F474147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 315 | 667 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300006178|Ga0075367_10043014|Ga0075367_100430144 |
| Length | 173 |
| Sequence | MSRSDVRLLSRAVEIKDIDMKQKSTLGLWLAIAFTAALLHGGPAFAIDNVTTSNAPDLTSVRAKVKAKDFKGALAELTPMLQTHQHADVYNLMGFSLRKTGDQQQAFTFYRKALDFDPQHKGALEYLGELYVETGQIEKARQNVAILKMLCPSGCEELADLEEAIAAAPAKAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 2 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 3 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 4 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 218 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 219 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 221 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 222 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 312 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 313 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.16 |
| Nodule | 0.6 |
| Rhizoplane | 13.41 |
| Rhizosphere | 71.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10198634 | 3300001989 | Bacteria | 589 |
| 2 | JGI24743J22301_10003589 | 3300001991 | Bacteria | 2467 |
| 3 | JGI24750J21931_1004772 | 3300002070 | Bacteria | 1649 |
| 4 | JGI24745J21846_1017131 | 3300002073 | Bacteria | 842 |
| 5 | JGI24742J22300_10003072 | 3300002244 | Bacteria | 2702 |
| 6 | JGI25159J45721_1024778 | 3300002987 | Bacteria | 1061 |
| 7 | JGI25406J46586_10004605 | 3300003203 | Bacteria | 6419 |
| 8 | JGI25165J46597_1000028 | 3300003214 | Bacteria | 325146 |
| 9 | JGI25160J50197_1033099 | 3300003354 | Bacteria | 1305 |
| 10 | Ga0055529_1003320 | 3300003763 | Bacteria | 2707 |
| 11 | JGI25405J52794_10010926 | 3300003911 | Bacteria | 1734 |
| 12 | JGI25405J52794_10028447 | 3300003911 | Unclassified | 1154 |
| 13 | Ga0070676_10018217 | 3300005328 | Bacteria | 3888 |
| 14 | Ga0070683_100196963 | 3300005329 | Bacteria | 1913 |
| 15 | Ga0070683_100208787 | 3300005329 | Bacteria | 1855 |
| 16 | Ga0070690_100013918 | 3300005330 | Bacteria | 4769 |
| 17 | Ga0070690_100084460 | 3300005330 | Bacteria | 2081 |
| 18 | Ga0070670_100001910 | 3300005331 | Bacteria | 17062 |
| 19 | Ga0070670_100256415 | 3300005331 | Bacteria | 1524 |
| 20 | Ga0070670_100360453 | 3300005331 | Archaea | 1278 |
| 21 | Ga0070677_10590609 | 3300005333 | Bacteria | 614 |
| 22 | Ga0068869_100175136 | 3300005334 | Bacteria | 1678 |
| 23 | Ga0070666_10049186 | 3300005335 | Bacteria | 2832 |
| 24 | Ga0070666_10082669 | 3300005335 | Bacteria | 2196 |
| 25 | Ga0070666_10801000 | 3300005335 | Bacteria | 694 |
| 26 | Ga0068868_100014860 | 3300005338 | Bacteria | 5746 |
| 27 | Ga0068868_100069045 | 3300005338 | Bacteria | 2815 |
| 28 | Ga0070689_100027535 | 3300005340 | Bacteria | 4285 |
| 29 | Ga0070689_100083702 | 3300005340 | Bacteria | 2507 |
| 30 | Ga0070689_100356474 | 3300005340 | Bacteria | 1228 |
| 31 | Ga0070687_100047358 | 3300005343 | Bacteria | 2205 |
| 32 | Ga0070687_100218784 | 3300005343 | Unclassified | 1165 |
| 33 | Ga0070687_100339286 | 3300005343 | Bacteria | 966 |
| 34 | Ga0070687_100384039 | 3300005343 | Bacteria | 916 |
| 35 | Ga0070661_100122348 | 3300005344 | Bacteria | 1950 |
| 36 | Ga0070661_100954600 | 3300005344 | Bacteria | 710 |
| 37 | Ga0070692_10411575 | 3300005345 | Unclassified | 856 |
| 38 | Ga0070669_100174579 | 3300005353 | Bacteria | 1677 |
| 39 | Ga0070669_100832218 | 3300005353 | Unclassified | 786 |
| 40 | Ga0070669_101518613 | 3300005353 | Bacteria | 582 |
| 41 | Ga0070675_100102198 | 3300005354 | Bacteria | 2415 |
| 42 | Ga0070671_100110782 | 3300005355 | Bacteria | 2306 |
| 43 | Ga0070671_100187996 | 3300005355 | Bacteria | 1750 |
| 44 | Ga0070671_100270746 | 3300005355 | Bacteria | 1444 |
| 45 | Ga0070674_101220057 | 3300005356 | Bacteria | 668 |
| 46 | Ga0070673_100142725 | 3300005364 | Bacteria | 2021 |
| 47 | Ga0070673_100313996 | 3300005364 | Unclassified | 1383 |
| 48 | Ga0070688_100166558 | 3300005365 | Bacteria | 1517 |
| 49 | Ga0070688_100537198 | 3300005365 | Bacteria | 887 |
| 50 | Ga0070688_100732368 | 3300005365 | Bacteria | 768 |
| 51 | Ga0070659_100067305 | 3300005366 | Bacteria | 2840 |
| 52 | Ga0070667_100013697 | 3300005367 | Bacteria | 6701 |
| 53 | Ga0070709_10104819 | 3300005434 | Bacteria | 1890 |
| 54 | Ga0070714_100009251 | 3300005435 | Bacteria | 7741 |
| 55 | Ga0070713_100116409 | 3300005436 | Bacteria | 2337 |
| 56 | Ga0070713_100804633 | 3300005436 | Bacteria | 901 |
| 57 | Ga0070710_10255568 | 3300005437 | Bacteria | 1128 |
| 58 | Ga0070710_11078029 | 3300005437 | Bacteria | 589 |
| 59 | Ga0070701_10040627 | 3300005438 | Bacteria | 2366 |
| 60 | Ga0070711_100007938 | 3300005439 | Bacteria | 6473 |
| 61 | Ga0070705_100181035 | 3300005440 | Bacteria | 1428 |
| 62 | Ga0070700_100007273 | 3300005441 | Bacteria | 5966 |
| 63 | Ga0070663_100013463 | 3300005455 | Bacteria | 5218 |
| 64 | Ga0070663_100147032 | 3300005455 | Unclassified | 1804 |
| 65 | Ga0070663_100871939 | 3300005455 | Bacteria | 776 |
| 66 | Ga0070678_100285451 | 3300005456 | Bacteria | 1397 |
| 67 | Ga0070662_100007330 | 3300005457 | Bacteria | 7145 |
| 68 | Ga0068867_100043619 | 3300005459 | Bacteria | 3283 |
| 69 | Ga0070685_10495005 | 3300005466 | Unclassified | 864 |
| 70 | Ga0070706_100683017 | 3300005467 | Bacteria | 953 |
| 71 | Ga0070699_100044916 | 3300005518 | Bacteria | 3824 |
| 72 | Ga0070699_100086784 | 3300005518 | Unclassified | 2731 |
| 73 | Ga0070684_100024113 | 3300005535 | Bacteria | 5100 |
| 74 | Ga0070684_100294234 | 3300005535 | Bacteria | 1489 |
| 75 | Ga0068853_100279975 | 3300005539 | Bacteria | 1537 |
| 76 | Ga0068853_100538223 | 3300005539 | Bacteria | 1105 |
| 77 | Ga0070672_100019109 | 3300005543 | Bacteria | 4967 |
| 78 | Ga0070672_100852828 | 3300005543 | Unclassified | 803 |
| 79 | Ga0070686_100008180 | 3300005544 | Bacteria | 5852 |
| 80 | Ga0070686_100137067 | 3300005544 | Bacteria | 1699 |
| 81 | Ga0070695_100123321 | 3300005545 | Bacteria | 1776 |
| 82 | Ga0070695_100506148 | 3300005545 | Bacteria | 935 |
| 83 | Ga0070696_100695127 | 3300005546 | Bacteria | 828 |
| 84 | Ga0070665_100066968 | 3300005548 | Bacteria | 3602 |
| 85 | Ga0070665_100524982 | 3300005548 | Bacteria | 1196 |
| 86 | Ga0070665_101508848 | 3300005548 | Bacteria | 680 |
| 87 | Ga0070704_100123430 | 3300005549 | Unclassified | 1994 |
| 88 | Ga0070704_100140835 | 3300005549 | Bacteria | 1883 |
| 89 | Ga0070664_100248604 | 3300005564 | Bacteria | 1598 |
| 90 | Ga0070664_100654000 | 3300005564 | Bacteria | 977 |
| 91 | Ga0068857_100811931 | 3300005577 | Bacteria | 894 |
