F474147

General Info

Members Datasets Scaffolds Average Seq Length
671 315 667 155

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10043014|Ga0075367_100430144
Length 173
Sequence MSRSDVRLLSRAVEIKDIDMKQKSTLGLWLAIAFTAALLHGGPAFAIDNVTTSNAPDLTSVRAKVKAKDFKGALAELTPMLQTHQHADVYNLMGFSLRKTGDQQQAFTFYRKALDFDPQHKGALEYLGELYVETGQIEKARQNVAILKMLCPSGCEELADLEEAIAAAPAKAN

Samples

Sample ID Description Type Environment
1 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
2 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
3 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
4 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
220 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
221 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
312 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.16
Nodule 0.6
Rhizoplane 13.41
Rhizosphere 71.24
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10198634 3300001989 Bacteria 589
2 JGI24743J22301_10003589 3300001991 Bacteria 2467
3 JGI24750J21931_1004772 3300002070 Bacteria 1649
4 JGI24745J21846_1017131 3300002073 Bacteria 842
5 JGI24742J22300_10003072 3300002244 Bacteria 2702
6 JGI25159J45721_1024778 3300002987 Bacteria 1061
7 JGI25406J46586_10004605 3300003203 Bacteria 6419
8 JGI25165J46597_1000028 3300003214 Bacteria 325146
9 JGI25160J50197_1033099 3300003354 Bacteria 1305
10 Ga0055529_1003320 3300003763 Bacteria 2707
11 JGI25405J52794_10010926 3300003911 Bacteria 1734
12 JGI25405J52794_10028447 3300003911 Unclassified 1154
13 Ga0070676_10018217 3300005328 Bacteria 3888
14 Ga0070683_100196963 3300005329 Bacteria 1913
15 Ga0070683_100208787 3300005329 Bacteria 1855
16 Ga0070690_100013918 3300005330 Bacteria 4769
17 Ga0070690_100084460 3300005330 Bacteria 2081
18 Ga0070670_100001910 3300005331 Bacteria 17062
19 Ga0070670_100256415 3300005331 Bacteria 1524
20 Ga0070670_100360453 3300005331 Archaea 1278
21 Ga0070677_10590609 3300005333 Bacteria 614
22 Ga0068869_100175136 3300005334 Bacteria 1678
23 Ga0070666_10049186 3300005335 Bacteria 2832
24 Ga0070666_10082669 3300005335 Bacteria 2196
25 Ga0070666_10801000 3300005335 Bacteria 694
26 Ga0068868_100014860 3300005338 Bacteria 5746
27 Ga0068868_100069045 3300005338 Bacteria 2815
28 Ga0070689_100027535 3300005340 Bacteria 4285
29 Ga0070689_100083702 3300005340 Bacteria 2507
30 Ga0070689_100356474 3300005340 Bacteria 1228
31 Ga0070687_100047358 3300005343 Bacteria 2205
32 Ga0070687_100218784 3300005343 Unclassified 1165
33 Ga0070687_100339286 3300005343 Bacteria 966
34 Ga0070687_100384039 3300005343 Bacteria 916
35 Ga0070661_100122348 3300005344 Bacteria 1950
36 Ga0070661_100954600 3300005344 Bacteria 710
37 Ga0070692_10411575 3300005345 Unclassified 856
38 Ga0070669_100174579 3300005353 Bacteria 1677
39 Ga0070669_100832218 3300005353 Unclassified 786
40 Ga0070669_101518613 3300005353 Bacteria 582
41 Ga0070675_100102198 3300005354 Bacteria 2415
42 Ga0070671_100110782 3300005355 Bacteria 2306
43 Ga0070671_100187996 3300005355 Bacteria 1750
44 Ga0070671_100270746 3300005355 Bacteria 1444
45 Ga0070674_101220057 3300005356 Bacteria 668
46 Ga0070673_100142725 3300005364 Bacteria 2021
47 Ga0070673_100313996 3300005364 Unclassified 1383
48 Ga0070688_100166558 3300005365 Bacteria 1517
49 Ga0070688_100537198 3300005365 Bacteria 887
50 Ga0070688_100732368 3300005365 Bacteria 768
51 Ga0070659_100067305 3300005366 Bacteria 2840
52 Ga0070667_100013697 3300005367 Bacteria 6701
53 Ga0070709_10104819 3300005434 Bacteria 1890
54 Ga0070714_100009251 3300005435 Bacteria 7741
55 Ga0070713_100116409 3300005436 Bacteria 2337
56 Ga0070713_100804633 3300005436 Bacteria 901
57 Ga0070710_10255568 3300005437 Bacteria 1128
58 Ga0070710_11078029 3300005437 Bacteria 589
59 Ga0070701_10040627 3300005438 Bacteria 2366
60 Ga0070711_100007938 3300005439 Bacteria 6473
61 Ga0070705_100181035 3300005440 Bacteria 1428
62 Ga0070700_100007273 3300005441 Bacteria 5966
63 Ga0070663_100013463 3300005455 Bacteria 5218
64 Ga0070663_100147032 3300005455 Unclassified 1804
65 Ga0070663_100871939 3300005455 Bacteria 776
66 Ga0070678_100285451 3300005456 Bacteria 1397
67 Ga0070662_100007330 3300005457 Bacteria 7145
68 Ga0068867_100043619 3300005459 Bacteria 3283
69 Ga0070685_10495005 3300005466 Unclassified 864
70 Ga0070706_100683017 3300005467 Bacteria 953
71 Ga0070699_100044916 3300005518 Bacteria 3824
72 Ga0070699_100086784 3300005518 Unclassified 2731
73 Ga0070684_100024113 3300005535 Bacteria 5100
74 Ga0070684_100294234 3300005535 Bacteria 1489
75 Ga0068853_100279975 3300005539 Bacteria 1537
76 Ga0068853_100538223 3300005539 Bacteria 1105
77 Ga0070672_100019109 3300005543 Bacteria 4967
78 Ga0070672_100852828 3300005543 Unclassified 803
79 Ga0070686_100008180 3300005544 Bacteria 5852
80 Ga0070686_100137067 3300005544 Bacteria 1699
81 Ga0070695_100123321 3300005545 Bacteria 1776
82 Ga0070695_100506148 3300005545 Bacteria 935
83 Ga0070696_100695127 3300005546 Bacteria 828
84 Ga0070665_100066968 3300005548 Bacteria 3602
85 Ga0070665_100524982 3300005548 Bacteria 1196
86 Ga0070665_101508848 3300005548 Bacteria 680
87 Ga0070704_100123430 3300005549 Unclassified 1994
88 Ga0070704_100140835 3300005549 Bacteria 1883
89 Ga0070664_100248604 3300005564 Bacteria 1598
90 Ga0070664_100654000 3300005564 Bacteria 977
91 Ga0068857_100811931 3300005577 Bacteria 894
92 Ga0068854_100034569 3300005578 Bacteria 3532
93 Ga0068856_101104957 3300005614 Bacteria 810
94 Ga0068856_101320219 3300005614 Bacteria 736
95 Ga0070702_100020572 3300005615 Bacteria 3459
96 Ga0070702_100202425 3300005615 Bacteria 1315
97 Ga0068852_100065349 3300005616 Bacteria 3173
98 Ga0068859_100120528 3300005617 Bacteria 2690
99 Ga0068859_100147525 3300005617 Bacteria 2428
100 Ga0068859_100186031 3300005617 Unclassified 2161
101 Ga0068859_100442521 3300005617 Unclassified 1396
102 Ga0068864_100126329 3300005618 Bacteria 2292
103 Ga0068864_100363116 3300005618 Bacteria 1369
104 Ga0068866_10010810 3300005718 Bacteria 3925
105 Ga0068861_100011281 3300005719 Bacteria 6205
106 Ga0068861_100251487 3300005719 Bacteria 1508
107 Ga0068870_10003512 3300005840 Bacteria 6651
108 Ga0068863_100282731 3300005841 Unclassified 1608
109 Ga0068858_100032563 3300005842 Bacteria 4840
110 Ga0068858_100547276 3300005842 Bacteria 1120
111 Ga0068858_100958179 3300005842 Bacteria 838
112 Ga0068860_100041885 3300005843 Bacteria 4375
113 Ga0068860_101057255 3300005843 Bacteria 830
114 Ga0068862_100090331 3300005844 Bacteria 2666
115 Ga0068862_100856637 3300005844 Unclassified 891
116 Ga0081455_10003886 3300005937 Bacteria 17015
117 Ga0081455_10013304 3300005937 Bacteria 8144
118 Ga0081455_10018742 3300005937 Bacteria 6570
119 Ga0081455_10183573 3300005937 Bacteria 1582
120 Ga0081455_10272105 3300005937 Bacteria 1228
121 Ga0081455_10321140 3300005937 Bacteria 1103
122 Ga0081538_10020271 3300005981 Bacteria 4904
123 Ga0081540_1000245 3300005983 Bacteria 56994
124 Ga0081540_1004291 3300005983 Bacteria 10923
125 Ga0081540_1039856 3300005983 Unclassified 2457
126 Ga0081540_1042912 3300005983 Bacteria 2327
127 Ga0081539_10033395 3300005985 Bacteria 3135
128 Ga0081539_10049156 3300005985 Bacteria 2395
129 Ga0081539_10090932 3300005985 Unclassified 1577
130 Ga0081539_10172122 3300005985 Bacteria 1023
131 Ga0070717_10011616 3300006028 Bacteria 6696
132 Ga0070717_10164880 3300006028 Bacteria 1924
133 Ga0070717_10290752 3300006028 Unclassified 1451
134 Ga0075365_10008586 3300006038 Bacteria 5814
135 Ga0075365_10009939 3300006038 Bacteria 5510
136 Ga0075365_10055888 3300006038 Bacteria 2622
137 Ga0075365_10119318 3300006038 Bacteria 1818
138 Ga0075365_10125591 3300006038 Bacteria 1773
139 Ga0075365_10150464 3300006038 Bacteria 1619
140 Ga0075365_10509971 3300006038 Bacteria 850
141 Ga0075365_10737306 3300006038 Unclassified 696
142 Ga0075368_10059132 3300006042 Bacteria 1533
143 Ga0075368_10080152 3300006042 Bacteria 1328
144 Ga0075368_10100105 3300006042 Unclassified 1190
145 Ga0075363_100007933 3300006048 Bacteria 4917
146 Ga0075363_100022852 3300006048 Bacteria 3165
147 Ga0075363_100030948 3300006048 Bacteria 2772
148 Ga0075363_100049492 3300006048 Unclassified 2238
149 Ga0075363_100273578 3300006048 Bacteria 976
150 Ga0075363_100283071 3300006048 Bacteria 959
151 Ga0075364_10003031 3300006051 Bacteria 9487
152 Ga0075364_10007069 3300006051 Bacteria 6636
153 Ga0075364_10025002 3300006051 Bacteria 3798
154 Ga0075364_10037264 3300006051 Bacteria 3148
155 Ga0075364_10163586 3300006051 Bacteria 1503
156 Ga0075364_10241864 3300006051 Bacteria 1226
157 Ga0075364_10263272 3300006051 Unclassified 1172
158 Ga0070715_10172234 3300006163 Bacteria 1079
159 Ga0070715_10461583 3300006163 Unclassified 719
160 Ga0070715_10731852 3300006163 Bacteria 594
161 Ga0070716_100007056 3300006173 Bacteria 5514
162 Ga0070716_100125323 3300006173 Unclassified 1615
163 Ga0070716_100146413 3300006173 Bacteria 1514
164 Ga0070716_100367275 3300006173 Bacteria 1024
165 Ga0070716_100588097 3300006173 Bacteria 835
166 Ga0070716_101265627 3300006173 Unclassified 595
167 Ga0070712_100001758 3300006175 Bacteria 13261
168 Ga0070712_100352172 3300006175 Bacteria 1205
169 Ga0070712_100967831 3300006175 Bacteria 736
170 Ga0075362_10019895 3300006177 Bacteria 2799
171 Ga0075362_10020464 3300006177 Bacteria 2764
172 Ga0075362_10036813 3300006177 Bacteria 2142
173 Ga0075362_10057502 3300006177 Unclassified 1753
174 Ga0075367_10001828 3300006178 Bacteria 9373
175 Ga0075367_10004657 3300006178 Bacteria 6727
176 Ga0075367_10007981 3300006178 Bacteria 5457
177 Ga0075367_10043014 3300006178 Bacteria 2645
178 Ga0075367_10066299 3300006178 Bacteria 2163
179 Ga0075367_10255499 3300006178 Bacteria 1099
180 Ga0075367_10260671 3300006178 Bacteria 1088
181 Ga0075367_10330271 3300006178 Bacteria 961
182 Ga0075369_10021741 3300006186 Bacteria 2640
183 Ga0075369_10048892 3300006186 Bacteria 1826
184 Ga0075369_10182922 3300006186 Bacteria 964
185 Ga0075369_10396823 3300006186 Unclassified 650
186 Ga0075366_10056361 3300006195 Bacteria 2334
187 Ga0075366_10461541 3300006195 Unclassified 784
188 Ga0097621_100016214 3300006237 Bacteria 5627
189 Ga0075370_10061104 3300006353 Bacteria 2146
190 Ga0075370_10374286 3300006353 Bacteria 853
191 Ga0075370_10639621 3300006353 Unclassified 645
192 Ga0068871_100043533 3300006358 Bacteria 3606
193 Ga0075428_100062375 3300006844 Bacteria 4081
194 Ga0075428_100065772 3300006844 Bacteria 3970
195 Ga0075428_100144544 3300006844 Bacteria 2585
196 Ga0075428_100174653 3300006844 Bacteria 2327
197 Ga0075430_100032718 3300006846 Bacteria 4413
198 Ga0075430_100045229 3300006846 Bacteria 3720
199 Ga0075431_100023249 3300006847 Bacteria 6341
200 Ga0075431_100054699 3300006847 Bacteria 4115
201 Ga0075433_10018481 3300006852 Bacteria 5795