| 92 | Ga0068854_100034569 | 3300005578 | Bacteria | 3532 |
| 93 | Ga0068856_101104957 | 3300005614 | Bacteria | 810 |
| 94 | Ga0068856_101320219 | 3300005614 | Bacteria | 736 |
| 95 | Ga0070702_100020572 | 3300005615 | Bacteria | 3459 |
| 96 | Ga0070702_100202425 | 3300005615 | Bacteria | 1315 |
| 97 | Ga0068852_100065349 | 3300005616 | Bacteria | 3173 |
| 98 | Ga0068859_100120528 | 3300005617 | Bacteria | 2690 |
| 99 | Ga0068859_100147525 | 3300005617 | Bacteria | 2428 |
| 100 | Ga0068859_100186031 | 3300005617 | Unclassified | 2161 |
| 101 | Ga0068859_100442521 | 3300005617 | Unclassified | 1396 |
| 102 | Ga0068864_100126329 | 3300005618 | Bacteria | 2292 |
| 103 | Ga0068864_100363116 | 3300005618 | Bacteria | 1369 |
| 104 | Ga0068866_10010810 | 3300005718 | Bacteria | 3925 |
| 105 | Ga0068861_100011281 | 3300005719 | Bacteria | 6205 |
| 106 | Ga0068861_100251487 | 3300005719 | Bacteria | 1508 |
| 107 | Ga0068870_10003512 | 3300005840 | Bacteria | 6651 |
| 108 | Ga0068863_100282731 | 3300005841 | Unclassified | 1608 |
| 109 | Ga0068858_100032563 | 3300005842 | Bacteria | 4840 |
| 110 | Ga0068858_100547276 | 3300005842 | Bacteria | 1120 |
| 111 | Ga0068858_100958179 | 3300005842 | Bacteria | 838 |
| 112 | Ga0068860_100041885 | 3300005843 | Bacteria | 4375 |
| 113 | Ga0068860_101057255 | 3300005843 | Bacteria | 830 |
| 114 | Ga0068862_100090331 | 3300005844 | Bacteria | 2666 |
| 115 | Ga0068862_100856637 | 3300005844 | Unclassified | 891 |
| 116 | Ga0081455_10003886 | 3300005937 | Bacteria | 17015 |
| 117 | Ga0081455_10013304 | 3300005937 | Bacteria | 8144 |
| 118 | Ga0081455_10018742 | 3300005937 | Bacteria | 6570 |
| 119 | Ga0081455_10183573 | 3300005937 | Bacteria | 1582 |
| 120 | Ga0081455_10272105 | 3300005937 | Bacteria | 1228 |
| 121 | Ga0081455_10321140 | 3300005937 | Bacteria | 1103 |
| 122 | Ga0081538_10020271 | 3300005981 | Bacteria | 4904 |
| 123 | Ga0081540_1000245 | 3300005983 | Bacteria | 56994 |
| 124 | Ga0081540_1004291 | 3300005983 | Bacteria | 10923 |
| 125 | Ga0081540_1039856 | 3300005983 | Unclassified | 2457 |
| 126 | Ga0081540_1042912 | 3300005983 | Bacteria | 2327 |
| 127 | Ga0081539_10033395 | 3300005985 | Bacteria | 3135 |
| 128 | Ga0081539_10049156 | 3300005985 | Bacteria | 2395 |
| 129 | Ga0081539_10090932 | 3300005985 | Unclassified | 1577 |
| 130 | Ga0081539_10172122 | 3300005985 | Bacteria | 1023 |
| 131 | Ga0070717_10011616 | 3300006028 | Bacteria | 6696 |
| 132 | Ga0070717_10164880 | 3300006028 | Bacteria | 1924 |
| 133 | Ga0070717_10290752 | 3300006028 | Unclassified | 1451 |
| 134 | Ga0075365_10008586 | 3300006038 | Bacteria | 5814 |
| 135 | Ga0075365_10009939 | 3300006038 | Bacteria | 5510 |
| 136 | Ga0075365_10055888 | 3300006038 | Bacteria | 2622 |
| 137 | Ga0075365_10119318 | 3300006038 | Bacteria | 1818 |
| 138 | Ga0075365_10125591 | 3300006038 | Bacteria | 1773 |
| 139 | Ga0075365_10150464 | 3300006038 | Bacteria | 1619 |
| 140 | Ga0075365_10509971 | 3300006038 | Bacteria | 850 |
| 141 | Ga0075365_10737306 | 3300006038 | Unclassified | 696 |
| 142 | Ga0075368_10059132 | 3300006042 | Bacteria | 1533 |
| 143 | Ga0075368_10080152 | 3300006042 | Bacteria | 1328 |
| 144 | Ga0075368_10100105 | 3300006042 | Unclassified | 1190 |
| 145 | Ga0075363_100007933 | 3300006048 | Bacteria | 4917 |
| 146 | Ga0075363_100022852 | 3300006048 | Bacteria | 3165 |
| 147 | Ga0075363_100030948 | 3300006048 | Bacteria | 2772 |
| 148 | Ga0075363_100049492 | 3300006048 | Unclassified | 2238 |
| 149 | Ga0075363_100273578 | 3300006048 | Bacteria | 976 |
| 150 | Ga0075363_100283071 | 3300006048 | Bacteria | 959 |
| 151 | Ga0075364_10003031 | 3300006051 | Bacteria | 9487 |
| 152 | Ga0075364_10007069 | 3300006051 | Bacteria | 6636 |
| 153 | Ga0075364_10025002 | 3300006051 | Bacteria | 3798 |
| 154 | Ga0075364_10037264 | 3300006051 | Bacteria | 3148 |
| 155 | Ga0075364_10163586 | 3300006051 | Bacteria | 1503 |
| 156 | Ga0075364_10241864 | 3300006051 | Bacteria | 1226 |
| 157 | Ga0075364_10263272 | 3300006051 | Unclassified | 1172 |
| 158 | Ga0070715_10172234 | 3300006163 | Bacteria | 1079 |
| 159 | Ga0070715_10461583 | 3300006163 | Unclassified | 719 |
| 160 | Ga0070715_10731852 | 3300006163 | Bacteria | 594 |
| 161 | Ga0070716_100007056 | 3300006173 | Bacteria | 5514 |
| 162 | Ga0070716_100125323 | 3300006173 | Unclassified | 1615 |
| 163 | Ga0070716_100146413 | 3300006173 | Bacteria | 1514 |
| 164 | Ga0070716_100367275 | 3300006173 | Bacteria | 1024 |
| 165 | Ga0070716_100588097 | 3300006173 | Bacteria | 835 |
| 166 | Ga0070716_101265627 | 3300006173 | Unclassified | 595 |
| 167 | Ga0070712_100001758 | 3300006175 | Bacteria | 13261 |
| 168 | Ga0070712_100352172 | 3300006175 | Bacteria | 1205 |
| 169 | Ga0070712_100967831 | 3300006175 | Bacteria | 736 |
| 170 | Ga0075362_10019895 | 3300006177 | Bacteria | 2799 |
| 171 | Ga0075362_10020464 | 3300006177 | Bacteria | 2764 |
| 172 | Ga0075362_10036813 | 3300006177 | Bacteria | 2142 |
| 173 | Ga0075362_10057502 | 3300006177 | Unclassified | 1753 |
| 174 | Ga0075367_10001828 | 3300006178 | Bacteria | 9373 |
| 175 | Ga0075367_10004657 | 3300006178 | Bacteria | 6727 |
| 176 | Ga0075367_10007981 | 3300006178 | Bacteria | 5457 |
| 177 | Ga0075367_10043014 | 3300006178 | Bacteria | 2645 |
| 178 | Ga0075367_10066299 | 3300006178 | Bacteria | 2163 |
| 179 | Ga0075367_10255499 | 3300006178 | Bacteria | 1099 |
| 180 | Ga0075367_10260671 | 3300006178 | Bacteria | 1088 |
| 181 | Ga0075367_10330271 | 3300006178 | Bacteria | 961 |
| 182 | Ga0075369_10021741 | 3300006186 | Bacteria | 2640 |
| 183 | Ga0075369_10048892 | 3300006186 | Bacteria | 1826 |
| 184 | Ga0075369_10182922 | 3300006186 | Bacteria | 964 |
| 185 | Ga0075369_10396823 | 3300006186 | Unclassified | 650 |
| 186 | Ga0075366_10056361 | 3300006195 | Bacteria | 2334 |
| 187 | Ga0075366_10461541 | 3300006195 | Unclassified | 784 |
| 188 | Ga0097621_100016214 | 3300006237 | Bacteria | 5627 |
| 189 | Ga0075370_10061104 | 3300006353 | Bacteria | 2146 |
| 190 | Ga0075370_10374286 | 3300006353 | Bacteria | 853 |
| 191 | Ga0075370_10639621 | 3300006353 | Unclassified | 645 |
| 192 | Ga0068871_100043533 | 3300006358 | Bacteria | 3606 |
| 193 | Ga0075428_100062375 | 3300006844 | Bacteria | 4081 |
| 194 | Ga0075428_100065772 | 3300006844 | Bacteria | 3970 |
| 195 | Ga0075428_100144544 | 3300006844 | Bacteria | 2585 |
| 196 | Ga0075428_100174653 | 3300006844 | Bacteria | 2327 |
| 197 | Ga0075430_100032718 | 3300006846 | Bacteria | 4413 |
| 198 | Ga0075430_100045229 | 3300006846 | Bacteria | 3720 |
| 199 | Ga0075431_100023249 | 3300006847 | Bacteria | 6341 |
| 200 | Ga0075431_100054699 | 3300006847 | Bacteria | 4115 |
| 201 | Ga0075433_10018481 | 3300006852 | Bacteria | 5795 |
| 202 | Ga0075433_10206011 | 3300006852 | Unclassified | 1748 |
| 203 | Ga0075433_10365089 | 3300006852 | Bacteria | 1275 |
| 204 | Ga0075434_100016976 | 3300006871 | Bacteria | 7003 |
| 205 | Ga0075434_100034613 | 3300006871 | Bacteria | 4989 |
| 206 | Ga0075434_100050371 | 3300006871 | Bacteria | 4137 |
| 207 | Ga0075434_100508608 | 3300006871 | Unclassified | 1225 |
| 208 | Ga0075434_100956548 | 3300006871 | Bacteria | 871 |
| 209 | Ga0075434_101765230 | 3300006871 | Bacteria | 626 |
| 210 | Ga0075429_100012864 | 3300006880 | Bacteria | 7260 |
| 211 | Ga0075429_100201436 | 3300006880 | Bacteria | 1744 |
| 212 | Ga0075429_100425590 | 3300006880 | Unclassified | 1163 |
| 213 | Ga0075429_100799895 | 3300006880 | Bacteria | 826 |
| 214 | Ga0075436_101400004 | 3300006914 | Bacteria | 530 |
| 215 | Ga0097620_100120529 | 3300006931 | Bacteria | 2690 |
| 216 | Ga0097620_100147534 | 3300006931 | Bacteria | 2428 |
| 217 | Ga0097620_100186017 | 3300006931 | Unclassified | 2161 |
| 218 | Ga0097620_100442478 | 3300006931 | Unclassified | 1396 |
| 219 | Ga0075435_100038695 | 3300007076 | Bacteria | 3803 |
| 220 | Ga0075435_100065738 | 3300007076 | Unclassified | 2949 |
| 221 | Ga0075435_100267747 | 3300007076 | Bacteria | 1457 |
| 222 | Ga0075435_101173153 | 3300007076 | Bacteria | 672 |
| 223 | Ga0099794_10028683 | 3300007265 | Bacteria | 2589 |
| 224 | Ga0099795_10001119 | 3300007788 | Bacteria | 5577 |
| 225 | Ga0105240_10497632 | 3300009093 | Bacteria | 1356 |
| 226 | Ga0111539_10101233 | 3300009094 | Bacteria | 3383 |
| 227 | Ga0111539_10115691 | 3300009094 | Bacteria | 3144 |
| 228 | Ga0111539_10242870 | 3300009094 | Bacteria | 2097 |
| 229 | Ga0111539_10838454 | 3300009094 | Bacteria | 1070 |
| 230 | Ga0105245_10000301 | 3300009098 | Bacteria | 47401 |
| 231 | Ga0105245_10058772 | 3300009098 | Bacteria | 3461 |
| 232 | Ga0105245_10407347 | 3300009098 | Bacteria | 1360 |
| 233 | Ga0105245_12264343 | 3300009098 | Bacteria | 597 |
| 234 | Ga0105247_10006172 | 3300009101 | Bacteria | 7437 |
| 235 | Ga0105247_11527821 | 3300009101 | Bacteria | 545 |
| 236 | Ga0114129_10011285 | 3300009147 | Bacteria | 12732 |
| 237 | Ga0114129_10038749 | 3300009147 | Bacteria | 6719 |
| 238 | Ga0114129_10039522 | 3300009147 | Bacteria | 6652 |
| 239 | Ga0114129_10261955 | 3300009147 | Unclassified | 2317 |
| 240 | Ga0114129_10530565 | 3300009147 | Bacteria | 1533 |
| 241 | Ga0105243_10140290 | 3300009148 | Bacteria | 2061 |
| 242 | Ga0105243_10220173 | 3300009148 | Bacteria | 1677 |
| 243 | Ga0105242_10050357 | 3300009176 | Bacteria | 3391 |
| 244 | Ga0105242_10350170 | 3300009176 | Bacteria | 1364 |
| 245 | Ga0105242_11104558 | 3300009176 | Bacteria | 807 |
| 246 | Ga0105242_11167055 | 3300009176 | Bacteria | 788 |
| 247 | Ga0105242_11904560 | 3300009176 | Bacteria | 635 |
| 248 | Ga0105248_10010977 | 3300009177 | Bacteria | 9994 |
| 249 | Ga0105248_10012485 | 3300009177 | Bacteria | 9370 |
| 250 | Ga0105248_10238720 | 3300009177 | Bacteria | 2046 |
| 251 | Ga0105237_10035802 | 3300009545 | Bacteria | 5021 |
| 252 | Ga0105237_10243475 | 3300009545 | Bacteria | 1800 |
| 253 | Ga0105238_10016854 | 3300009551 | Bacteria | 7411 |
| 254 | Ga0105238_10115144 | 3300009551 | Bacteria | 2668 |
| 255 | Ga0105238_10158173 | 3300009551 | Bacteria | 2241 |
| 256 | Ga0105249_10065054 | 3300009553 | Bacteria | 3353 |
| 257 | Ga0105249_10780461 | 3300009553 | Unclassified | 1019 |
| 258 | Ga0099796_10000877 | 3300010159 | Bacteria | 5567 |
| 259 | Ga0105239_10106857 | 3300010375 | Unclassified | 3100 |
| 260 | Ga0105239_10346130 | 3300010375 | Bacteria | 1678 |
| 261 | Ga0105239_11071227 | 3300010375 | Unclassified | 928 |
| 262 | Ga0105246_10023628 | 3300011119 | Bacteria | 3980 |
| 263 | Ga0105246_10077777 | 3300011119 | Unclassified | 2355 |
| 264 | Ga0105246_10205392 | 3300011119 | Bacteria | 1534 |
| 265 | Ga0105246_11439627 | 3300011119 | Bacteria | 644 |
| 266 | Ga0157336_1010167 | 3300012477 | Bacteria | 712 |
| 267 | Ga0157370_10323436 | 3300013104 | Bacteria | 1422 |
| 268 | Ga0157369_10067717 | 3300013105 | Bacteria | 3837 |
| 269 | Ga0157374_10002466 | 3300013296 | Bacteria | 15626 |
| 270 | Ga0157374_11503611 | 3300013296 | Unclassified | 697 |
| 271 | Ga0157378_10145081 | 3300013297 | Bacteria | 2207 |
| 272 | Ga0157378_10849898 | 3300013297 | Bacteria | 941 |
| 273 | Ga0157378_11005618 | 3300013297 | Unclassified | 868 |
| 274 | Ga0163162_10638510 | 3300013306 | Unclassified | 1189 |
| 275 | Ga0157372_11548250 | 3300013307 | Bacteria | 764 |
| 276 | Ga0157375_10045749 | 3300013308 | Bacteria | 4260 |
| 277 | Ga0157375_10307779 | 3300013308 | Bacteria | 1748 |
| 278 | Ga0157375_10797496 | 3300013308 | Unclassified | 1093 |
| 279 | Ga0163163_10024687 | 3300014325 | Bacteria | 5724 |
| 280 | Ga0163163_10031093 | 3300014325 | Bacteria | 5150 |
| 281 | Ga0157380_10044463 | 3300014326 | Bacteria | 3481 |
| 282 | Ga0157380_10279823 | 3300014326 | Bacteria | 1526 |
| 283 | Ga0157380_10428025 | 3300014326 | Bacteria | 1264 |
| 284 | Ga0157380_10922422 | 3300014326 | Unclassified | 901 |
| 285 | Ga0157377_10012638 | 3300014745 | Bacteria | 4250 |
| 286 | Ga0157379_10039921 | 3300014968 | Bacteria | 4188 |
| 287 | Ga0157379_11441810 | 3300014968 | Bacteria | 668 |
| 288 | Ga0157376_10263600 | 3300014969 | Bacteria | 1615 |
| 289 | Ga0163161_10039612 | 3300017792 | Bacteria | 3383 |
| 290 | Ga0163161_10188804 | 3300017792 | Bacteria | 1583 |
| 291 | Ga0163161_10548376 | 3300017792 | Bacteria | 947 |
| 292 | Ga0213872_10089660 | 3300021361 | Unclassified | 1377 |
| 293 | Ga0209148_1000037 | 3300025254 | Bacteria | 494767 |
| 294 | Ga0209233_1000087 | 3300025261 | Bacteria | 325225 |
| 295 | Ga0209455_1000036 | 3300025272 | Bacteria | 473309 |
| 296 | Ga0209130_1000909 | 3300025284 | Bacteria | 23891 |
| 297 | Ga0207426_1000366 | 3300025302 | Bacteria | 80234 |
| 298 | Ga0207697_10042033 | 3300025315 | Bacteria | 1877 |
| 299 | Ga0207697_10194933 | 3300025315 | Bacteria | 890 |
| 300 | Ga0207692_10040961 | 3300025898 | Bacteria | 2290 |
| 301 | Ga0207692_10048516 | 3300025898 | Unclassified | 2138 |
| 302 | Ga0207692_10330109 | 3300025898 | Bacteria | 936 |
| 303 | Ga0207710_10015598 | 3300025900 | Bacteria | 3214 |
| 304 | Ga0207688_10000117 | 3300025901 | Bacteria | 32379 |
| 305 | Ga0207680_10050728 | 3300025903 | Bacteria | 2477 |