202 Ga0075433_10206011 3300006852 Unclassified 1748
203 Ga0075433_10365089 3300006852 Bacteria 1275
204 Ga0075434_100016976 3300006871 Bacteria 7003
205 Ga0075434_100034613 3300006871 Bacteria 4989
206 Ga0075434_100050371 3300006871 Bacteria 4137
207 Ga0075434_100508608 3300006871 Unclassified 1225
208 Ga0075434_100956548 3300006871 Bacteria 871
209 Ga0075434_101765230 3300006871 Bacteria 626
210 Ga0075429_100012864 3300006880 Bacteria 7260
211 Ga0075429_100201436 3300006880 Bacteria 1744
212 Ga0075429_100425590 3300006880 Unclassified 1163
213 Ga0075429_100799895 3300006880 Bacteria 826
214 Ga0075436_101400004 3300006914 Bacteria 530
215 Ga0097620_100120529 3300006931 Bacteria 2690
216 Ga0097620_100147534 3300006931 Bacteria 2428
217 Ga0097620_100186017 3300006931 Unclassified 2161
218 Ga0097620_100442478 3300006931 Unclassified 1396
219 Ga0075435_100038695 3300007076 Bacteria 3803
220 Ga0075435_100065738 3300007076 Unclassified 2949
221 Ga0075435_100267747 3300007076 Bacteria 1457
222 Ga0075435_101173153 3300007076 Bacteria 672
223 Ga0099794_10028683 3300007265 Bacteria 2589
224 Ga0099795_10001119 3300007788 Bacteria 5577
225 Ga0105240_10497632 3300009093 Bacteria 1356
226 Ga0111539_10101233 3300009094 Bacteria 3383
227 Ga0111539_10115691 3300009094 Bacteria 3144
228 Ga0111539_10242870 3300009094 Bacteria 2097
229 Ga0111539_10838454 3300009094 Bacteria 1070
230 Ga0105245_10000301 3300009098 Bacteria 47401
231 Ga0105245_10058772 3300009098 Bacteria 3461
232 Ga0105245_10407347 3300009098 Bacteria 1360
233 Ga0105245_12264343 3300009098 Bacteria 597
234 Ga0105247_10006172 3300009101 Bacteria 7437
235 Ga0105247_11527821 3300009101 Bacteria 545
236 Ga0114129_10011285 3300009147 Bacteria 12732
237 Ga0114129_10038749 3300009147 Bacteria 6719
238 Ga0114129_10039522 3300009147 Bacteria 6652
239 Ga0114129_10261955 3300009147 Unclassified 2317
240 Ga0114129_10530565 3300009147 Bacteria 1533
241 Ga0105243_10140290 3300009148 Bacteria 2061
242 Ga0105243_10220173 3300009148 Bacteria 1677
243 Ga0105242_10050357 3300009176 Bacteria 3391
244 Ga0105242_10350170 3300009176 Bacteria 1364
245 Ga0105242_11104558 3300009176 Bacteria 807
246 Ga0105242_11167055 3300009176 Bacteria 788
247 Ga0105242_11904560 3300009176 Bacteria 635
248 Ga0105248_10010977 3300009177 Bacteria 9994
249 Ga0105248_10012485 3300009177 Bacteria 9370
250 Ga0105248_10238720 3300009177 Bacteria 2046
251 Ga0105237_10035802 3300009545 Bacteria 5021
252 Ga0105237_10243475 3300009545 Bacteria 1800
253 Ga0105238_10016854 3300009551 Bacteria 7411
254 Ga0105238_10115144 3300009551 Bacteria 2668
255 Ga0105238_10158173 3300009551 Bacteria 2241
256 Ga0105249_10065054 3300009553 Bacteria 3353
257 Ga0105249_10780461 3300009553 Unclassified 1019
258 Ga0099796_10000877 3300010159 Bacteria 5567
259 Ga0105239_10106857 3300010375 Unclassified 3100
260 Ga0105239_10346130 3300010375 Bacteria 1678
261 Ga0105239_11071227 3300010375 Unclassified 928
262 Ga0105246_10023628 3300011119 Bacteria 3980
263 Ga0105246_10077777 3300011119 Unclassified 2355
264 Ga0105246_10205392 3300011119 Bacteria 1534
265 Ga0105246_11439627 3300011119 Bacteria 644
266 Ga0157336_1010167 3300012477 Bacteria 712
267 Ga0157370_10323436 3300013104 Bacteria 1422
268 Ga0157369_10067717 3300013105 Bacteria 3837
269 Ga0157374_10002466 3300013296 Bacteria 15626
270 Ga0157374_11503611 3300013296 Unclassified 697
271 Ga0157378_10145081 3300013297 Bacteria 2207
272 Ga0157378_10849898 3300013297 Bacteria 941
273 Ga0157378_11005618 3300013297 Unclassified 868
274 Ga0163162_10638510 3300013306 Unclassified 1189
275 Ga0157372_11548250 3300013307 Bacteria 764
276 Ga0157375_10045749 3300013308 Bacteria 4260
277 Ga0157375_10307779 3300013308 Bacteria 1748
278 Ga0157375_10797496 3300013308 Unclassified 1093
279 Ga0163163_10024687 3300014325 Bacteria 5724
280 Ga0163163_10031093 3300014325 Bacteria 5150
281 Ga0157380_10044463 3300014326 Bacteria 3481
282 Ga0157380_10279823 3300014326 Bacteria 1526
283 Ga0157380_10428025 3300014326 Bacteria 1264
284 Ga0157380_10922422 3300014326 Unclassified 901
285 Ga0157377_10012638 3300014745 Bacteria 4250
286 Ga0157379_10039921 3300014968 Bacteria 4188
287 Ga0157379_11441810 3300014968 Bacteria 668
288 Ga0157376_10263600 3300014969 Bacteria 1615
289 Ga0163161_10039612 3300017792 Bacteria 3383
290 Ga0163161_10188804 3300017792 Bacteria 1583
291 Ga0163161_10548376 3300017792 Bacteria 947
292 Ga0213872_10089660 3300021361 Unclassified 1377
293 Ga0209148_1000037 3300025254 Bacteria 494767
294 Ga0209233_1000087 3300025261 Bacteria 325225
295 Ga0209455_1000036 3300025272 Bacteria 473309
296 Ga0209130_1000909 3300025284 Bacteria 23891
297 Ga0207426_1000366 3300025302 Bacteria 80234
298 Ga0207697_10042033 3300025315 Bacteria 1877
299 Ga0207697_10194933 3300025315 Bacteria 890
300 Ga0207692_10040961 3300025898 Bacteria 2290
301 Ga0207692_10048516 3300025898 Unclassified 2138
302 Ga0207692_10330109 3300025898 Bacteria 936
303 Ga0207710_10015598 3300025900 Bacteria 3214
304 Ga0207688_10000117 3300025901 Bacteria 32379
305 Ga0207680_10050728 3300025903 Bacteria 2477
306 Ga0207647_10024618 3300025904 Bacteria 3968
307 Ga0207647_10216020 3300025904 Bacteria 1106
308 Ga0207685_10011886 3300025905 Unclassified 2637
309 Ga0207699_10011887 3300025906 Bacteria 4412
310 Ga0207699_10234770 3300025906 Bacteria 1257
311 Ga0207645_10018258 3300025907 Bacteria 4619
312 Ga0207643_10000291 3300025908 Bacteria 34985
313 Ga0207684_10060885 3300025910 Bacteria 3206
314 Ga0207695_11238063 3300025913 Bacteria 627
315 Ga0207671_10060060 3300025914 Bacteria 2820
316 Ga0207671_10177522 3300025914 Bacteria 1656
317 Ga0207693_10006232 3300025915 Bacteria 9894
318 Ga0207693_10044042 3300025915 Bacteria 3507
319 Ga0207693_10238127 3300025915 Bacteria 1429
320 Ga0207663_10012786 3300025916 Bacteria 4546
321 Ga0207663_10612737 3300025916 Bacteria 856
322 Ga0207662_10004840 3300025918 Bacteria 7122
323 Ga0207657_10054531 3300025919 Bacteria 3456
324 Ga0207649_10030096 3300025920 Bacteria 3212
325 Ga0207649_10563100 3300025920 Bacteria 873
326 Ga0207646_10427537 3300025922 Bacteria 1195
327 Ga0207681_10048673 3300025923 Bacteria 2862
328 Ga0207694_10070158 3300025924 Bacteria 2737
329 Ga0207694_10212409 3300025924 Bacteria 1576
330 Ga0207650_10007981 3300025925 Bacteria 7216
331 Ga0207650_10256966 3300025925 Bacteria 1416
332 Ga0207650_10445359 3300025925 Bacteria 1077
333 Ga0207659_10016345 3300025926 Bacteria 4827
334 Ga0207687_10002101 3300025927 Bacteria 13619
335 Ga0207687_10183490 3300025927 Bacteria 1623
336 Ga0207687_10790182 3300025927 Bacteria 809
337 Ga0207700_10000458 3300025928 Bacteria 23936
338 Ga0207700_10108611 3300025928 Unclassified 2228
339 Ga0207700_10195977 3300025928 Bacteria 1700
340 Ga0207700_10200849 3300025928 Bacteria 1680
341 Ga0207664_10031202 3300025929 Bacteria 4076
342 Ga0207644_10159770 3300025931 Bacteria 1751
343 Ga0207644_10180125 3300025931 Bacteria 1655
344 Ga0207644_10246499 3300025931 Bacteria 1424
345 Ga0207644_10361623 3300025931 Unclassified 1181
346 Ga0207690_10056792 3300025932 Bacteria 2642
347 Ga0207690_10059084 3300025932 Bacteria 2597
348 Ga0207706_10022984 3300025933 Bacteria 5599
349 Ga0207686_10007270 3300025934 Bacteria 5958
350 Ga0207686_10114180 3300025934 Bacteria 1827
351 Ga0207686_11475772 3300025934 Bacteria 560
352 Ga0207709_10071644 3300025935 Bacteria 2202
353 Ga0207670_10195365 3300025936 Bacteria 1534
354 Ga0207670_10284947 3300025936 Bacteria 1289
355 Ga0207670_10311262 3300025936 Bacteria 1236
356 Ga0207704_10278966 3300025938 Bacteria 1269
357 Ga0207665_10006165 3300025939 Bacteria 7962
358 Ga0207665_10192106 3300025939 Unclassified 1484
359 Ga0207665_10337792 3300025939 Bacteria 1134
360 Ga0207665_10569866 3300025939 Bacteria 881
361 Ga0207665_10636485 3300025939 Bacteria 835
362 Ga0207691_10012255 3300025940 Bacteria 8219
363 Ga0207711_10055291 3300025941 Bacteria 3408
364 Ga0207711_10168732 3300025941 Bacteria 1985
365 Ga0207689_10018113 3300025942 Bacteria 5948
366 Ga0207661_10228448 3300025944 Bacteria 1647
367 Ga0207679_10065067 3300025945 Bacteria 2727
368 Ga0207679_10409974 3300025945 Unclassified 1194
369 Ga0207667_10533632 3300025949 Bacteria 1188
370 Ga0207651_10034648 3300025960 Bacteria 3272
371 Ga0207651_10261877 3300025960 Bacteria 1420
372 Ga0207712_10066107 3300025961 Bacteria 2584
373 Ga0207712_10435152 3300025961 Unclassified 1109
374 Ga0207668_10005839 3300025972 Bacteria 7248
375 Ga0207668_11275738 3300025972 Unclassified 661
376 Ga0207640_10013472 3300025981 Bacteria 4688
377 Ga0207640_11015359 3300025981 Bacteria 730
378 Ga0207658_10088942 3300025986 Bacteria 2389
379 Ga0207677_10019084 3300026023 Bacteria 4132
380 Ga0207677_10028823 3300026023 Bacteria 3519
381 Ga0207703_10050960 3300026035 Bacteria 3352
382 Ga0207703_10324521 3300026035 Bacteria 1411
383 Ga0207639_10635195 3300026041 Bacteria 987
384 Ga0207678_10121486 3300026067 Bacteria 2229
385 Ga0207678_10167598 3300026067 Bacteria 1875
386 Ga0207678_10802073 3300026067 Bacteria 831
387 Ga0207708_10001828 3300026075 Bacteria 15698
388 Ga0207708_11258456 3300026075 Bacteria 648
389 Ga0207702_10283733 3300026078 Bacteria 1566
390 Ga0207702_10510880 3300026078 Bacteria 1172
391 Ga0207702_12194360 3300026078 Bacteria 541
392 Ga0207641_10072273 3300026088 Bacteria 2970
393 Ga0207641_10360527 3300026088 Bacteria 1388
394 Ga0207641_11246540 3300026088 Bacteria 744
395 Ga0207648_10028571 3300026089 Bacteria 4944
396 Ga0207676_10036735 3300026095 Bacteria 3729
397 Ga0207676_10557770 3300026095 Bacteria 1095
398 Ga0207674_10504821 3300026116 Bacteria 1168
399 Ga0207675_100023684 3300026118 Bacteria 5712
400 Ga0207675_100037669 3300026118 Bacteria 4511
401 Ga0207675_100799042 3300026118 Bacteria 957
402 Ga0207698_10311949 3300026142 Bacteria 1469
403 Ga0209588_1064242 3300027671 Bacteria 1186
404 Ga0209813_10007840 3300027866 Bacteria 2673
405 Ga0207428_10519932 3300027907 Unclassified 863
406 Ga0268266_10050992 3300028379 Bacteria 3551
407 Ga0268266_10271728 3300028379 Bacteria 1574
408 Ga0268265_10173676 3300028380 Bacteria 1844
409 Ga0268265_10875467 3300028380 Unclassified 880
410 Ga0268264_10037501 3300028381 Bacteria 3996
411 Ga0268264_10219335 3300028381 Bacteria 1750
412 Ga0268264_10839258 3300028381 Unclassified 920
413 Ga0373923_0316902 3300035111 Bacteria 740
414 Ga0373936_0052186 3300035113 Bacteria 1656
415 Ga0373943_0398493 3300035170 Bacteria 794
416 Ga0373946_0019631 3300035171 Bacteria 2605
417 Ga0373946_0325964 3300035171 Unclassified 764
418 Ga0373931_0147176 3300035691 Bacteria 1370
419 Ga0373931_0148597 3300035691 Bacteria 1364
420 Ga0373931_0191953 3300035691 Unclassified 1216
421 Ga0373931_0346757 3300035691 Bacteria 929
422 Ga0373931_0954204 3300035691 Unclassified 578