| 306 | Ga0207647_10024618 | 3300025904 | Bacteria | 3968 |
| 307 | Ga0207647_10216020 | 3300025904 | Bacteria | 1106 |
| 308 | Ga0207685_10011886 | 3300025905 | Unclassified | 2637 |
| 309 | Ga0207699_10011887 | 3300025906 | Bacteria | 4412 |
| 310 | Ga0207699_10234770 | 3300025906 | Bacteria | 1257 |
| 311 | Ga0207645_10018258 | 3300025907 | Bacteria | 4619 |
| 312 | Ga0207643_10000291 | 3300025908 | Bacteria | 34985 |
| 313 | Ga0207684_10060885 | 3300025910 | Bacteria | 3206 |
| 314 | Ga0207695_11238063 | 3300025913 | Bacteria | 627 |
| 315 | Ga0207671_10060060 | 3300025914 | Bacteria | 2820 |
| 316 | Ga0207671_10177522 | 3300025914 | Bacteria | 1656 |
| 317 | Ga0207693_10006232 | 3300025915 | Bacteria | 9894 |
| 318 | Ga0207693_10044042 | 3300025915 | Bacteria | 3507 |
| 319 | Ga0207693_10238127 | 3300025915 | Bacteria | 1429 |
| 320 | Ga0207663_10012786 | 3300025916 | Bacteria | 4546 |
| 321 | Ga0207663_10612737 | 3300025916 | Bacteria | 856 |
| 322 | Ga0207662_10004840 | 3300025918 | Bacteria | 7122 |
| 323 | Ga0207657_10054531 | 3300025919 | Bacteria | 3456 |
| 324 | Ga0207649_10030096 | 3300025920 | Bacteria | 3212 |
| 325 | Ga0207649_10563100 | 3300025920 | Bacteria | 873 |
| 326 | Ga0207646_10427537 | 3300025922 | Bacteria | 1195 |
| 327 | Ga0207681_10048673 | 3300025923 | Bacteria | 2862 |
| 328 | Ga0207694_10070158 | 3300025924 | Bacteria | 2737 |
| 329 | Ga0207694_10212409 | 3300025924 | Bacteria | 1576 |
| 330 | Ga0207650_10007981 | 3300025925 | Bacteria | 7216 |
| 331 | Ga0207650_10256966 | 3300025925 | Bacteria | 1416 |
| 332 | Ga0207650_10445359 | 3300025925 | Bacteria | 1077 |
| 333 | Ga0207659_10016345 | 3300025926 | Bacteria | 4827 |
| 334 | Ga0207687_10002101 | 3300025927 | Bacteria | 13619 |
| 335 | Ga0207687_10183490 | 3300025927 | Bacteria | 1623 |
| 336 | Ga0207687_10790182 | 3300025927 | Bacteria | 809 |
| 337 | Ga0207700_10000458 | 3300025928 | Bacteria | 23936 |
| 338 | Ga0207700_10108611 | 3300025928 | Unclassified | 2228 |
| 339 | Ga0207700_10195977 | 3300025928 | Bacteria | 1700 |
| 340 | Ga0207700_10200849 | 3300025928 | Bacteria | 1680 |
| 341 | Ga0207664_10031202 | 3300025929 | Bacteria | 4076 |
| 342 | Ga0207644_10159770 | 3300025931 | Bacteria | 1751 |
| 343 | Ga0207644_10180125 | 3300025931 | Bacteria | 1655 |
| 344 | Ga0207644_10246499 | 3300025931 | Bacteria | 1424 |
| 345 | Ga0207644_10361623 | 3300025931 | Unclassified | 1181 |
| 346 | Ga0207690_10056792 | 3300025932 | Bacteria | 2642 |
| 347 | Ga0207690_10059084 | 3300025932 | Bacteria | 2597 |
| 348 | Ga0207706_10022984 | 3300025933 | Bacteria | 5599 |
| 349 | Ga0207686_10007270 | 3300025934 | Bacteria | 5958 |
| 350 | Ga0207686_10114180 | 3300025934 | Bacteria | 1827 |
| 351 | Ga0207686_11475772 | 3300025934 | Bacteria | 560 |
| 352 | Ga0207709_10071644 | 3300025935 | Bacteria | 2202 |
| 353 | Ga0207670_10195365 | 3300025936 | Bacteria | 1534 |
| 354 | Ga0207670_10284947 | 3300025936 | Bacteria | 1289 |
| 355 | Ga0207670_10311262 | 3300025936 | Bacteria | 1236 |
| 356 | Ga0207704_10278966 | 3300025938 | Bacteria | 1269 |
| 357 | Ga0207665_10006165 | 3300025939 | Bacteria | 7962 |
| 358 | Ga0207665_10192106 | 3300025939 | Unclassified | 1484 |
| 359 | Ga0207665_10337792 | 3300025939 | Bacteria | 1134 |
| 360 | Ga0207665_10569866 | 3300025939 | Bacteria | 881 |
| 361 | Ga0207665_10636485 | 3300025939 | Bacteria | 835 |
| 362 | Ga0207691_10012255 | 3300025940 | Bacteria | 8219 |
| 363 | Ga0207711_10055291 | 3300025941 | Bacteria | 3408 |
| 364 | Ga0207711_10168732 | 3300025941 | Bacteria | 1985 |
| 365 | Ga0207689_10018113 | 3300025942 | Bacteria | 5948 |
| 366 | Ga0207661_10228448 | 3300025944 | Bacteria | 1647 |
| 367 | Ga0207679_10065067 | 3300025945 | Bacteria | 2727 |
| 368 | Ga0207679_10409974 | 3300025945 | Unclassified | 1194 |
| 369 | Ga0207667_10533632 | 3300025949 | Bacteria | 1188 |
| 370 | Ga0207651_10034648 | 3300025960 | Bacteria | 3272 |
| 371 | Ga0207651_10261877 | 3300025960 | Bacteria | 1420 |
| 372 | Ga0207712_10066107 | 3300025961 | Bacteria | 2584 |
| 373 | Ga0207712_10435152 | 3300025961 | Unclassified | 1109 |
| 374 | Ga0207668_10005839 | 3300025972 | Bacteria | 7248 |
| 375 | Ga0207668_11275738 | 3300025972 | Unclassified | 661 |
| 376 | Ga0207640_10013472 | 3300025981 | Bacteria | 4688 |
| 377 | Ga0207640_11015359 | 3300025981 | Bacteria | 730 |
| 378 | Ga0207658_10088942 | 3300025986 | Bacteria | 2389 |
| 379 | Ga0207677_10019084 | 3300026023 | Bacteria | 4132 |
| 380 | Ga0207677_10028823 | 3300026023 | Bacteria | 3519 |
| 381 | Ga0207703_10050960 | 3300026035 | Bacteria | 3352 |
| 382 | Ga0207703_10324521 | 3300026035 | Bacteria | 1411 |
| 383 | Ga0207639_10635195 | 3300026041 | Bacteria | 987 |
| 384 | Ga0207678_10121486 | 3300026067 | Bacteria | 2229 |
| 385 | Ga0207678_10167598 | 3300026067 | Bacteria | 1875 |
| 386 | Ga0207678_10802073 | 3300026067 | Bacteria | 831 |
| 387 | Ga0207708_10001828 | 3300026075 | Bacteria | 15698 |
| 388 | Ga0207708_11258456 | 3300026075 | Bacteria | 648 |
| 389 | Ga0207702_10283733 | 3300026078 | Bacteria | 1566 |
| 390 | Ga0207702_10510880 | 3300026078 | Bacteria | 1172 |
| 391 | Ga0207702_12194360 | 3300026078 | Bacteria | 541 |
| 392 | Ga0207641_10072273 | 3300026088 | Bacteria | 2970 |
| 393 | Ga0207641_10360527 | 3300026088 | Bacteria | 1388 |
| 394 | Ga0207641_11246540 | 3300026088 | Bacteria | 744 |
| 395 | Ga0207648_10028571 | 3300026089 | Bacteria | 4944 |
| 396 | Ga0207676_10036735 | 3300026095 | Bacteria | 3729 |
| 397 | Ga0207676_10557770 | 3300026095 | Bacteria | 1095 |
| 398 | Ga0207674_10504821 | 3300026116 | Bacteria | 1168 |
| 399 | Ga0207675_100023684 | 3300026118 | Bacteria | 5712 |
| 400 | Ga0207675_100037669 | 3300026118 | Bacteria | 4511 |
| 401 | Ga0207675_100799042 | 3300026118 | Bacteria | 957 |
| 402 | Ga0207698_10311949 | 3300026142 | Bacteria | 1469 |
| 403 | Ga0209588_1064242 | 3300027671 | Bacteria | 1186 |
| 404 | Ga0209813_10007840 | 3300027866 | Bacteria | 2673 |
| 405 | Ga0207428_10519932 | 3300027907 | Unclassified | 863 |
| 406 | Ga0268266_10050992 | 3300028379 | Bacteria | 3551 |
| 407 | Ga0268266_10271728 | 3300028379 | Bacteria | 1574 |
| 408 | Ga0268265_10173676 | 3300028380 | Bacteria | 1844 |
| 409 | Ga0268265_10875467 | 3300028380 | Unclassified | 880 |
| 410 | Ga0268264_10037501 | 3300028381 | Bacteria | 3996 |
| 411 | Ga0268264_10219335 | 3300028381 | Bacteria | 1750 |
| 412 | Ga0268264_10839258 | 3300028381 | Unclassified | 920 |
| 413 | Ga0373923_0316902 | 3300035111 | Bacteria | 740 |
| 414 | Ga0373936_0052186 | 3300035113 | Bacteria | 1656 |
| 415 | Ga0373943_0398493 | 3300035170 | Bacteria | 794 |
| 416 | Ga0373946_0019631 | 3300035171 | Bacteria | 2605 |
| 417 | Ga0373946_0325964 | 3300035171 | Unclassified | 764 |
| 418 | Ga0373931_0147176 | 3300035691 | Bacteria | 1370 |
| 419 | Ga0373931_0148597 | 3300035691 | Bacteria | 1364 |
| 420 | Ga0373931_0191953 | 3300035691 | Unclassified | 1216 |
| 421 | Ga0373931_0346757 | 3300035691 | Bacteria | 929 |
| 422 | Ga0373931_0954204 | 3300035691 | Unclassified | 578 |
| 423 | Ga0373935_0071894 | 3300035692 | Unclassified | 2233 |
| 424 | Ga0373935_0264463 | 3300035692 | Bacteria | 1207 |
| 425 | Ga0373927_0024586 | 3300035695 | Bacteria | 3938 |
| 426 | Ga0373927_0211595 | 3300035695 | Bacteria | 1273 |
| 427 | Ga0373947_0005360 | 3300035725 | Bacteria | 7485 |
| 428 | Ga0373925_0394981 | 3300037068 | Unclassified | 1127 |
| 429 | Ga0395900_1261997 | 3300037418 | Unclassified | 653 |
| 430 | Ga0395905_0118821 | 3300037471 | Unclassified | 2485 |
| 431 | Ga0395901_0568228 | 3300038443 | Unclassified | 1147 |
| 432 | Ga0436365_1098622 | 3300039437 | Bacteria | 3912 |
| 433 | Ga0436360_1293235 | 3300039438 | Bacteria | 545 |
| 434 | Ga0436361_0416025 | 3300039447 | Bacteria | 7315 |
| 435 | Ga0436363_0085767 | 3300039450 | Unclassified | 2132 |
| 436 | Ga0436363_0090918 | 3300039450 | Bacteria | 1892 |
| 437 | Ga0436362_0106370 | 3300039453 | Bacteria | 575 |
| 438 | Ga0436362_0276156 | 3300039453 | Bacteria | 667 |
| 439 | Ga0439466_0112665 | 3300041411 | Bacteria | 843 |
| 440 | Ga0451795_0313201 | 3300041456 | Unclassified | 672 |
| 441 | Ga0451802_1451856 | 3300041460 | Unclassified | 783 |
| 442 | Ga0450907_004366 | 3300042146 | Bacteria | 2445 |
| 443 | Ga0495617_099212 | 3300046452 | Bacteria | 947 |
| 444 | Ga0495603_0020414 | 3300046455 | Bacteria | 4015 |
| 445 | Ga0495590_0126746 | 3300046457 | Bacteria | 917 |
| 446 | Ga0495591_066331 | 3300046458 | Bacteria | 947 |
| 447 | Ga0495629_0075660 | 3300046459 | Bacteria | 2351 |
| 448 | Ga0495638_0553777 | 3300046460 | Bacteria | 571 |
| 449 | Ga0495582_0220822 | 3300046473 | Unclassified | 1084 |
| 450 | Ga0495605_0025009 | 3300046474 | Bacteria | 3117 |
| 451 | Ga0495605_0130673 | 3300046474 | Bacteria | 1133 |
| 452 | Ga0495662_0102954 | 3300046476 | Bacteria | 1397 |
| 453 | Ga0495584_0014161 | 3300046491 | Bacteria | 4064 |
| 454 | Ga0495584_0015339 | 3300046491 | Unclassified | 3904 |
| 455 | Ga0495585_0004639 | 3300046492 | Bacteria | 8872 |
| 456 | Ga0495594_0083137 | 3300046499 | Bacteria | 1789 |
| 457 | Ga0495596_0021949 | 3300046500 | Bacteria | 2601 |
| 458 | Ga0495596_0229315 | 3300046500 | Bacteria | 721 |
| 459 | Ga0495607_0182328 | 3300046501 | Bacteria | 1052 |
| 460 | Ga0495618_0517197 | 3300046514 | Unclassified | 718 |
| 461 | Ga0495620_0097447 | 3300046515 | Bacteria | 1175 |
| 462 | Ga0495630_0309993 | 3300046517 | Bacteria | 1206 |
| 463 | Ga0495631_0039464 | 3300046518 | Unclassified | 2095 |
| 464 | Ga0495631_0201996 | 3300046518 | Bacteria | 850 |
| 465 | Ga0495637_0057033 | 3300046520 | Bacteria | 1615 |
| 466 | Ga0495663_0003607 | 3300046525 | Bacteria | 4446 |
| 467 | Ga0495665_0071093 | 3300046531 | Unclassified | 1833 |
| 468 | Ga0495640_0014540 | 3300046533 | Bacteria | 5950 |
| 469 | Ga0495598_0022026 | 3300046537 | Bacteria | 1701 |
| 470 | Ga0495621_0032439 | 3300046539 | Unclassified | 1796 |
| 471 | Ga0495621_0372604 | 3300046539 | Unclassified | 602 |
| 472 | Ga0495633_0114777 | 3300046558 | Bacteria | 1248 |
| 473 | Ga0495611_0158563 | 3300046648 | Bacteria | 1057 |
| 474 | Ga0495625_0185052 | 3300046660 | Bacteria | 1383 |
| 475 | Ga0495659_0181370 | 3300046664 | Unclassified | 857 |
| 476 | Ga0495661_0493282 | 3300046665 | Bacteria | 585 |
| 477 | Ga0495647_0016089 | 3300046681 | Bacteria | 2630 |
| 478 | Ga0495647_0191018 | 3300046681 | Unclassified | 895 |
| 479 | Ga0495658_0115688 | 3300046683 | Bacteria | 1617 |
| 480 | Ga0495613_0043735 | 3300046689 | Bacteria | 3314 |
| 481 | Ga0495624_0039728 | 3300046690 | Bacteria | 3016 |
| 482 | Ga0495671_0074213 | 3300046692 | Bacteria | 1669 |
| 483 | Ga0495649_0019711 | 3300046694 | Bacteria | 3787 |
| 484 | Ga0495589_0051663 | 3300046794 | Bacteria | 2032 |
| 485 | Ga0495660_0276742 | 3300046810 | Bacteria | 769 |
| 486 | Ga0495581_0086007 | 3300047315 | Bacteria | 1823 |
| 487 | Ga0495581_0098661 | 3300047315 | Unclassified | 1697 |
| 488 | Ga0495581_0124534 | 3300047315 | Bacteria | 1501 |
| 489 | Ga0495581_0498423 | 3300047315 | Bacteria | 708 |
| 490 | Ga0495674_0403046 | 3300047319 | Unclassified | 1104 |
| 491 | Ga0495672_0038267 | 3300047320 | Bacteria | 2928 |
| 492 | Ga0495676_0178746 | 3300047321 | Bacteria | 1488 |
| 493 | Ga0495676_0182041 | 3300047321 | Unclassified | 1472 |
| 494 | Ga0495676_0426215 | 3300047321 | Bacteria | 877 |
| 495 | Ga0495683_0291312 | 3300047323 | Bacteria | 704 |
| 496 | Ga0495593_0039641 | 3300047673 | Bacteria | 2539 |
| 497 | Ga0495614_0266897 | 3300048089 | Bacteria | 786 |
| 498 | Ga0496100_0004121 | 3300048903 | Bacteria | 7665 |
| 499 | Ga0496100_0034871 | 3300048903 | Bacteria | 3161 |
| 500 | Ga0496100_0138972 | 3300048903 | Unclassified | 1719 |
| 501 | Ga0496101_0002301 | 3300048904 | Bacteria | 11683 |
| 502 | Ga0496101_0006780 | 3300048904 | Bacteria | 7384 |
| 503 | Ga0496101_0109660 | 3300048904 | Bacteria | 2076 |
| 504 | Ga0496101_0163726 | 3300048904 | Unclassified | 1707 |
| 505 | Ga0496101_0282178 | 3300048904 | Unclassified | 1298 |
| 506 | Ga0496101_0578467 | 3300048904 | Bacteria | 888 |
| 507 | Ga0496102_0001907 | 3300048905 | Bacteria | 17978 |
| 508 | Ga0496102_0016244 | 3300048905 | Bacteria | 6504 |
| 509 | Ga0496102_0051818 | 3300048905 | Bacteria | 3738 |
| 510 | Ga0496102_0236631 | 3300048905 | Bacteria | 1722 |
| 511 | Ga0496102_0494203 | 3300048905 | Bacteria | 1145 |
| 512 | Ga0496103_0005487 | 3300048906 | Bacteria | 7583 |
| 513 | Ga0496103_0070261 | 3300048906 | Bacteria | 2190 |
| 514 | Ga0496103_0224945 | 3300048906 | Unclassified | 1207 |
| 515 | Ga0496104_0001787 | 3300048907 | Bacteria | 18622 |
| 516 | Ga0496104_0003321 | 3300048907 | Bacteria | 13883 |
| 517 | Ga0496104_0013709 | 3300048907 | Bacteria | 7310 |
| 518 | Ga0496104_0019430 | 3300048907 | Bacteria | 6216 |
| 519 | Ga0496104_0090210 | 3300048907 | Bacteria | 2928 |
| 520 | Ga0496104_0254604 | 3300048907 | Bacteria | 1668 |
| 521 | Ga0496105_0005141 | 3300048908 | Bacteria | 9925 |
| 522 | Ga0496105_0011008 | 3300048908 | Bacteria | 7130 |