423 Ga0373935_0071894 3300035692 Unclassified 2233
424 Ga0373935_0264463 3300035692 Bacteria 1207
425 Ga0373927_0024586 3300035695 Bacteria 3938
426 Ga0373927_0211595 3300035695 Bacteria 1273
427 Ga0373947_0005360 3300035725 Bacteria 7485
428 Ga0373925_0394981 3300037068 Unclassified 1127
429 Ga0395900_1261997 3300037418 Unclassified 653
430 Ga0395905_0118821 3300037471 Unclassified 2485
431 Ga0395901_0568228 3300038443 Unclassified 1147
432 Ga0436365_1098622 3300039437 Bacteria 3912
433 Ga0436360_1293235 3300039438 Bacteria 545
434 Ga0436361_0416025 3300039447 Bacteria 7315
435 Ga0436363_0085767 3300039450 Unclassified 2132
436 Ga0436363_0090918 3300039450 Bacteria 1892
437 Ga0436362_0106370 3300039453 Bacteria 575
438 Ga0436362_0276156 3300039453 Bacteria 667
439 Ga0439466_0112665 3300041411 Bacteria 843
440 Ga0451795_0313201 3300041456 Unclassified 672
441 Ga0451802_1451856 3300041460 Unclassified 783
442 Ga0450907_004366 3300042146 Bacteria 2445
443 Ga0495617_099212 3300046452 Bacteria 947
444 Ga0495603_0020414 3300046455 Bacteria 4015
445 Ga0495590_0126746 3300046457 Bacteria 917
446 Ga0495591_066331 3300046458 Bacteria 947
447 Ga0495629_0075660 3300046459 Bacteria 2351
448 Ga0495638_0553777 3300046460 Bacteria 571
449 Ga0495582_0220822 3300046473 Unclassified 1084
450 Ga0495605_0025009 3300046474 Bacteria 3117
451 Ga0495605_0130673 3300046474 Bacteria 1133
452 Ga0495662_0102954 3300046476 Bacteria 1397
453 Ga0495584_0014161 3300046491 Bacteria 4064
454 Ga0495584_0015339 3300046491 Unclassified 3904
455 Ga0495585_0004639 3300046492 Bacteria 8872
456 Ga0495594_0083137 3300046499 Bacteria 1789
457 Ga0495596_0021949 3300046500 Bacteria 2601
458 Ga0495596_0229315 3300046500 Bacteria 721
459 Ga0495607_0182328 3300046501 Bacteria 1052
460 Ga0495618_0517197 3300046514 Unclassified 718
461 Ga0495620_0097447 3300046515 Bacteria 1175
462 Ga0495630_0309993 3300046517 Bacteria 1206
463 Ga0495631_0039464 3300046518 Unclassified 2095
464 Ga0495631_0201996 3300046518 Bacteria 850
465 Ga0495637_0057033 3300046520 Bacteria 1615
466 Ga0495663_0003607 3300046525 Bacteria 4446
467 Ga0495665_0071093 3300046531 Unclassified 1833
468 Ga0495640_0014540 3300046533 Bacteria 5950
469 Ga0495598_0022026 3300046537 Bacteria 1701
470 Ga0495621_0032439 3300046539 Unclassified 1796
471 Ga0495621_0372604 3300046539 Unclassified 602
472 Ga0495633_0114777 3300046558 Bacteria 1248
473 Ga0495611_0158563 3300046648 Bacteria 1057
474 Ga0495625_0185052 3300046660 Bacteria 1383
475 Ga0495659_0181370 3300046664 Unclassified 857
476 Ga0495661_0493282 3300046665 Bacteria 585
477 Ga0495647_0016089 3300046681 Bacteria 2630
478 Ga0495647_0191018 3300046681 Unclassified 895
479 Ga0495658_0115688 3300046683 Bacteria 1617
480 Ga0495613_0043735 3300046689 Bacteria 3314
481 Ga0495624_0039728 3300046690 Bacteria 3016
482 Ga0495671_0074213 3300046692 Bacteria 1669
483 Ga0495649_0019711 3300046694 Bacteria 3787
484 Ga0495589_0051663 3300046794 Bacteria 2032
485 Ga0495660_0276742 3300046810 Bacteria 769
486 Ga0495581_0086007 3300047315 Bacteria 1823
487 Ga0495581_0098661 3300047315 Unclassified 1697
488 Ga0495581_0124534 3300047315 Bacteria 1501
489 Ga0495581_0498423 3300047315 Bacteria 708
490 Ga0495674_0403046 3300047319 Unclassified 1104
491 Ga0495672_0038267 3300047320 Bacteria 2928
492 Ga0495676_0178746 3300047321 Bacteria 1488
493 Ga0495676_0182041 3300047321 Unclassified 1472
494 Ga0495676_0426215 3300047321 Bacteria 877
495 Ga0495683_0291312 3300047323 Bacteria 704
496 Ga0495593_0039641 3300047673 Bacteria 2539
497 Ga0495614_0266897 3300048089 Bacteria 786
498 Ga0496100_0004121 3300048903 Bacteria 7665
499 Ga0496100_0034871 3300048903 Bacteria 3161
500 Ga0496100_0138972 3300048903 Unclassified 1719
501 Ga0496101_0002301 3300048904 Bacteria 11683
502 Ga0496101_0006780 3300048904 Bacteria 7384
503 Ga0496101_0109660 3300048904 Bacteria 2076
504 Ga0496101_0163726 3300048904 Unclassified 1707
505 Ga0496101_0282178 3300048904 Unclassified 1298
506 Ga0496101_0578467 3300048904 Bacteria 888
507 Ga0496102_0001907 3300048905 Bacteria 17978
508 Ga0496102_0016244 3300048905 Bacteria 6504
509 Ga0496102_0051818 3300048905 Bacteria 3738
510 Ga0496102_0236631 3300048905 Bacteria 1722
511 Ga0496102_0494203 3300048905 Bacteria 1145
512 Ga0496103_0005487 3300048906 Bacteria 7583
513 Ga0496103_0070261 3300048906 Bacteria 2190
514 Ga0496103_0224945 3300048906 Unclassified 1207
515 Ga0496104_0001787 3300048907 Bacteria 18622
516 Ga0496104_0003321 3300048907 Bacteria 13883
517 Ga0496104_0013709 3300048907 Bacteria 7310
518 Ga0496104_0019430 3300048907 Bacteria 6216
519 Ga0496104_0090210 3300048907 Bacteria 2928
520 Ga0496104_0254604 3300048907 Bacteria 1668
521 Ga0496105_0005141 3300048908 Bacteria 9925
522 Ga0496105_0011008 3300048908 Bacteria 7130
523 Ga0496105_0013382 3300048908 Bacteria 6511
524 Ga0496105_0320515 3300048908 Bacteria 1242
525 Ga0496106_0001903 3300048909 Bacteria 15629
526 Ga0496106_0081808 3300048909 Bacteria 2481
527 Ga0496106_0130364 3300048909 Bacteria 1971
528 Ga0496106_0380848 3300048909 Bacteria 1134
529 Ga0496106_0714330 3300048909 Bacteria 798
530 Ga0496107_0000742 3300048910 Bacteria 18683
531 Ga0496107_0001577 3300048910 Bacteria 14176
532 Ga0496107_0135608 3300048910 Bacteria 1818
533 Ga0496107_0224009 3300048910 Bacteria 1399
534 Ga0496107_0548098 3300048910 Unclassified 857
535 Ga0496108_0004907 3300048911 Bacteria 10804
536 Ga0496108_0005149 3300048911 Bacteria 10570
537 Ga0496108_0012312 3300048911 Bacteria 6957
538 Ga0496108_0023055 3300048911 Bacteria 5121
539 Ga0496108_0117243 3300048911 Bacteria 2281
540 Ga0496108_0293757 3300048911 Bacteria 1415
541 Ga0496108_0680538 3300048911 Bacteria 893
542 Ga0496108_0781961 3300048911 Bacteria 824
543 Ga0496109_0001273 3300048912 Bacteria 20907
544 Ga0496109_0002185 3300048912 Bacteria 16231
545 Ga0496109_0005798 3300048912 Bacteria 10340
546 Ga0496109_0007347 3300048912 Bacteria 9319
547 Ga0496109_0012097 3300048912 Bacteria 7439
548 Ga0496109_0589290 3300048912 Unclassified 1048
549 Ga0496110_0001267 3300048913 Bacteria 18072
550 Ga0496110_0001439 3300048913 Bacteria 17212
551 Ga0496110_0008474 3300048913 Bacteria 8276
552 Ga0496110_0010029 3300048913 Bacteria 7686
553 Ga0496110_0128093 3300048913 Bacteria 2291
554 Ga0496110_0154263 3300048913 Unclassified 2080
555 Ga0496110_0189820 3300048913 Unclassified 1866
556 Ga0496110_0439868 3300048913 Unclassified 1188
557 Ga0496111_0004907 3300048914 Bacteria 8499
558 Ga0496111_0005865 3300048914 Bacteria 7920
559 Ga0496111_0011164 3300048914 Bacteria 6046
560 Ga0496111_0026573 3300048914 Bacteria 4088
561 Ga0496111_0076354 3300048914 Unclassified 2442
562 Ga0496111_0239192 3300048914 Bacteria 1348
563 Ga0496112_0002066 3300048915 Bacteria 15919
564 Ga0496112_0021566 3300048915 Bacteria 6127
565 Ga0496112_0139833 3300048915 Unclassified 2391
566 Ga0496112_0271257 3300048915 Unclassified 1645
567 Ga0496112_0419389 3300048915 Unclassified 1277
568 Ga0496112_0536869 3300048915 Bacteria 1104
569 Ga0496112_0570047 3300048915 Bacteria 1065
570 Ga0496113_0000303 3300048916 Bacteria 23409
571 Ga0496113_0032411 3300048916 Bacteria 3798
572 Ga0496113_0165545 3300048916 Bacteria 1749
573 Ga0496113_0171762 3300048916 Bacteria 1717
574 Ga0496113_0190595 3300048916 Bacteria 1627
575 Ga0496113_0277496 3300048916 Unclassified 1340
576 Ga0496113_0279872 3300048916 Bacteria 1334
577 Ga0496113_1051702 3300048916 Bacteria 640
578 Ga0496114_0551285 3300048917 Bacteria 1018
579 Ga0496114_1338404 3300048917 Unclassified 603
580 Ga0496114_1525596 3300048917 Bacteria 556
581 Ga0496115_0015774 3300048918 Bacteria 5738
582 Ga0496115_0018692 3300048918 Bacteria 5327
583 Ga0496115_0041111 3300048918 Bacteria 3677
584 Ga0496115_0051494 3300048918 Bacteria 3302
585 Ga0496115_0097278 3300048918 Bacteria 2410
586 Ga0496117_0140566 3300048920 Bacteria 1447
587 Ga0501040_1296955 3300049576 Bacteria 528
588 Ga0501067_0058873 3300049583 Bacteria 2127
589 Ga0501069_0165456 3300049585 Unclassified 1275
590 Ga0501074_1253733 3300049590 Bacteria 520
591 Ga0501079_0176397 3300049741 Unclassified 1667
592 Ga0501081_0552876 3300049743 Bacteria 860
593 Ga0501083_0298895 3300049744 Bacteria 1047
594 nmdc:mga03683_111289_c1 3300050489 Unclassified 1211
595 nmdc:mga03683_133716_c1 3300050489 Bacteria 1111
596 nmdc:mga03683_96704_c1 3300050489 Bacteria 1294
597 nmdc:mga03n38_10892_c1 3300050490 Bacteria 3367
598 nmdc:mga03n38_16037_c1 3300050490 Unclassified 2907
599 nmdc:mga03n38_292890_c1 3300050490 Unclassified 872
600 nmdc:mga03n38_59336_c1 3300050490 Bacteria 1736
601 nmdc:mga03n38_61205_c1 3300050490 Bacteria 1714
602 nmdc:mga00v17_19320_c1 3300050491 Unclassified 3889
603 nmdc:mga00v17_196555_c1 3300050491 Bacteria 1303
604 nmdc:mga00v17_229611_c1 3300050491 Bacteria 1202
605 nmdc:mga00v17_25999_c1 3300050491 Bacteria 3406
606 nmdc:mga00v17_260268_c1 3300050491 Unclassified 1125
607 nmdc:mga00v17_3784_c1 3300050491 Bacteria 7811
608 nmdc:mga0yw44_167927_c1 3300050492 Bacteria 1440
609 nmdc:mga0yw44_17544_c1 3300050492 Bacteria 3898
610 nmdc:mga0yw44_176099_c1 3300050492 Bacteria 1406
611 nmdc:mga0yw44_222330_c1 3300050492 Bacteria 1252
612 nmdc:mga0yw44_41949_c1 3300050492 Bacteria 2726
613 nmdc:mga0yw44_553900_c1 3300050492 Bacteria 781
614 nmdc:mga0yw44_68052_c1 3300050492 Bacteria 2202
615 nmdc:mga0yw44_697023_c1 3300050492 Unclassified 690
616 nmdc:mga0yw44_8043_c1 3300050492 Bacteria 5230
617 nmdc:mga0k408_105348_c1 3300050493 Bacteria 1665
618 nmdc:mga06z11_14465_c1 3300050494 Bacteria 3495
619 nmdc:mga06z11_269318_c1 3300050494 Bacteria 1007
620 nmdc:mga06z11_3590_c1 3300050494 Bacteria 6012
621 nmdc:mga06z11_49946_c1 3300050494 Bacteria 2136
622 nmdc:mga06z11_89111_c1 3300050494 Bacteria 1672
623 nmdc:mga04h51_2637_c1 3300050495 Bacteria 4272
624 nmdc:mga04h51_489262_c1 3300050495 Archaea 524
625 nmdc:mga07m45_254637_c1 3300050496 Unclassified 1021
626 nmdc:mga07m45_298086_c1 3300050496 Bacteria 938
627 nmdc:mga05p37_24411_c1 3300050507 Bacteria 7347
628 nmdc:mga05p37_308112_c1 3300050507 Unclassified 1878
629 nmdc:mga05p37_45362_c1 3300050507 Bacteria 5407
630 nmdc:mga05p37_510362_c1 3300050507 Bacteria 1377
631 nmdc:mga05p37_865771_c1 3300050507 Unclassified 979
632 nmdc:mga09592_210496_c1 3300050508 Bacteria 1684
633 nmdc:mga09592_241130_c1 3300050508 Bacteria 1566
634 nmdc:mga09592_388073_c1 3300050508 Unclassified 1207
635 nmdc:mga0qj67_62573_c1 3300050509 Bacteria 2957
636 nmdc:mga06r32_207384_c1 3300050510 Bacteria 1948
637 nmdc:mga06r32_207606_c1 3300050510 Unclassified 1947
638 nmdc:mga06r32_39256_c1 3300050510 Bacteria 4491
639 nmdc:mga08y16_181244_c1 3300050511 Unclassified 2187
640 nmdc:mga08y16_795482_c1 3300050511 Bacteria 939
641 nmdc:mga08y16_886865_c1 3300050511 Bacteria 879
642 nmdc:mga0n895_126600_c1 3300050512 Bacteria 2578
643 nmdc:mga0n895_47877_c1 3300050512 Bacteria 4182
644 nmdc:mga0n895_773897_c1 3300050512 Bacteria 952
645 nmdc:mga0n895_832661_c1 3300050512 Bacteria 911
646 nmdc:mga0rr50_275124_c1 3300050513 Bacteria 1404
647 nmdc:mga0rr50_30637_c1 3300050513 Bacteria 3811
648 nmdc:mga0rr50_323808_c1 3300050513 Unclassified 1292
649 nmdc:mga0rr50_85516_c1 3300050513 Unclassified 2444
650 nmdc:mga08x19_223834_c1 3300050514 Bacteria 1293
651 nmdc:mga0a205_1002437_c1 3300050515 Bacteria 682
652 nmdc:mga0a205_129262_c1 3300050515 Bacteria 2426
653 nmdc:mga0a205_296570_c1 3300050515 Bacteria 1490
654 nmdc:mga0sz30_206786_c1 3300050516 Bacteria 872
655 nmdc:mga0sz30_42439_c1 3300050516 Bacteria 1914
656 Ga0495601_0048960 3300053077 Bacteria 2663
657 Ga0495601_0214700 3300053077 Bacteria 1256
658 Ga0495601_0619359 3300053077 Bacteria 694
659 Ga0495655_0008425 3300053083 Bacteria 1958
660 Ga0495619_0370517 3300053085 Bacteria 990
661 Ga0495619_0409077 3300053085 Unclassified 936
662 Ga0495619_0814507 3300053085 Bacteria 631
663 Ga0500578_0588929 3300053086 Bacteria 613
664 Ga0500562_153995 3300053108 Unclassified 626
665 Ga0500608_303625 3300053122 Bacteria 591
666 Ga0500616_0085862 3300053153 Bacteria 1571
667 Ga0500633_0132167 3300053160 Bacteria 932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10216020 Ga0207647_102160202 123
2 3300048914 Ga0496111_0076354 Ga0496111_0076354_34_456 133
3 3300048917 Ga0496114_1338404 Ga0496114_1338404_164_586 133
4 3300049741 Ga0501079_0176397 Ga0501079_0176397_525_989 133
5 3300005455 Ga0070663_100871939 Ga0070663_1008719391 134
6 3300005539 Ga0068853_100538223 Ga0068853_1005382232 134
7 3300005548 Ga0070665_100524982 Ga0070665_1005249822 134
8 3300005614 Ga0068856_101320219 Ga0068856_1013202191 134
9 3300006042 Ga0075368_10080152 Ga0075368_100801522 134
10 3300006051 Ga0075364_10025002 Ga0075364_100250023 134
11 3300006178 Ga0075367_10066299 Ga0075367_100662992 134
12 3300006186 Ga0075369_10182922 Ga0075369_101829221 134
13 3300009551 Ga0105238_10115144 Ga0105238_101151442 134
14 3300013104 Ga0157370_10323436 Ga0157370_103234362 134
15 3300013105 Ga0157369_10067717 Ga0157369_100677172 134
16 3300025913 Ga0207695_11238063 Ga0207695_112380631 134
17 3300026067 Ga0207678_10802073 Ga0207678_108020731 134
18 3300050491 nmdc:mga00v17_25999_c1 nmdc:mga00v17_25999_c1_2372_2851 134
19 3300050492 nmdc:mga0yw44_68052_c1 nmdc:mga0yw44_68052_c1_1398_1877 134
20 3300050516 nmdc:mga0sz30_206786_c1 nmdc:mga0sz30_206786_c1_225_704 134
21 3300005335 Ga0070666_10801000 Ga0070666_108010001 135
22 3300005343 Ga0070687_100339286 Ga0070687_1003392861 135
23 3300005344 Ga0070661_100954600 Ga0070661_1009546001 135
24 3300017792 Ga0163161_10548376 Ga0163161_105483762 135
25 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028278 136
26 3300025261 Ga0209233_1000087 Ga0209233_1000087280 136
27 3300009093 Ga0105240_10497632 Ga0105240_104976322 137
28 3300014968 Ga0157379_11441810 Ga0157379_114418102 137
29 3300014969 Ga0157376_10263600 Ga0157376_102636002 137
30 3300025920 Ga0207649_10563100 Ga0207649_105631001 137
31 3300039438 Ga0436360_1293235 Ga0436360_1293235_63_506 137
32 3300048911 Ga0496108_0781961 Ga0496108_0781961_212_658 137
33 3300048913 Ga0496110_0439868 Ga0496110_0439868_195_641 137
34 3300048915 Ga0496112_0419389 Ga0496112_0419389_352_798 137
35 3300009177 Ga0105248_10012485 Ga0105248_100124854 138
36 3300013296 Ga0157374_11503611 Ga0157374_115036112 138
37 3300025981 Ga0207640_11015359 Ga0207640_110153592 138
38 3300050512 nmdc:mga0n895_126600_c1 nmdc:mga0n895_126600_c1_1579_2016 138
39 3300050515 nmdc:mga0a205_296570_c1 nmdc:mga0a205_296570_c1_297_734 138
40 iso_pu_bacteria 2857349434 2857355041 138
41 iso_pu_bacteria 2977942078 2977943896 138
42 iso_pu_bacteria 2987636660 2987643642 138
43 iso_pu_bacteria 3004203850 3004207187 138
44 3300005353 Ga0070669_100832218 Ga0070669_1008322181 139
45 3300005456 Ga0070678_100285451 Ga0070678_1002854512 139
46 3300005844 Ga0068862_100856637 Ga0068862_1008566372 139
47 3300005937 Ga0081455_10321140 Ga0081455_103211401 139
48 3300025315 Ga0207697_10042033 Ga0207697_100420332 139
49 3300025961 Ga0207712_10435152 Ga0207712_104351522 139
50 3300028380 Ga0268265_10875467 Ga0268265_108754672 139
51 3300003763 Ga0055529_1003320 Ga0055529_10033202 140
52 3300006048 Ga0075363_100022852 Ga0075363_1000228522 140
53 3300006880 Ga0075429_100425590 Ga0075429_1004255902 140
54 3300025254 Ga0209148_1000037 Ga0209148_1000037334 140
55 3300025272 Ga0209455_1000036 Ga0209455_1000036311 140
56 3300039450 Ga0436363_0090918 Ga0436363_0090918_582_1061 140
57 3300050508 nmdc:mga09592_388073_c1 nmdc:mga09592_388073_c1_649_1092 140
58 3300005983 Ga0081540_1000245 Ga0081540_100024554 141
59 3300026078 Ga0207702_12194360 Ga0207702_121943601 141
60 3300053108 Ga0500562_153995 Ga0500562_153995_125_595 141
61 3300053160 Ga0500633_0132167 Ga0500633_0132167_41_511 141
62 3300003911 JGI25405J52794_10028447 JGI25405J52794_100284472 142
63 3300005330 Ga0070690_100084460 Ga0070690_1000844601 142
64 3300005335 Ga0070666_10082669 Ga0070666_100826693 142
65 3300005338 Ga0068868_100069045 Ga0068868_1000690453 142
66 3300005345 Ga0070692_10411575 Ga0070692_104115752 142
67 3300005355 Ga0070671_100110782 Ga0070671_1001107823 142
68 3300005355 Ga0070671_100187996 Ga0070671_1001879962 142
69 3300005365 Ga0070688_100537198 Ga0070688_1005371982 142
70 3300005435 Ga0070714_100009251 Ga0070714_1000092513 142
71 3300005439 Ga0070711_100007938 Ga0070711_1000079381 142
72 3300005544 Ga0070686_100137067 Ga0070686_1001370672 142
73 3300005546 Ga0070696_100695127 Ga0070696_1006951272 142
74 3300005549 Ga0070704_100123430 Ga0070704_1001234302 142
75 3300005615 Ga0070702_100202425 Ga0070702_1002024252 142
76 3300005617 Ga0068859_100120528 Ga0068859_1001205283 142
77 3300005937 Ga0081455_10003886 Ga0081455_1000388614 142
78 3300005983 Ga0081540_1004291 Ga0081540_10042914 142
79 3300006028 Ga0070717_10011616 Ga0070717_100116167 142
80 3300006163 Ga0070715_10461583 Ga0070715_104615831 142
81 3300006173 Ga0070716_100007056 Ga0070716_1000070565 142
82 3300006844 Ga0075428_100062375 Ga0075428_1000623754 142
83 3300006871 Ga0075434_100016976 Ga0075434_1000169765 142
84 3300006871 Ga0075434_100956548 Ga0075434_1009565482 142
85 3300006931 Ga0097620_100120529 Ga0097620_1001205293 142
86 3300007076 Ga0075435_100065738 Ga0075435_1000657383 142
87 3300007076 Ga0075435_100267747 Ga0075435_1002677472 142
88 3300009098 Ga0105245_10000301 Ga0105245_1000030111 142
89 3300009101 Ga0105247_11527821 Ga0105247_115278212 142
90 3300009147 Ga0114129_10038749 Ga0114129_100387492 142
91 3300009147 Ga0114129_10261955 Ga0114129_102619553 142
92 3300009176 Ga0105242_10050357 Ga0105242_100503573 142
93 3300009176 Ga0105242_11104558 Ga0105242_111045582 142
94 3300009551 Ga0105238_10158173 Ga0105238_101581733 142
95 3300014326 Ga0157380_10279823 Ga0157380_102798232 142
96 3300025898 Ga0207692_10048516 Ga0207692_100485162 142
97 3300025905 Ga0207685_10011886 Ga0207685_100118862 142
98 3300025906 Ga0207699_10011887 Ga0207699_100118873 142
99 3300025915 Ga0207693_10006232 Ga0207693_100062327 142
100 3300025916 Ga0207663_10012786 Ga0207663_100127862 142
101 3300025924 Ga0207694_10212409 Ga0207694_102124092 142
102 3300025927 Ga0207687_10002101 Ga0207687_100021014 142
103 3300025928 Ga0207700_10000458 Ga0207700_100004585 142
104 3300025928 Ga0207700_10200849 Ga0207700_102008493 142
105 3300025929 Ga0207664_10031202 Ga0207664_100312025 142
106 3300025931 Ga0207644_10159770 Ga0207644_101597702 142
107 3300025931 Ga0207644_10246499 Ga0207644_102464992 142
108 3300025934 Ga0207686_10114180 Ga0207686_101141802 142
109 3300025939 Ga0207665_10006165 Ga0207665_100061656 142
110 3300025939 Ga0207665_10636485 Ga0207665_106364852 142
111 3300025941 Ga0207711_10168732 Ga0207711_101687323 142
112 3300025945 Ga0207679_10409974 Ga0207679_104099742 142
113 3300026023 Ga0207677_10028823 Ga0207677_100288234 142
114 3300026041 Ga0207639_10635195 Ga0207639_106351951 142
115 3300026088 Ga0207641_11246540 Ga0207641_112465402 142
116 3300037418 Ga0395900_1261997 Ga0395900_1261997_107_556 142
117 3300037471 Ga0395905_0118821 Ga0395905_0118821_434_883 142
118 3300038443 Ga0395901_0568228 Ga0395901_0568228_535_984 142
119 3300039450 Ga0436363_0085767 Ga0436363_0085767_479_940 142
120 3300046810 Ga0495660_0276742 Ga0495660_0276742_230_712 142
121 3300048903 Ga0496100_0004121 Ga0496100_0004121_2026_2475 142
122 3300048904 Ga0496101_0002301 Ga0496101_0002301_5728_6177 142
123 3300048904 Ga0496101_0163726 Ga0496101_0163726_981_1442 142
124 3300048905 Ga0496102_0001907 Ga0496102_0001907_2937_3386 142
125 3300048906 Ga0496103_0224945 Ga0496103_0224945_354_815 142
126 3300048907 Ga0496104_0003321 Ga0496104_0003321_8454_8903 142
127 3300048907 Ga0496104_0254604 Ga0496104_0254604_1058_1507 142
128 3300048908 Ga0496105_0011008 Ga0496105_0011008_1669_2118 142
129 3300048909 Ga0496106_0001903 Ga0496106_0001903_12928_13377 142
130 3300048909 Ga0496106_0714330 Ga0496106_0714330_134_595 142
131 3300048910 Ga0496107_0000742 Ga0496107_0000742_1917_2366 142
132 3300048911 Ga0496108_0005149 Ga0496108_0005149_2384_2833 142
133 3300048911 Ga0496108_0012312 Ga0496108_0012312_5318_5767 142
134 3300048912 Ga0496109_0002185 Ga0496109_0002185_1278_1727 142
135 3300048912 Ga0496109_0005798 Ga0496109_0005798_1394_1843 142
136 3300048913 Ga0496110_0001267 Ga0496110_0001267_2252_2701 142
137 3300048913 Ga0496110_0001439 Ga0496110_0001439_2480_2929 142
138 3300048914 Ga0496111_0005865 Ga0496111_0005865_793_1242 142
139 3300048914 Ga0496111_0011164 Ga0496111_0011164_3623_4072 142
140 3300048915 Ga0496112_0002066 Ga0496112_0002066_8568_9017 142
141 3300048916 Ga0496113_0165545 Ga0496113_0165545_121_570 142
142 3300048916 Ga0496113_0190595 Ga0496113_0190595_347_796 142
143 3300048917 Ga0496114_1525596 Ga0496114_1525596_36_485 142
144 3300048918 Ga0496115_0015774 Ga0496115_0015774_2530_2979 142
145 3300049583 Ga0501067_0058873 Ga0501067_0058873_989_1438 142
146 3300049585 Ga0501069_0165456 Ga0501069_0165456_541_990 142
147 3300050490 nmdc:mga03n38_292890_c1 nmdc:mga03n38_292890_c1_360_824 142
148 3300050507 nmdc:mga05p37_24411_c1 nmdc:mga05p37_24411_c1_5585_6034 142
149 3300050507 nmdc:mga05p37_308112_c1 nmdc:mga05p37_308112_c1_939_1400 142
150 3300050510 nmdc:mga06r32_39256_c1 nmdc:mga06r32_39256_c1_222_671 142
151 3300050512 nmdc:mga0n895_773897_c1 nmdc:mga0n895_773897_c1_220_681 142
152 3300050513 nmdc:mga0rr50_275124_c1 nmdc:mga0rr50_275124_c1_178_639 142
153 3300050513 nmdc:mga0rr50_85516_c1 nmdc:mga0rr50_85516_c1_1912_2373 142