| 523 | Ga0496105_0013382 | 3300048908 | Bacteria | 6511 |
| 524 | Ga0496105_0320515 | 3300048908 | Bacteria | 1242 |
| 525 | Ga0496106_0001903 | 3300048909 | Bacteria | 15629 |
| 526 | Ga0496106_0081808 | 3300048909 | Bacteria | 2481 |
| 527 | Ga0496106_0130364 | 3300048909 | Bacteria | 1971 |
| 528 | Ga0496106_0380848 | 3300048909 | Bacteria | 1134 |
| 529 | Ga0496106_0714330 | 3300048909 | Bacteria | 798 |
| 530 | Ga0496107_0000742 | 3300048910 | Bacteria | 18683 |
| 531 | Ga0496107_0001577 | 3300048910 | Bacteria | 14176 |
| 532 | Ga0496107_0135608 | 3300048910 | Bacteria | 1818 |
| 533 | Ga0496107_0224009 | 3300048910 | Bacteria | 1399 |
| 534 | Ga0496107_0548098 | 3300048910 | Unclassified | 857 |
| 535 | Ga0496108_0004907 | 3300048911 | Bacteria | 10804 |
| 536 | Ga0496108_0005149 | 3300048911 | Bacteria | 10570 |
| 537 | Ga0496108_0012312 | 3300048911 | Bacteria | 6957 |
| 538 | Ga0496108_0023055 | 3300048911 | Bacteria | 5121 |
| 539 | Ga0496108_0117243 | 3300048911 | Bacteria | 2281 |
| 540 | Ga0496108_0293757 | 3300048911 | Bacteria | 1415 |
| 541 | Ga0496108_0680538 | 3300048911 | Bacteria | 893 |
| 542 | Ga0496108_0781961 | 3300048911 | Bacteria | 824 |
| 543 | Ga0496109_0001273 | 3300048912 | Bacteria | 20907 |
| 544 | Ga0496109_0002185 | 3300048912 | Bacteria | 16231 |
| 545 | Ga0496109_0005798 | 3300048912 | Bacteria | 10340 |
| 546 | Ga0496109_0007347 | 3300048912 | Bacteria | 9319 |
| 547 | Ga0496109_0012097 | 3300048912 | Bacteria | 7439 |
| 548 | Ga0496109_0589290 | 3300048912 | Unclassified | 1048 |
| 549 | Ga0496110_0001267 | 3300048913 | Bacteria | 18072 |
| 550 | Ga0496110_0001439 | 3300048913 | Bacteria | 17212 |
| 551 | Ga0496110_0008474 | 3300048913 | Bacteria | 8276 |
| 552 | Ga0496110_0010029 | 3300048913 | Bacteria | 7686 |
| 553 | Ga0496110_0128093 | 3300048913 | Bacteria | 2291 |
| 554 | Ga0496110_0154263 | 3300048913 | Unclassified | 2080 |
| 555 | Ga0496110_0189820 | 3300048913 | Unclassified | 1866 |
| 556 | Ga0496110_0439868 | 3300048913 | Unclassified | 1188 |
| 557 | Ga0496111_0004907 | 3300048914 | Bacteria | 8499 |
| 558 | Ga0496111_0005865 | 3300048914 | Bacteria | 7920 |
| 559 | Ga0496111_0011164 | 3300048914 | Bacteria | 6046 |
| 560 | Ga0496111_0026573 | 3300048914 | Bacteria | 4088 |
| 561 | Ga0496111_0076354 | 3300048914 | Unclassified | 2442 |
| 562 | Ga0496111_0239192 | 3300048914 | Bacteria | 1348 |
| 563 | Ga0496112_0002066 | 3300048915 | Bacteria | 15919 |
| 564 | Ga0496112_0021566 | 3300048915 | Bacteria | 6127 |
| 565 | Ga0496112_0139833 | 3300048915 | Unclassified | 2391 |
| 566 | Ga0496112_0271257 | 3300048915 | Unclassified | 1645 |
| 567 | Ga0496112_0419389 | 3300048915 | Unclassified | 1277 |
| 568 | Ga0496112_0536869 | 3300048915 | Bacteria | 1104 |
| 569 | Ga0496112_0570047 | 3300048915 | Bacteria | 1065 |
| 570 | Ga0496113_0000303 | 3300048916 | Bacteria | 23409 |
| 571 | Ga0496113_0032411 | 3300048916 | Bacteria | 3798 |
| 572 | Ga0496113_0165545 | 3300048916 | Bacteria | 1749 |
| 573 | Ga0496113_0171762 | 3300048916 | Bacteria | 1717 |
| 574 | Ga0496113_0190595 | 3300048916 | Bacteria | 1627 |
| 575 | Ga0496113_0277496 | 3300048916 | Unclassified | 1340 |
| 576 | Ga0496113_0279872 | 3300048916 | Bacteria | 1334 |
| 577 | Ga0496113_1051702 | 3300048916 | Bacteria | 640 |
| 578 | Ga0496114_0551285 | 3300048917 | Bacteria | 1018 |
| 579 | Ga0496114_1338404 | 3300048917 | Unclassified | 603 |
| 580 | Ga0496114_1525596 | 3300048917 | Bacteria | 556 |
| 581 | Ga0496115_0015774 | 3300048918 | Bacteria | 5738 |
| 582 | Ga0496115_0018692 | 3300048918 | Bacteria | 5327 |
| 583 | Ga0496115_0041111 | 3300048918 | Bacteria | 3677 |
| 584 | Ga0496115_0051494 | 3300048918 | Bacteria | 3302 |
| 585 | Ga0496115_0097278 | 3300048918 | Bacteria | 2410 |
| 586 | Ga0496117_0140566 | 3300048920 | Bacteria | 1447 |
| 587 | Ga0501040_1296955 | 3300049576 | Bacteria | 528 |
| 588 | Ga0501067_0058873 | 3300049583 | Bacteria | 2127 |
| 589 | Ga0501069_0165456 | 3300049585 | Unclassified | 1275 |
| 590 | Ga0501074_1253733 | 3300049590 | Bacteria | 520 |
| 591 | Ga0501079_0176397 | 3300049741 | Unclassified | 1667 |
| 592 | Ga0501081_0552876 | 3300049743 | Bacteria | 860 |
| 593 | Ga0501083_0298895 | 3300049744 | Bacteria | 1047 |
| 594 | nmdc:mga03683_111289_c1 | 3300050489 | Unclassified | 1211 |
| 595 | nmdc:mga03683_133716_c1 | 3300050489 | Bacteria | 1111 |
| 596 | nmdc:mga03683_96704_c1 | 3300050489 | Bacteria | 1294 |
| 597 | nmdc:mga03n38_10892_c1 | 3300050490 | Bacteria | 3367 |
| 598 | nmdc:mga03n38_16037_c1 | 3300050490 | Unclassified | 2907 |
| 599 | nmdc:mga03n38_292890_c1 | 3300050490 | Unclassified | 872 |
| 600 | nmdc:mga03n38_59336_c1 | 3300050490 | Bacteria | 1736 |
| 601 | nmdc:mga03n38_61205_c1 | 3300050490 | Bacteria | 1714 |
| 602 | nmdc:mga00v17_19320_c1 | 3300050491 | Unclassified | 3889 |
| 603 | nmdc:mga00v17_196555_c1 | 3300050491 | Bacteria | 1303 |
| 604 | nmdc:mga00v17_229611_c1 | 3300050491 | Bacteria | 1202 |
| 605 | nmdc:mga00v17_25999_c1 | 3300050491 | Bacteria | 3406 |
| 606 | nmdc:mga00v17_260268_c1 | 3300050491 | Unclassified | 1125 |
| 607 | nmdc:mga00v17_3784_c1 | 3300050491 | Bacteria | 7811 |
| 608 | nmdc:mga0yw44_167927_c1 | 3300050492 | Bacteria | 1440 |
| 609 | nmdc:mga0yw44_17544_c1 | 3300050492 | Bacteria | 3898 |
| 610 | nmdc:mga0yw44_176099_c1 | 3300050492 | Bacteria | 1406 |
| 611 | nmdc:mga0yw44_222330_c1 | 3300050492 | Bacteria | 1252 |
| 612 | nmdc:mga0yw44_41949_c1 | 3300050492 | Bacteria | 2726 |
| 613 | nmdc:mga0yw44_553900_c1 | 3300050492 | Bacteria | 781 |
| 614 | nmdc:mga0yw44_68052_c1 | 3300050492 | Bacteria | 2202 |
| 615 | nmdc:mga0yw44_697023_c1 | 3300050492 | Unclassified | 690 |
| 616 | nmdc:mga0yw44_8043_c1 | 3300050492 | Bacteria | 5230 |
| 617 | nmdc:mga0k408_105348_c1 | 3300050493 | Bacteria | 1665 |
| 618 | nmdc:mga06z11_14465_c1 | 3300050494 | Bacteria | 3495 |
| 619 | nmdc:mga06z11_269318_c1 | 3300050494 | Bacteria | 1007 |
| 620 | nmdc:mga06z11_3590_c1 | 3300050494 | Bacteria | 6012 |
| 621 | nmdc:mga06z11_49946_c1 | 3300050494 | Bacteria | 2136 |
| 622 | nmdc:mga06z11_89111_c1 | 3300050494 | Bacteria | 1672 |
| 623 | nmdc:mga04h51_2637_c1 | 3300050495 | Bacteria | 4272 |
| 624 | nmdc:mga04h51_489262_c1 | 3300050495 | Archaea | 524 |
| 625 | nmdc:mga07m45_254637_c1 | 3300050496 | Unclassified | 1021 |
| 626 | nmdc:mga07m45_298086_c1 | 3300050496 | Bacteria | 938 |
| 627 | nmdc:mga05p37_24411_c1 | 3300050507 | Bacteria | 7347 |
| 628 | nmdc:mga05p37_308112_c1 | 3300050507 | Unclassified | 1878 |
| 629 | nmdc:mga05p37_45362_c1 | 3300050507 | Bacteria | 5407 |
| 630 | nmdc:mga05p37_510362_c1 | 3300050507 | Bacteria | 1377 |
| 631 | nmdc:mga05p37_865771_c1 | 3300050507 | Unclassified | 979 |
| 632 | nmdc:mga09592_210496_c1 | 3300050508 | Bacteria | 1684 |
| 633 | nmdc:mga09592_241130_c1 | 3300050508 | Bacteria | 1566 |
| 634 | nmdc:mga09592_388073_c1 | 3300050508 | Unclassified | 1207 |
| 635 | nmdc:mga0qj67_62573_c1 | 3300050509 | Bacteria | 2957 |
| 636 | nmdc:mga06r32_207384_c1 | 3300050510 | Bacteria | 1948 |
| 637 | nmdc:mga06r32_207606_c1 | 3300050510 | Unclassified | 1947 |
| 638 | nmdc:mga06r32_39256_c1 | 3300050510 | Bacteria | 4491 |
| 639 | nmdc:mga08y16_181244_c1 | 3300050511 | Unclassified | 2187 |
| 640 | nmdc:mga08y16_795482_c1 | 3300050511 | Bacteria | 939 |
| 641 | nmdc:mga08y16_886865_c1 | 3300050511 | Bacteria | 879 |
| 642 | nmdc:mga0n895_126600_c1 | 3300050512 | Bacteria | 2578 |
| 643 | nmdc:mga0n895_47877_c1 | 3300050512 | Bacteria | 4182 |
| 644 | nmdc:mga0n895_773897_c1 | 3300050512 | Bacteria | 952 |
| 645 | nmdc:mga0n895_832661_c1 | 3300050512 | Bacteria | 911 |
| 646 | nmdc:mga0rr50_275124_c1 | 3300050513 | Bacteria | 1404 |
| 647 | nmdc:mga0rr50_30637_c1 | 3300050513 | Bacteria | 3811 |
| 648 | nmdc:mga0rr50_323808_c1 | 3300050513 | Unclassified | 1292 |
| 649 | nmdc:mga0rr50_85516_c1 | 3300050513 | Unclassified | 2444 |
| 650 | nmdc:mga08x19_223834_c1 | 3300050514 | Bacteria | 1293 |
| 651 | nmdc:mga0a205_1002437_c1 | 3300050515 | Bacteria | 682 |
| 652 | nmdc:mga0a205_129262_c1 | 3300050515 | Bacteria | 2426 |
| 653 | nmdc:mga0a205_296570_c1 | 3300050515 | Bacteria | 1490 |
| 654 | nmdc:mga0sz30_206786_c1 | 3300050516 | Bacteria | 872 |
| 655 | nmdc:mga0sz30_42439_c1 | 3300050516 | Bacteria | 1914 |
| 656 | Ga0495601_0048960 | 3300053077 | Bacteria | 2663 |
| 657 | Ga0495601_0214700 | 3300053077 | Bacteria | 1256 |
| 658 | Ga0495601_0619359 | 3300053077 | Bacteria | 694 |
| 659 | Ga0495655_0008425 | 3300053083 | Bacteria | 1958 |
| 660 | Ga0495619_0370517 | 3300053085 | Bacteria | 990 |
| 661 | Ga0495619_0409077 | 3300053085 | Unclassified | 936 |
| 662 | Ga0495619_0814507 | 3300053085 | Bacteria | 631 |
| 663 | Ga0500578_0588929 | 3300053086 | Bacteria | 613 |
| 664 | Ga0500562_153995 | 3300053108 | Unclassified | 626 |
| 665 | Ga0500608_303625 | 3300053122 | Bacteria | 591 |
| 666 | Ga0500616_0085862 | 3300053153 | Bacteria | 1571 |
| 667 | Ga0500633_0132167 | 3300053160 | Bacteria | 932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025904 | Ga0207647_10216020 | Ga0207647_102160202 | 123 |
| 2 | 3300048914 | Ga0496111_0076354 | Ga0496111_0076354_34_456 | 133 |
| 3 | 3300048917 | Ga0496114_1338404 | Ga0496114_1338404_164_586 | 133 |
| 4 | 3300049741 | Ga0501079_0176397 | Ga0501079_0176397_525_989 | 133 |
| 5 | 3300005455 | Ga0070663_100871939 | Ga0070663_1008719391 | 134 |
| 6 | 3300005539 | Ga0068853_100538223 | Ga0068853_1005382232 | 134 |
| 7 | 3300005548 | Ga0070665_100524982 | Ga0070665_1005249822 | 134 |
| 8 | 3300005614 | Ga0068856_101320219 | Ga0068856_1013202191 | 134 |
| 9 | 3300006042 | Ga0075368_10080152 | Ga0075368_100801522 | 134 |
| 10 | 3300006051 | Ga0075364_10025002 | Ga0075364_100250023 | 134 |
| 11 | 3300006178 | Ga0075367_10066299 | Ga0075367_100662992 | 134 |
| 12 | 3300006186 | Ga0075369_10182922 | Ga0075369_101829221 | 134 |
| 13 | 3300009551 | Ga0105238_10115144 | Ga0105238_101151442 | 134 |
| 14 | 3300013104 | Ga0157370_10323436 | Ga0157370_103234362 | 134 |
| 15 | 3300013105 | Ga0157369_10067717 | Ga0157369_100677172 | 134 |
| 16 | 3300025913 | Ga0207695_11238063 | Ga0207695_112380631 | 134 |
| 17 | 3300026067 | Ga0207678_10802073 | Ga0207678_108020731 | 134 |
| 18 | 3300050491 | nmdc:mga00v17_25999_c1 | nmdc:mga00v17_25999_c1_2372_2851 | 134 |
| 19 | 3300050492 | nmdc:mga0yw44_68052_c1 | nmdc:mga0yw44_68052_c1_1398_1877 | 134 |
| 20 | 3300050516 | nmdc:mga0sz30_206786_c1 | nmdc:mga0sz30_206786_c1_225_704 | 134 |
| 21 | 3300005335 | Ga0070666_10801000 | Ga0070666_108010001 | 135 |
| 22 | 3300005343 | Ga0070687_100339286 | Ga0070687_1003392861 | 135 |
| 23 | 3300005344 | Ga0070661_100954600 | Ga0070661_1009546001 | 135 |
| 24 | 3300017792 | Ga0163161_10548376 | Ga0163161_105483762 | 135 |
| 25 | 3300003214 | JGI25165J46597_1000028 | JGI25165J46597_1000028278 | 136 |
| 26 | 3300025261 | Ga0209233_1000087 | Ga0209233_1000087280 | 136 |
| 27 | 3300009093 | Ga0105240_10497632 | Ga0105240_104976322 | 137 |
| 28 | 3300014968 | Ga0157379_11441810 | Ga0157379_114418102 | 137 |
| 29 | 3300014969 | Ga0157376_10263600 | Ga0157376_102636002 | 137 |
| 30 | 3300025920 | Ga0207649_10563100 | Ga0207649_105631001 | 137 |
| 31 | 3300039438 | Ga0436360_1293235 | Ga0436360_1293235_63_506 | 137 |
| 32 | 3300048911 | Ga0496108_0781961 | Ga0496108_0781961_212_658 | 137 |
| 33 | 3300048913 | Ga0496110_0439868 | Ga0496110_0439868_195_641 | 137 |
| 34 | 3300048915 | Ga0496112_0419389 | Ga0496112_0419389_352_798 | 137 |
| 35 | 3300009177 | Ga0105248_10012485 | Ga0105248_100124854 | 138 |
| 36 | 3300013296 | Ga0157374_11503611 | Ga0157374_115036112 | 138 |
| 37 | 3300025981 | Ga0207640_11015359 | Ga0207640_110153592 | 138 |
| 38 | 3300050512 | nmdc:mga0n895_126600_c1 | nmdc:mga0n895_126600_c1_1579_2016 | 138 |
| 39 | 3300050515 | nmdc:mga0a205_296570_c1 | nmdc:mga0a205_296570_c1_297_734 | 138 |
| 40 | iso_pu_bacteria | 2857349434 | 2857355041 | 138 |
| 41 | iso_pu_bacteria | 2977942078 | 2977943896 | 138 |
| 42 | iso_pu_bacteria | 2987636660 | 2987643642 | 138 |
| 43 | iso_pu_bacteria | 3004203850 | 3004207187 | 138 |
| 44 | 3300005353 | Ga0070669_100832218 | Ga0070669_1008322181 | 139 |
| 45 | 3300005456 | Ga0070678_100285451 | Ga0070678_1002854512 | 139 |
| 46 | 3300005844 | Ga0068862_100856637 | Ga0068862_1008566372 | 139 |
| 47 | 3300005937 | Ga0081455_10321140 | Ga0081455_103211401 | 139 |
| 48 | 3300025315 | Ga0207697_10042033 | Ga0207697_100420332 | 139 |
| 49 | 3300025961 | Ga0207712_10435152 | Ga0207712_104351522 | 139 |
| 50 | 3300028380 | Ga0268265_10875467 | Ga0268265_108754672 | 139 |
| 51 | 3300003763 | Ga0055529_1003320 | Ga0055529_10033202 | 140 |
| 52 | 3300006048 | Ga0075363_100022852 | Ga0075363_1000228522 | 140 |
| 53 | 3300006880 | Ga0075429_100425590 | Ga0075429_1004255902 | 140 |
| 54 | 3300025254 | Ga0209148_1000037 | Ga0209148_1000037334 | 140 |
| 55 | 3300025272 | Ga0209455_1000036 | Ga0209455_1000036311 | 140 |
| 56 | 3300039450 | Ga0436363_0090918 | Ga0436363_0090918_582_1061 | 140 |