154 3300050514 nmdc:mga08x19_223834_c1 nmdc:mga08x19_223834_c1_748_1209 142
155 3300050515 nmdc:mga0a205_1002437_c1 nmdc:mga0a205_1002437_c1_164_625 142
156 3300003911 JGI25405J52794_10010926 JGI25405J52794_100109262 143
157 3300005356 Ga0070674_101220057 Ga0070674_1012200571 143
158 3300005937 Ga0081455_10018742 Ga0081455_100187425 143
159 3300005937 Ga0081455_10183573 Ga0081455_101835732 143
160 3300005937 Ga0081455_10272105 Ga0081455_102721052 143
161 3300005983 Ga0081540_1042912 Ga0081540_10429122 143
162 3300005985 Ga0081539_10049156 Ga0081539_100491565 143
163 3300006038 Ga0075365_10737306 Ga0075365_107373061 143
164 3300006051 Ga0075364_10241864 Ga0075364_102418642 143
165 3300006163 Ga0070715_10172234 Ga0070715_101722342 143
166 3300006173 Ga0070716_100146413 Ga0070716_1001464131 143
167 3300006173 Ga0070716_100367275 Ga0070716_1003672752 143
168 3300006175 Ga0070712_100967831 Ga0070712_1009678311 143
169 3300006186 Ga0075369_10396823 Ga0075369_103968232 143
170 3300006844 Ga0075428_100174653 Ga0075428_1001746533 143
171 3300006846 Ga0075430_100045229 Ga0075430_1000452294 143
172 3300006847 Ga0075431_100054699 Ga0075431_1000546995 143
173 3300006880 Ga0075429_100799895 Ga0075429_1007998952 143
174 3300009094 Ga0111539_10838454 Ga0111539_108384542 143
175 3300009147 Ga0114129_10530565 Ga0114129_105305652 143
176 3300009553 Ga0105249_10780461 Ga0105249_107804612 143
177 3300025906 Ga0207699_10234770 Ga0207699_102347702 143
178 3300025915 Ga0207693_10238127 Ga0207693_102381272 143
179 3300025939 Ga0207665_10337792 Ga0207665_103377923 143
180 3300025972 Ga0207668_11275738 Ga0207668_112757382 143
181 3300039437 Ga0436365_1098622 Ga0436365_1098622_557_1000 143
182 3300046459 Ga0495629_0075660 Ga0495629_0075660_1042_1506 143
183 3300046476 Ga0495662_0102954 Ga0495662_0102954_825_1283 143
184 3300046500 Ga0495596_0229315 Ga0495596_0229315_89_535 143
185 3300046531 Ga0495665_0071093 Ga0495665_0071093_1206_1670 143
186 3300046533 Ga0495640_0014540 Ga0495640_0014540_2514_2972 143
187 3300047315 Ga0495581_0124534 Ga0495581_0124534_119_577 143
188 3300047319 Ga0495674_0403046 Ga0495674_0403046_301_765 143
189 3300048920 Ga0496117_0140566 Ga0496117_0140566_12_461 143
190 3300049590 Ga0501074_1253733 Ga0501074_1253733_50_502 143
191 3300049743 Ga0501081_0552876 Ga0501081_0552876_77_559 143
192 3300050489 nmdc:mga03683_133716_c1 nmdc:mga03683_133716_c1_574_1056 143
193 3300050491 nmdc:mga00v17_196555_c1 nmdc:mga00v17_196555_c1_323_805 143
194 3300050492 nmdc:mga0yw44_553900_c1 nmdc:mga0yw44_553900_c1_216_698 143
195 3300050492 nmdc:mga0yw44_697023_c1 nmdc:mga0yw44_697023_c1_67_549 143
196 3300050508 nmdc:mga09592_210496_c1 nmdc:mga09592_210496_c1_1080_1562 143
197 3300050509 nmdc:mga0qj67_62573_c1 nmdc:mga0qj67_62573_c1_1141_1623 143
198 3300050510 nmdc:mga06r32_207606_c1 nmdc:mga06r32_207606_c1_262_744 143
199 3300050511 nmdc:mga08y16_795482_c1 nmdc:mga08y16_795482_c1_53_535 143
200 3300053077 Ga0495601_0214700 Ga0495601_0214700_661_1119 143
201 3300001991 JGI24743J22301_10003589 JGI24743J22301_100035892 144
202 3300002070 JGI24750J21931_1004772 JGI24750J21931_10047722 144
203 3300002073 JGI24745J21846_1017131 JGI24745J21846_10171312 144
204 3300002244 JGI24742J22300_10003072 JGI24742J22300_100030724 144
205 3300005328 Ga0070676_10018217 Ga0070676_100182174 144
206 3300005329 Ga0070683_100196963 Ga0070683_1001969631 144
207 3300005329 Ga0070683_100208787 Ga0070683_1002087872 144
208 3300005330 Ga0070690_100013918 Ga0070690_1000139184 144
209 3300005331 Ga0070670_100001910 Ga0070670_1000019107 144
210 3300005331 Ga0070670_100256415 Ga0070670_1002564152 144
211 3300005333 Ga0070677_10590609 Ga0070677_105906091 144
212 3300005334 Ga0068869_100175136 Ga0068869_1001751362 144
213 3300005335 Ga0070666_10049186 Ga0070666_100491863 144
214 3300005338 Ga0068868_100014860 Ga0068868_1000148604 144
215 3300005340 Ga0070689_100027535 Ga0070689_1000275354 144
216 3300005343 Ga0070687_100047358 Ga0070687_1000473583 144
217 3300005344 Ga0070661_100122348 Ga0070661_1001223483 144
218 3300005353 Ga0070669_100174579 Ga0070669_1001745793 144
219 3300005354 Ga0070675_100102198 Ga0070675_1001021983 144
220 3300005355 Ga0070671_100270746 Ga0070671_1002707463 144
221 3300005364 Ga0070673_100142725 Ga0070673_1001427252 144
222 3300005364 Ga0070673_100313996 Ga0070673_1003139962 144
223 3300005366 Ga0070659_100067305 Ga0070659_1000673053 144
224 3300005367 Ga0070667_100013697 Ga0070667_1000136973 144
225 3300005436 Ga0070713_100116409 Ga0070713_1001164092 144
226 3300005436 Ga0070713_100804633 Ga0070713_1008046332 144
227 3300005437 Ga0070710_10255568 Ga0070710_102555681 144
228 3300005437 Ga0070710_11078029 Ga0070710_110780291 144
229 3300005438 Ga0070701_10040627 Ga0070701_100406272 144
230 3300005440 Ga0070705_100181035 Ga0070705_1001810352 144
231 3300005441 Ga0070700_100007273 Ga0070700_1000072734 144
232 3300005455 Ga0070663_100013463 Ga0070663_1000134633 144
233 3300005455 Ga0070663_100147032 Ga0070663_1001470322 144
234 3300005457 Ga0070662_100007330 Ga0070662_1000073304 144
235 3300005459 Ga0068867_100043619 Ga0068867_1000436193 144
236 3300005466 Ga0070685_10495005 Ga0070685_104950052 144
237 3300005467 Ga0070706_100683017 Ga0070706_1006830172 144
238 3300005518 Ga0070699_100044916 Ga0070699_1000449163 144
239 3300005518 Ga0070699_100086784 Ga0070699_1000867843 144
240 3300005535 Ga0070684_100024113 Ga0070684_1000241132 144
241 3300005535 Ga0070684_100294234 Ga0070684_1002942341 144
242 3300005539 Ga0068853_100279975 Ga0068853_1002799751 144
243 3300005543 Ga0070672_100019109 Ga0070672_1000191094 144
244 3300005543 Ga0070672_100852828 Ga0070672_1008528282 144
245 3300005544 Ga0070686_100008180 Ga0070686_1000081802 144
246 3300005545 Ga0070695_100123321 Ga0070695_1001233211 144
247 3300005548 Ga0070665_100066968 Ga0070665_1000669684 144
248 3300005548 Ga0070665_101508848 Ga0070665_1015088481 144
249 3300005564 Ga0070664_100248604 Ga0070664_1002486042 144
250 3300005564 Ga0070664_100654000 Ga0070664_1006540002 144
251 3300005577 Ga0068857_100811931 Ga0068857_1008119311 144
252 3300005578 Ga0068854_100034569 Ga0068854_1000345694 144
253 3300005614 Ga0068856_101104957 Ga0068856_1011049572 144
254 3300005615 Ga0070702_100020572 Ga0070702_1000205722 144
255 3300005616 Ga0068852_100065349 Ga0068852_1000653493 144
256 3300005617 Ga0068859_100147525 Ga0068859_1001475251 144
257 3300005617 Ga0068859_100442521 Ga0068859_1004425212 144
258 3300005618 Ga0068864_100126329 Ga0068864_1001263293 144
259 3300005718 Ga0068866_10010810 Ga0068866_100108102 144
260 3300005719 Ga0068861_100011281 Ga0068861_1000112813 144
261 3300005840 Ga0068870_10003512 Ga0068870_100035127 144
262 3300005842 Ga0068858_100032563 Ga0068858_1000325634 144
263 3300005842 Ga0068858_100958179 Ga0068858_1009581792 144
264 3300005843 Ga0068860_100041885 Ga0068860_1000418854 144
265 3300005843 Ga0068860_101057255 Ga0068860_1010572552 144
266 3300005844 Ga0068862_100090331 Ga0068862_1000903311 144
267 3300005937 Ga0081455_10013304 Ga0081455_100133044 144
268 3300006028 Ga0070717_10164880 Ga0070717_101648802 144
269 3300006028 Ga0070717_10290752 Ga0070717_102907522 144
270 3300006038 Ga0075365_10055888 Ga0075365_100558883 144
271 3300006038 Ga0075365_10125591 Ga0075365_101255912 144
272 3300006038 Ga0075365_10150464 Ga0075365_101504642 144
273 3300006042 Ga0075368_10100105 Ga0075368_101001052 144
274 3300006048 Ga0075363_100273578 Ga0075363_1002735782 144
275 3300006051 Ga0075364_10163586 Ga0075364_101635862 144
276 3300006051 Ga0075364_10263272 Ga0075364_102632722 144
277 3300006163 Ga0070715_10731852 Ga0070715_107318521 144
278 3300006173 Ga0070716_100125323 Ga0070716_1001253232 144
279 3300006175 Ga0070712_100352172 Ga0070712_1003521722 144
280 3300006177 Ga0075362_10020464 Ga0075362_100204642 144
281 3300006178 Ga0075367_10330271 Ga0075367_103302711 144
282 3300006186 Ga0075369_10048892 Ga0075369_100488923 144
283 3300006237 Ga0097621_100016214 Ga0097621_1000162147 144
284 3300006358 Ga0068871_100043533 Ga0068871_1000435333 144
285 3300006844 Ga0075428_100065772 Ga0075428_1000657723 144
286 3300006844 Ga0075428_100144544 Ga0075428_1001445442 144
287 3300006846 Ga0075430_100032718 Ga0075430_1000327182 144
288 3300006847 Ga0075431_100023249 Ga0075431_1000232493 144
289 3300006852 Ga0075433_10206011 Ga0075433_102060112 144
290 3300006871 Ga0075434_100034613 Ga0075434_1000346132 144
291 3300006871 Ga0075434_101765230 Ga0075434_1017652301 144
292 3300006880 Ga0075429_100012864 Ga0075429_1000128645 144
293 3300006880 Ga0075429_100201436 Ga0075429_1002014362 144
294 3300006931 Ga0097620_100147534 Ga0097620_1001475343 144
295 3300006931 Ga0097620_100442478 Ga0097620_1004424782 144
296 3300007265 Ga0099794_10028683 Ga0099794_100286832 144
297 3300007788 Ga0099795_10001119 Ga0099795_100011192 144
298 3300009094 Ga0111539_10101233 Ga0111539_101012332 144
299 3300009094 Ga0111539_10115691 Ga0111539_101156913 144
300 3300009098 Ga0105245_10058772 Ga0105245_100587724 144
301 3300009098 Ga0105245_12264343 Ga0105245_122643432 144
302 3300009101 Ga0105247_10006172 Ga0105247_100061726 144
303 3300009147 Ga0114129_10011285 Ga0114129_100112854 144
304 3300009147 Ga0114129_10039522 Ga0114129_100395226 144
305 3300009148 Ga0105243_10140290 Ga0105243_101402902 144
306 3300009176 Ga0105242_10350170 Ga0105242_103501702 144
307 3300009176 Ga0105242_11904560 Ga0105242_119045601 144
308 3300009177 Ga0105248_10010977 Ga0105248_100109772 144
309 3300009545 Ga0105237_10035802 Ga0105237_100358022 144
310 3300009545 Ga0105237_10243475 Ga0105237_102434752 144
311 3300009551 Ga0105238_10016854 Ga0105238_1001685410 144
312 3300009553 Ga0105249_10065054 Ga0105249_100650544 144
313 3300010159 Ga0099796_10000877 Ga0099796_100008774 144
314 3300010375 Ga0105239_10106857 Ga0105239_101068573 144
315 3300010375 Ga0105239_10346130 Ga0105239_103461302 144
316 3300011119 Ga0105246_10023628 Ga0105246_100236283 144
317 3300011119 Ga0105246_10077777 Ga0105246_100777772 144
318 3300011119 Ga0105246_11439627 Ga0105246_114396271 144
319 3300012477 Ga0157336_1010167 Ga0157336_10101672 144
320 3300013296 Ga0157374_10002466 Ga0157374_100024667 144
321 3300013297 Ga0157378_11005618 Ga0157378_110056182 144
322 3300013307 Ga0157372_11548250 Ga0157372_115482501 144
323 3300013308 Ga0157375_10045749 Ga0157375_100457493 144
324 3300013308 Ga0157375_10797496 Ga0157375_107974962 144
325 3300014325 Ga0163163_10024687 Ga0163163_100246873 144
326 3300014326 Ga0157380_10044463 Ga0157380_100444634 144
327 3300014745 Ga0157377_10012638 Ga0157377_100126382 144
328 3300014968 Ga0157379_10039921 Ga0157379_100399213 144
329 3300017792 Ga0163161_10039612 Ga0163161_100396122 144
330 3300021361 Ga0213872_10089660 Ga0213872_100896602 144
331 3300025315 Ga0207697_10194933 Ga0207697_101949332 144
332 3300025898 Ga0207692_10040961 Ga0207692_100409612 144
333 3300025898 Ga0207692_10330109 Ga0207692_103301091 144
334 3300025900 Ga0207710_10015598 Ga0207710_100155983 144
335 3300025901 Ga0207688_10000117 Ga0207688_1000011729 144
336 3300025903 Ga0207680_10050728 Ga0207680_100507282 144
337 3300025904 Ga0207647_10024618 Ga0207647_100246182 144
338 3300025907 Ga0207645_10018258 Ga0207645_100182584 144
339 3300025908 Ga0207643_10000291 Ga0207643_1000029127 144
340 3300025910 Ga0207684_10060885 Ga0207684_100608852 144
341 3300025914 Ga0207671_10060060 Ga0207671_100600603 144
342 3300025914 Ga0207671_10177522 Ga0207671_101775221 144
343 3300025915 Ga0207693_10044042 Ga0207693_100440423 144
344 3300025916 Ga0207663_10612737 Ga0207663_106127371 144
345 3300025918 Ga0207662_10004840 Ga0207662_100048402 144
346 3300025919 Ga0207657_10054531 Ga0207657_100545312 144
347 3300025920 Ga0207649_10030096 Ga0207649_100300964 144
348 3300025922 Ga0207646_10427537 Ga0207646_104275372 144
349 3300025923 Ga0207681_10048673 Ga0207681_100486732 144
350 3300025924 Ga0207694_10070158 Ga0207694_100701581 144
351 3300025925 Ga0207650_10007981 Ga0207650_100079813 144
352 3300025925 Ga0207650_10256966 Ga0207650_102569662 144
353 3300025926 Ga0207659_10016345 Ga0207659_100163454 144
354 3300025927 Ga0207687_10183490 Ga0207687_101834902 144
355 3300025928 Ga0207700_10108611 Ga0207700_101086112 144
356 3300025928 Ga0207700_10195977 Ga0207700_101959773 144
357 3300025931 Ga0207644_10180125 Ga0207644_101801253 144
358 3300025931 Ga0207644_10361623 Ga0207644_103616231 144
359 3300025932 Ga0207690_10056792 Ga0207690_100567923 144
360 3300025932 Ga0207690_10059084 Ga0207690_100590842 144
361 3300025933 Ga0207706_10022984 Ga0207706_100229844 144
362 3300025934 Ga0207686_10007270 Ga0207686_100072703 144
363 3300025934 Ga0207686_11475772 Ga0207686_114757721 144
364 3300025935 Ga0207709_10071644 Ga0207709_100716442 144
365 3300025936 Ga0207670_10311262 Ga0207670_103112622 144
366 3300025938 Ga0207704_10278966 Ga0207704_102789662 144
367 3300025939 Ga0207665_10192106 Ga0207665_101921062 144
368 3300025940 Ga0207691_10012255 Ga0207691_100122555 144
369 3300025941 Ga0207711_10055291 Ga0207711_100552913 144
370 3300025942 Ga0207689_10018113 Ga0207689_100181132 144
371 3300025944 Ga0207661_10228448 Ga0207661_102284481 144
372 3300025945 Ga0207679_10065067 Ga0207679_100650672 144
373 3300025949 Ga0207667_10533632 Ga0207667_105336322 144
374 3300025960 Ga0207651_10034648 Ga0207651_100346482 144
375 3300025960 Ga0207651_10261877 Ga0207651_102618772 144
376 3300025961 Ga0207712_10066107 Ga0207712_100661071 144
377 3300025972 Ga0207668_10005839 Ga0207668_100058396 144
378 3300025981 Ga0207640_10013472 Ga0207640_100134725 144
379 3300025986 Ga0207658_10088942 Ga0207658_100889422 144
380 3300026023 Ga0207677_10019084 Ga0207677_100190845 144
381 3300026035 Ga0207703_10050960 Ga0207703_100509603 144
382 3300026035 Ga0207703_10324521 Ga0207703_103245212 144
383 3300026067 Ga0207678_10121486 Ga0207678_101214862 144
384 3300026067 Ga0207678_10167598 Ga0207678_101675982 144
385 3300026075 Ga0207708_10001828 Ga0207708_100018289 144
386 3300026078 Ga0207702_10283733 Ga0207702_102837333 144
387 3300026078 Ga0207702_10510880 Ga0207702_105108802 144
388 3300026088 Ga0207641_10072273 Ga0207641_100722732 144
389 3300026089 Ga0207648_10028571 Ga0207648_100285714 144
390 3300026095 Ga0207676_10036735 Ga0207676_100367352 144
391 3300026116 Ga0207674_10504821 Ga0207674_105048212 144
392 3300026118 Ga0207675_100037669 Ga0207675_1000376693 144
393 3300026142 Ga0207698_10311949 Ga0207698_103119492 144
394 3300027671 Ga0209588_1064242 Ga0209588_10642422 144
395 3300027907 Ga0207428_10519932 Ga0207428_105199322 144
396 3300028379 Ga0268266_10050992 Ga0268266_100509924 144
397 3300028379 Ga0268266_10271728 Ga0268266_102717282 144
398 3300028380 Ga0268265_10173676 Ga0268265_101736762 144
399 3300028381 Ga0268264_10037501 Ga0268264_100375013 144
400 3300035111 Ga0373923_0316902 Ga0373923_0316902_59_535 144
401 3300035113 Ga0373936_0052186 Ga0373936_0052186_71_547 144
402 3300035170 Ga0373943_0398493 Ga0373943_0398493_237_713 144
403 3300035171 Ga0373946_0019631 Ga0373946_0019631_443_919 144
404 3300035691 Ga0373931_0147176 Ga0373931_0147176_193_666 144
405 3300035691 Ga0373931_0148597 Ga0373931_0148597_605_1051 144
406 3300035691 Ga0373931_0191953 Ga0373931_0191953_508_1005 144
407 3300035691 Ga0373931_0346757 Ga0373931_0346757_250_726 144
408 3300035692 Ga0373935_0071894 Ga0373935_0071894_566_1063 144
409 3300035692 Ga0373935_0264463 Ga0373935_0264463_316_792 144
410 3300035695 Ga0373927_0024586 Ga0373927_0024586_120_596 144
411 3300035695 Ga0373927_0211595 Ga0373927_0211595_189_665 144
412 3300035725 Ga0373947_0005360 Ga0373947_0005360_4952_5428 144
413 3300037068 Ga0373925_0394981 Ga0373925_0394981_493_987 144
414 3300039447 Ga0436361_0416025 Ga0436361_0416025_4861_5316 144
415 3300039453 Ga0436362_0106370 Ga0436362_0106370_87_533 144
416 3300039453 Ga0436362_0276156 Ga0436362_0276156_56_511 144
417 3300041456 Ga0451795_0313201 Ga0451795_0313201_90_566 144
418 3300041460 Ga0451802_1451856 Ga0451802_1451856_177_653 144
419 3300046452 Ga0495617_099212 Ga0495617_099212_417_893 144
420 3300046455 Ga0495603_0020414 Ga0495603_0020414_2466_2942 144
421 3300046458 Ga0495591_066331 Ga0495591_066331_218_694 144
422 3300046474 Ga0495605_0025009 Ga0495605_0025009_1809_2285 144
423 3300046474 Ga0495605_0130673 Ga0495605_0130673_601_1077 144
424 3300046491 Ga0495584_0014161 Ga0495584_0014161_297_764 144
425 3300046491 Ga0495584_0015339 Ga0495584_0015339_1112_1588 144
426 3300046492 Ga0495585_0004639 Ga0495585_0004639_2465_2941 144
427 3300046499 Ga0495594_0083137 Ga0495594_0083137_1282_1776 144
428 3300046500 Ga0495596_0021949 Ga0495596_0021949_1576_2052 144
429 3300046501 Ga0495607_0182328 Ga0495607_0182328_186_662 144
430 3300046514 Ga0495618_0517197 Ga0495618_0517197_14_505 144
431 3300046515 Ga0495620_0097447 Ga0495620_0097447_424_912 144
432 3300046517 Ga0495630_0309993 Ga0495630_0309993_459_935 144
433 3300046518 Ga0495631_0039464 Ga0495631_0039464_1278_1754 144
434 3300046518 Ga0495631_0201996 Ga0495631_0201996_232_708 144
435 3300046520 Ga0495637_0057033 Ga0495637_0057033_541_1017 144
436 3300046525 Ga0495663_0003607 Ga0495663_0003607_1164_1640 144
437 3300046537 Ga0495598_0022026 Ga0495598_0022026_457_933 144
438 3300046539 Ga0495621_0032439 Ga0495621_0032439_144_620 144
439 3300046539 Ga0495621_0372604 Ga0495621_0372604_50_505 144
440 3300046558 Ga0495633_0114777 Ga0495633_0114777_490_966 144
441 3300046648 Ga0495611_0158563 Ga0495611_0158563_387_863 144
442 3300046664 Ga0495659_0181370 Ga0495659_0181370_154_648 144
443 3300046665 Ga0495661_0493282 Ga0495661_0493282_74_550 144
444 3300046681 Ga0495647_0016089 Ga0495647_0016089_603_1079 144
445 3300046681 Ga0495647_0191018 Ga0495647_0191018_329_826 144
446 3300046683 Ga0495658_0115688 Ga0495658_0115688_644_1120 144
447 3300046689 Ga0495613_0043735 Ga0495613_0043735_2624_3100 144
448 3300046690 Ga0495624_0039728 Ga0495624_0039728_2114_2590 144
449 3300046692 Ga0495671_0074213 Ga0495671_0074213_342_818 144
450 3300046694 Ga0495649_0019711 Ga0495649_0019711_1736_2212 144
451 3300046794 Ga0495589_0051663 Ga0495589_0051663_153_644 144
452 3300047315 Ga0495581_0086007 Ga0495581_0086007_819_1295 144
453 3300047315 Ga0495581_0098661 Ga0495581_0098661_189_686 144
454 3300047315 Ga0495581_0498423 Ga0495581_0498423_30_476 144
455 3300047320 Ga0495672_0038267 Ga0495672_0038267_1206_1685 144
456 3300047321 Ga0495676_0178746 Ga0495676_0178746_44_520 144
457 3300047321 Ga0495676_0182041 Ga0495676_0182041_308_805 144
458 3300047321 Ga0495676_0426215 Ga0495676_0426215_221_697 144
459 3300047323 Ga0495683_0291312 Ga0495683_0291312_153_644 144
460 3300047673 Ga0495593_0039641 Ga0495593_0039641_2029_2526 144
461 3300048089 Ga0495614_0266897 Ga0495614_0266897_131_625 144
462 3300048903 Ga0496100_0034871 Ga0496100_0034871_2155_2631 144
463 3300048903 Ga0496100_0138972 Ga0496100_0138972_579_1076 144
464 3300048904 Ga0496101_0006780 Ga0496101_0006780_310_786 144
465 3300048904 Ga0496101_0109660 Ga0496101_0109660_474_971 144
466 3300048904 Ga0496101_0282178 Ga0496101_0282178_753_1229 144
467 3300048904 Ga0496101_0578467 Ga0496101_0578467_10_486 144
468 3300048905 Ga0496102_0016244 Ga0496102_0016244_5589_6086 144
469 3300048905 Ga0496102_0051818 Ga0496102_0051818_1895_2371 144
470 3300048905 Ga0496102_0236631 Ga0496102_0236631_243_719 144
471 3300048906 Ga0496103_0005487 Ga0496103_0005487_4671_5147 144
472 3300048906 Ga0496103_0070261 Ga0496103_0070261_1082_1579 144
473 3300048907 Ga0496104_0001787 Ga0496104_0001787_4052_4525 144
474 3300048907 Ga0496104_0019430 Ga0496104_0019430_3173_3670 144
475 3300048907 Ga0496104_0090210 Ga0496104_0090210_1368_1844 144
476 3300048908 Ga0496105_0005141 Ga0496105_0005141_8360_8836 144
477 3300048908 Ga0496105_0013382 Ga0496105_0013382_529_1026 144
478 3300048909 Ga0496106_0081808 Ga0496106_0081808_638_1114 144
479 3300048909 Ga0496106_0130364 Ga0496106_0130364_1075_1572 144
480 3300048909 Ga0496106_0380848 Ga0496106_0380848_427_951 144
481 3300048910 Ga0496107_0001577 Ga0496107_0001577_2798_3274 144
482 3300048910 Ga0496107_0135608 Ga0496107_0135608_907_1404 144
483 3300048910 Ga0496107_0224009 Ga0496107_0224009_458_931 144
484 3300048911 Ga0496108_0004907 Ga0496108_0004907_3685_4182 144
485 3300048911 Ga0496108_0023055 Ga0496108_0023055_3685_4209 144
486 3300048911 Ga0496108_0117243 Ga0496108_0117243_310_786 144
487 3300048911 Ga0496108_0680538 Ga0496108_0680538_94_570 144
488 3300048912 Ga0496109_0001273 Ga0496109_0001273_15036_15533 144
489 3300048912 Ga0496109_0007347 Ga0496109_0007347_1465_1941 144
490 3300048912 Ga0496109_0589290 Ga0496109_0589290_290_745 144
491 3300048913 Ga0496110_0008474 Ga0496110_0008474_1915_2391 144
492 3300048913 Ga0496110_0010029 Ga0496110_0010029_694_1191 144
493 3300048913 Ga0496110_0154263 Ga0496110_0154263_911_1399 144
494 3300048913 Ga0496110_0189820 Ga0496110_0189820_656_1129 144
495 3300048914 Ga0496111_0004907 Ga0496111_0004907_2386_2883 144
496 3300048914 Ga0496111_0026573 Ga0496111_0026573_2206_2682 144
497 3300048915 Ga0496112_0021566 Ga0496112_0021566_2586_3083 144
498 3300048915 Ga0496112_0139833 Ga0496112_0139833_1041_1529 144
499 3300048915 Ga0496112_0570047 Ga0496112_0570047_437_913 144
500 3300048916 Ga0496113_0000303 Ga0496113_0000303_11820_12317 144
501 3300048916 Ga0496113_0032411 Ga0496113_0032411_2193_2669 144
502 3300048916 Ga0496113_0277496 Ga0496113_0277496_383_871 144
503 3300048916 Ga0496113_0279872 Ga0496113_0279872_372_848 144
504 3300048916 Ga0496113_1051702 Ga0496113_1051702_48_524 144
505 3300048917 Ga0496114_0551285 Ga0496114_0551285_290_787 144
506 3300048918 Ga0496115_0018692 Ga0496115_0018692_4670_5146 144
507 3300048918 Ga0496115_0041111 Ga0496115_0041111_418_915 144
508 3300048918 Ga0496115_0051494 Ga0496115_0051494_1486_2010 144
509 3300050490 nmdc:mga03n38_61205_c1 nmdc:mga03n38_61205_c1_503_979 144
510 3300050491 nmdc:mga00v17_229611_c1 nmdc:mga00v17_229611_c1_370_846 144
511 3300050491 nmdc:mga00v17_260268_c1 nmdc:mga00v17_260268_c1_596_1093 144
512 3300050492 nmdc:mga0yw44_167927_c1 nmdc:mga0yw44_167927_c1_305_781 144
513 3300050492 nmdc:mga0yw44_41949_c1 nmdc:mga0yw44_41949_c1_1196_1672 144
514 3300050494 nmdc:mga06z11_49946_c1 nmdc:mga06z11_49946_c1_632_1108 144
515 3300050496 nmdc:mga07m45_298086_c1 nmdc:mga07m45_298086_c1_252_728 144
516 3300050507 nmdc:mga05p37_45362_c1 nmdc:mga05p37_45362_c1_3756_4253 144
517 3300050507 nmdc:mga05p37_510362_c1 nmdc:mga05p37_510362_c1_743_1231 144
518 3300050507 nmdc:mga05p37_865771_c1 nmdc:mga05p37_865771_c1_163_672 144
519 3300050508 nmdc:mga09592_241130_c1 nmdc:mga09592_241130_c1_428_925 144
520 3300050510 nmdc:mga06r32_207384_c1 nmdc:mga06r32_207384_c1_1212_1661 144
521 3300050511 nmdc:mga08y16_181244_c1 nmdc:mga08y16_181244_c1_1580_2077 144
522 3300050512 nmdc:mga0n895_832661_c1 nmdc:mga0n895_832661_c1_18_539 144
523 3300053077 Ga0495601_0048960 Ga0495601_0048960_1762_2253 144
524 3300053083 Ga0495655_0008425 Ga0495655_0008425_612_1088 144
525 3300053085 Ga0495619_0370517 Ga0495619_0370517_184_675 144
526 3300053085 Ga0495619_0409077 Ga0495619_0409077_238_735 144
527 3300003203 JGI25406J46586_10004605 JGI25406J46586_100046053 145
528 3300005340 Ga0070689_100356474 Ga0070689_1003564742 145
529 3300005985 Ga0081539_10172122 Ga0081539_101721222 145
530 3300009094 Ga0111539_10242870 Ga0111539_102428703 145
531 3300009176 Ga0105242_11167055 Ga0105242_111670552 145
532 3300013297 Ga0157378_10145081 Ga0157378_101450812 145
533 3300014326 Ga0157380_10922422 Ga0157380_109224222 145
534 3300025936 Ga0207670_10284947 Ga0207670_102849472 145
535 3300050511 nmdc:mga08y16_886865_c1 nmdc:mga08y16_886865_c1_141_602 145
536 3300005343 Ga0070687_100384039 Ga0070687_1003840392 146
537 3300005985 Ga0081539_10090932 Ga0081539_100909322 146
538 3300006173 Ga0070716_101265627 Ga0070716_1012656271 146
539 3300006175 Ga0070712_100001758 Ga0070712_10000175813 146
540 3300013297 Ga0157378_10849898 Ga0157378_108498982 146
541 3300046460 Ga0495638_0553777 Ga0495638_0553777_35_481 146
542 3300053086 Ga0500578_0588929 Ga0500578_0588929_92_538 146
543 3300053122 Ga0500608_303625 Ga0500608_303625_76_522 146
544 3300005353 Ga0070669_101518613 Ga0070669_1015186131 147
545 3300006038 Ga0075365_10119318 Ga0075365_101193182 147
546 3300006048 Ga0075363_100283071 Ga0075363_1002830712 147
547 3300006051 Ga0075364_10037264 Ga0075364_100372642 147
548 3300006177 Ga0075362_10036813 Ga0075362_100368133 147
549 3300006177 Ga0075362_10057502 Ga0075362_100575023 147
550 3300006178 Ga0075367_10043014 Ga0075367_100430144 147
551 3300006178 Ga0075367_10255499 Ga0075367_102554992 147
552 3300006186 Ga0075369_10021741 Ga0075369_100217413 147
553 3300006195 Ga0075366_10056361 Ga0075366_100563613 147
554 3300006195 Ga0075366_10461541 Ga0075366_104615411 147
555 3300006353 Ga0075370_10061104 Ga0075370_100611043 147
556 3300006353 Ga0075370_10374286 Ga0075370_103742862 147
557 3300006353 Ga0075370_10639621 Ga0075370_106396211 147
558 3300009148 Ga0105243_10220173 Ga0105243_102201733 147
559 3300025927 Ga0207687_10790182 Ga0207687_107901822 147
560 3300026075 Ga0207708_11258456 Ga0207708_112584561 147
561 3300028381 Ga0268264_10219335 Ga0268264_102193352 147
562 3300041411 Ga0439466_0112665 Ga0439466_0112665_278_736 147
563 3300050489 nmdc:mga03683_111289_c1 nmdc:mga03683_111289_c1_472_948 147
564 3300050492 nmdc:mga0yw44_222330_c1 nmdc:mga0yw44_222330_c1_559_1050 147
565 3300050493 nmdc:mga0k408_105348_c1 nmdc:mga0k408_105348_c1_820_1311 147
566 3300050494 nmdc:mga06z11_269318_c1 nmdc:mga06z11_269318_c1_109_630 147
567 3300050516 nmdc:mga0sz30_42439_c1 nmdc:mga0sz30_42439_c1_322_813 147
568 3300053085 Ga0495619_0814507 Ga0495619_0814507_129_614 147
569 3300005331 Ga0070670_100360453 Ga0070670_1003604531 148
570 3300005340 Ga0070689_100083702 Ga0070689_1000837024 148
571 3300005343 Ga0070687_100218784 Ga0070687_1002187842 148
572 3300005365 Ga0070688_100166558 Ga0070688_1001665581 148
573 3300005365 Ga0070688_100732368 Ga0070688_1007323681 148
574 3300005434 Ga0070709_10104819 Ga0070709_101048193 148
575 3300005545 Ga0070695_100506148 Ga0070695_1005061482 148
576 3300005549 Ga0070704_100140835 Ga0070704_1001408352 148
577 3300005617 Ga0068859_100186031 Ga0068859_1001860312 148
578 3300005618 Ga0068864_100363116 Ga0068864_1003631162 148
579 3300005719 Ga0068861_100251487 Ga0068861_1002514872 148
580 3300005841 Ga0068863_100282731 Ga0068863_1002827312 148
581 3300005842 Ga0068858_100547276 Ga0068858_1005472761 148
582 3300005983 Ga0081540_1039856 Ga0081540_10398562 148
583 3300006038 Ga0075365_10008586 Ga0075365_100085864 148
584 3300006042 Ga0075368_10059132 Ga0075368_100591322 148
585 3300006048 Ga0075363_100030948 Ga0075363_1000309482 148
586 3300006051 Ga0075364_10003031 Ga0075364_100030312 148
587 3300006173 Ga0070716_100588097 Ga0070716_1005880972 148
588 3300006178 Ga0075367_10004657 Ga0075367_100046576 148
589 3300006852 Ga0075433_10018481 Ga0075433_100184814 148
590 3300006871 Ga0075434_100050371 Ga0075434_1000503713 148
591 3300006914 Ga0075436_101400004 Ga0075436_1014000041 148
592 3300006931 Ga0097620_100186017 Ga0097620_1001860172 148
593 3300007076 Ga0075435_100038695 Ga0075435_1000386954 148
594 3300007076 Ga0075435_101173153 Ga0075435_1011731531 148
595 3300009098 Ga0105245_10407347 Ga0105245_104073472 148
596 3300009177 Ga0105248_10238720 Ga0105248_102387202 148
597 3300010375 Ga0105239_11071227 Ga0105239_110712272 148
598 3300013306 Ga0163162_10638510 Ga0163162_106385102 148
599 3300013308 Ga0157375_10307779 Ga0157375_103077792 148
600 3300014325 Ga0163163_10031093 Ga0163163_100310935 148
601 3300017792 Ga0163161_10188804 Ga0163161_101888042 148
602 3300025925 Ga0207650_10445359 Ga0207650_104453592 148
603 3300025936 Ga0207670_10195365 Ga0207670_101953652 148
604 3300025939 Ga0207665_10569866 Ga0207665_105698661 148
605 3300026088 Ga0207641_10360527 Ga0207641_103605271 148
606 3300026095 Ga0207676_10557770 Ga0207676_105577702 148
607 3300026118 Ga0207675_100023684 Ga0207675_1000236846 148
608 3300026118 Ga0207675_100799042 Ga0207675_1007990422 148
609 3300027866 Ga0209813_10007840 Ga0209813_100078404 148
610 3300028381 Ga0268264_10839258 Ga0268264_108392582 148
611 3300035171 Ga0373946_0325964 Ga0373946_0325964_268_744 148
612 3300046457 Ga0495590_0126746 Ga0495590_0126746_279_743 148
613 3300046660 Ga0495625_0185052 Ga0495625_0185052_115_603 148
614 3300048905 Ga0496102_0494203 Ga0496102_0494203_563_1039 148
615 3300048907 Ga0496104_0013709 Ga0496104_0013709_2013_2495 148
616 3300048908 Ga0496105_0320515 Ga0496105_0320515_145_627 148
617 3300048910 Ga0496107_0548098 Ga0496107_0548098_35_511 148
618 3300048911 Ga0496108_0293757 Ga0496108_0293757_917_1399 148
619 3300048912 Ga0496109_0012097 Ga0496109_0012097_201_683 148
620 3300048913 Ga0496110_0128093 Ga0496110_0128093_551_1027 148
621 3300048914 Ga0496111_0239192 Ga0496111_0239192_335_817 148
622 3300048915 Ga0496112_0271257 Ga0496112_0271257_581_1057 148
623 3300048915 Ga0496112_0536869 Ga0496112_0536869_353_835 148
624 3300048916 Ga0496113_0171762 Ga0496113_0171762_739_1221 148
625 3300048918 Ga0496115_0097278 Ga0496115_0097278_332_814 148
626 3300050490 nmdc:mga03n38_10892_c1 nmdc:mga03n38_10892_c1_1752_2216 148
627 3300050490 nmdc:mga03n38_16037_c1 nmdc:mga03n38_16037_c1_2230_2694 148
628 3300050491 nmdc:mga00v17_19320_c1 nmdc:mga00v17_19320_c1_703_1167 148
629 3300050492 nmdc:mga0yw44_17544_c1 nmdc:mga0yw44_17544_c1_3037_3501 148
630 3300050494 nmdc:mga06z11_89111_c1 nmdc:mga06z11_89111_c1_1097_1561 148
631 3300050495 nmdc:mga04h51_2637_c1 nmdc:mga04h51_2637_c1_755_1219 148
632 3300050495 nmdc:mga04h51_489262_c1 nmdc:mga04h51_489262_c1_15_479 148
633 3300050512 nmdc:mga0n895_47877_c1 nmdc:mga0n895_47877_c1_2491_2973 148
634 3300050513 nmdc:mga0rr50_30637_c1 nmdc:mga0rr50_30637_c1_2102_2584 148
635 3300050513 nmdc:mga0rr50_323808_c1 nmdc:mga0rr50_323808_c1_380_856 148
636 3300050515 nmdc:mga0a205_129262_c1 nmdc:mga0a205_129262_c1_209_685 148
637 3300053153 Ga0500616_0085862 Ga0500616_0085862_687_1151 148
638 3300001989 JGI24739J22299_10198634 JGI24739J22299_101986341 149
639 3300002987 JGI25159J45721_1024778 JGI25159J45721_10247782 149
640 3300003354 JGI25160J50197_1033099 JGI25160J50197_10330992 149
641 3300005981 Ga0081538_10020271 Ga0081538_100202715 149
642 3300005985 Ga0081539_10033395 Ga0081539_100333953 149
643 3300006038 Ga0075365_10009939 Ga0075365_100099395 149
644 3300006038 Ga0075365_10509971 Ga0075365_105099712 149
645 3300006048 Ga0075363_100007933 Ga0075363_1000079334 149
646 3300006048 Ga0075363_100049492 Ga0075363_1000494922 149
647 3300006051 Ga0075364_10007069 Ga0075364_100070696 149
648 3300006177 Ga0075362_10019895 Ga0075362_100198953 149
649 3300006178 Ga0075367_10001828 Ga0075367_1000182810 149
650 3300006178 Ga0075367_10007981 Ga0075367_100079812 149
651 3300006178 Ga0075367_10260671 Ga0075367_102606711 149
652 3300006852 Ga0075433_10365089 Ga0075433_103650892 149
653 3300006871 Ga0075434_100508608 Ga0075434_1005086082 149
654 3300011119 Ga0105246_10205392 Ga0105246_102053923 149
655 3300014326 Ga0157380_10428025 Ga0157380_104280252 149
656 3300025284 Ga0209130_1000909 Ga0209130_10009099 149
657 3300025302 Ga0207426_1000366 Ga0207426_100036673 149
658 3300035691 Ga0373931_0954204 Ga0373931_0954204_59_511 149
659 3300042146 Ga0450907_004366 Ga0450907_004366_567_1040 149
660 3300046473 Ga0495582_0220822 Ga0495582_0220822_101_586 149
661 3300049576 Ga0501040_1296955 Ga0501040_1296955_36_515 149
662 3300049744 Ga0501083_0298895 Ga0501083_0298895_534_1013 149
663 3300050489 nmdc:mga03683_96704_c1 nmdc:mga03683_96704_c1_744_1196 149
664 3300050490 nmdc:mga03n38_59336_c1 nmdc:mga03n38_59336_c1_544_993 149
665 3300050491 nmdc:mga00v17_3784_c1 nmdc:mga00v17_3784_c1_734_1186 149
666 3300050492 nmdc:mga0yw44_176099_c1 nmdc:mga0yw44_176099_c1_618_1067 149
667 3300050492 nmdc:mga0yw44_8043_c1 nmdc:mga0yw44_8043_c1_4040_4492 149
668 3300050494 nmdc:mga06z11_14465_c1 nmdc:mga06z11_14465_c1_723_1175 149
669 3300050494 nmdc:mga06z11_3590_c1 nmdc:mga06z11_3590_c1_3856_4308 149
670 3300050496 nmdc:mga07m45_254637_c1 nmdc:mga07m45_254637_c1_510_962 149
671 3300053077 Ga0495601_0619359 Ga0495601_0619359_48_539 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13431

TPR_17

Tetratricopeptide repeat

109

142

0.98

PF13181

TPR_8

Tetratricopeptide repeat

87

120

0.97

PF07719

TPR_2

Tetratricopeptide repeat

87

120

0.96

PF14559

TPR_19

Tetratricopeptide repeat

97

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zhe-assembly1.cif.gz_B structure of the c. elegans smg5-smg7 complex 0.952 64 125
3zhe-assembly2.cif.gz_D structure of the c. elegans smg5-smg7 complex 0.9461 64 125
3kd7-assembly5.cif.gz_E designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.9381 35 127
3kd7-assembly2.cif.gz_B designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.938 35 127
2wqh-assembly1.cif.gz_A-2 crystal structure of ctpr3y3 0.9238 35 127
ID Description Score Start End Superfamily
af_Q8IUR5_613_682_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9603 64 128 1.25.40.10
af_Q58350_225_318_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9436 35 123 1.25.40.10
af_A0A1D6J5H1_1_102_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.94 39 127 1.25.40.10
af_Q86TZ1_263_346_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.939 47 128 1.25.40.10
3kd7E00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9381 35 127 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A523FNY8-F1-model_v4 Tetratricopeptide repeat protein 0.9799 35 148 GO:0045892
AF-A0A7X3MUP6-F1-model_v4 Tetratricopeptide repeat protein 0.9737 34 149 GO:0009279
GO:0046813
AF-A0A6I6L1Y8-F1-model_v4 Tetratricopeptide repeat protein 0.9726 35 148
AF-A0A239Q0T0-F1-model_v4 Tetratricopeptide repeat-containing protein 0.971 35 148
AF-A0A6I4LSV8-F1-model_v4 Tetratricopeptide repeat protein 0.9707 35 148

Feature Viewer

pLDDT pTM Quality
86.61 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map