| 57 | 3300050508 | nmdc:mga09592_388073_c1 | nmdc:mga09592_388073_c1_649_1092 | 140 |
| 58 | 3300005983 | Ga0081540_1000245 | Ga0081540_100024554 | 141 |
| 59 | 3300026078 | Ga0207702_12194360 | Ga0207702_121943601 | 141 |
| 60 | 3300053108 | Ga0500562_153995 | Ga0500562_153995_125_595 | 141 |
| 61 | 3300053160 | Ga0500633_0132167 | Ga0500633_0132167_41_511 | 141 |
| 62 | 3300003911 | JGI25405J52794_10028447 | JGI25405J52794_100284472 | 142 |
| 63 | 3300005330 | Ga0070690_100084460 | Ga0070690_1000844601 | 142 |
| 64 | 3300005335 | Ga0070666_10082669 | Ga0070666_100826693 | 142 |
| 65 | 3300005338 | Ga0068868_100069045 | Ga0068868_1000690453 | 142 |
| 66 | 3300005345 | Ga0070692_10411575 | Ga0070692_104115752 | 142 |
| 67 | 3300005355 | Ga0070671_100110782 | Ga0070671_1001107823 | 142 |
| 68 | 3300005355 | Ga0070671_100187996 | Ga0070671_1001879962 | 142 |
| 69 | 3300005365 | Ga0070688_100537198 | Ga0070688_1005371982 | 142 |
| 70 | 3300005435 | Ga0070714_100009251 | Ga0070714_1000092513 | 142 |
| 71 | 3300005439 | Ga0070711_100007938 | Ga0070711_1000079381 | 142 |
| 72 | 3300005544 | Ga0070686_100137067 | Ga0070686_1001370672 | 142 |
| 73 | 3300005546 | Ga0070696_100695127 | Ga0070696_1006951272 | 142 |
| 74 | 3300005549 | Ga0070704_100123430 | Ga0070704_1001234302 | 142 |
| 75 | 3300005615 | Ga0070702_100202425 | Ga0070702_1002024252 | 142 |
| 76 | 3300005617 | Ga0068859_100120528 | Ga0068859_1001205283 | 142 |
| 77 | 3300005937 | Ga0081455_10003886 | Ga0081455_1000388614 | 142 |
| 78 | 3300005983 | Ga0081540_1004291 | Ga0081540_10042914 | 142 |
| 79 | 3300006028 | Ga0070717_10011616 | Ga0070717_100116167 | 142 |
| 80 | 3300006163 | Ga0070715_10461583 | Ga0070715_104615831 | 142 |
| 81 | 3300006173 | Ga0070716_100007056 | Ga0070716_1000070565 | 142 |
| 82 | 3300006844 | Ga0075428_100062375 | Ga0075428_1000623754 | 142 |
| 83 | 3300006871 | Ga0075434_100016976 | Ga0075434_1000169765 | 142 |
| 84 | 3300006871 | Ga0075434_100956548 | Ga0075434_1009565482 | 142 |
| 85 | 3300006931 | Ga0097620_100120529 | Ga0097620_1001205293 | 142 |
| 86 | 3300007076 | Ga0075435_100065738 | Ga0075435_1000657383 | 142 |
| 87 | 3300007076 | Ga0075435_100267747 | Ga0075435_1002677472 | 142 |
| 88 | 3300009098 | Ga0105245_10000301 | Ga0105245_1000030111 | 142 |
| 89 | 3300009101 | Ga0105247_11527821 | Ga0105247_115278212 | 142 |
| 90 | 3300009147 | Ga0114129_10038749 | Ga0114129_100387492 | 142 |
| 91 | 3300009147 | Ga0114129_10261955 | Ga0114129_102619553 | 142 |
| 92 | 3300009176 | Ga0105242_10050357 | Ga0105242_100503573 | 142 |
| 93 | 3300009176 | Ga0105242_11104558 | Ga0105242_111045582 | 142 |
| 94 | 3300009551 | Ga0105238_10158173 | Ga0105238_101581733 | 142 |
| 95 | 3300014326 | Ga0157380_10279823 | Ga0157380_102798232 | 142 |
| 96 | 3300025898 | Ga0207692_10048516 | Ga0207692_100485162 | 142 |
| 97 | 3300025905 | Ga0207685_10011886 | Ga0207685_100118862 | 142 |
| 98 | 3300025906 | Ga0207699_10011887 | Ga0207699_100118873 | 142 |
| 99 | 3300025915 | Ga0207693_10006232 | Ga0207693_100062327 | 142 |
| 100 | 3300025916 | Ga0207663_10012786 | Ga0207663_100127862 | 142 |
| 101 | 3300025924 | Ga0207694_10212409 | Ga0207694_102124092 | 142 |
| 102 | 3300025927 | Ga0207687_10002101 | Ga0207687_100021014 | 142 |
| 103 | 3300025928 | Ga0207700_10000458 | Ga0207700_100004585 | 142 |
| 104 | 3300025928 | Ga0207700_10200849 | Ga0207700_102008493 | 142 |
| 105 | 3300025929 | Ga0207664_10031202 | Ga0207664_100312025 | 142 |
| 106 | 3300025931 | Ga0207644_10159770 | Ga0207644_101597702 | 142 |
| 107 | 3300025931 | Ga0207644_10246499 | Ga0207644_102464992 | 142 |
| 108 | 3300025934 | Ga0207686_10114180 | Ga0207686_101141802 | 142 |
| 109 | 3300025939 | Ga0207665_10006165 | Ga0207665_100061656 | 142 |
| 110 | 3300025939 | Ga0207665_10636485 | Ga0207665_106364852 | 142 |
| 111 | 3300025941 | Ga0207711_10168732 | Ga0207711_101687323 | 142 |
| 112 | 3300025945 | Ga0207679_10409974 | Ga0207679_104099742 | 142 |
| 113 | 3300026023 | Ga0207677_10028823 | Ga0207677_100288234 | 142 |
| 114 | 3300026041 | Ga0207639_10635195 | Ga0207639_106351951 | 142 |
| 115 | 3300026088 | Ga0207641_11246540 | Ga0207641_112465402 | 142 |
| 116 | 3300037418 | Ga0395900_1261997 | Ga0395900_1261997_107_556 | 142 |
| 117 | 3300037471 | Ga0395905_0118821 | Ga0395905_0118821_434_883 | 142 |
| 118 | 3300038443 | Ga0395901_0568228 | Ga0395901_0568228_535_984 | 142 |
| 119 | 3300039450 | Ga0436363_0085767 | Ga0436363_0085767_479_940 | 142 |
| 120 | 3300046810 | Ga0495660_0276742 | Ga0495660_0276742_230_712 | 142 |
| 121 | 3300048903 | Ga0496100_0004121 | Ga0496100_0004121_2026_2475 | 142 |
| 122 | 3300048904 | Ga0496101_0002301 | Ga0496101_0002301_5728_6177 | 142 |
| 123 | 3300048904 | Ga0496101_0163726 | Ga0496101_0163726_981_1442 | 142 |
| 124 | 3300048905 | Ga0496102_0001907 | Ga0496102_0001907_2937_3386 | 142 |
| 125 | 3300048906 | Ga0496103_0224945 | Ga0496103_0224945_354_815 | 142 |
| 126 | 3300048907 | Ga0496104_0003321 | Ga0496104_0003321_8454_8903 | 142 |
| 127 | 3300048907 | Ga0496104_0254604 | Ga0496104_0254604_1058_1507 | 142 |
| 128 | 3300048908 | Ga0496105_0011008 | Ga0496105_0011008_1669_2118 | 142 |
| 129 | 3300048909 | Ga0496106_0001903 | Ga0496106_0001903_12928_13377 | 142 |
| 130 | 3300048909 | Ga0496106_0714330 | Ga0496106_0714330_134_595 | 142 |
| 131 | 3300048910 | Ga0496107_0000742 | Ga0496107_0000742_1917_2366 | 142 |
| 132 | 3300048911 | Ga0496108_0005149 | Ga0496108_0005149_2384_2833 | 142 |
| 133 | 3300048911 | Ga0496108_0012312 | Ga0496108_0012312_5318_5767 | 142 |
| 134 | 3300048912 | Ga0496109_0002185 | Ga0496109_0002185_1278_1727 | 142 |
| 135 | 3300048912 | Ga0496109_0005798 | Ga0496109_0005798_1394_1843 | 142 |
| 136 | 3300048913 | Ga0496110_0001267 | Ga0496110_0001267_2252_2701 | 142 |
| 137 | 3300048913 | Ga0496110_0001439 | Ga0496110_0001439_2480_2929 | 142 |
| 138 | 3300048914 | Ga0496111_0005865 | Ga0496111_0005865_793_1242 | 142 |
| 139 | 3300048914 | Ga0496111_0011164 | Ga0496111_0011164_3623_4072 | 142 |
| 140 | 3300048915 | Ga0496112_0002066 | Ga0496112_0002066_8568_9017 | 142 |
| 141 | 3300048916 | Ga0496113_0165545 | Ga0496113_0165545_121_570 | 142 |
| 142 | 3300048916 | Ga0496113_0190595 | Ga0496113_0190595_347_796 | 142 |
| 143 | 3300048917 | Ga0496114_1525596 | Ga0496114_1525596_36_485 | 142 |
| 144 | 3300048918 | Ga0496115_0015774 | Ga0496115_0015774_2530_2979 | 142 |
| 145 | 3300049583 | Ga0501067_0058873 | Ga0501067_0058873_989_1438 | 142 |
| 146 | 3300049585 | Ga0501069_0165456 | Ga0501069_0165456_541_990 | 142 |
| 147 | 3300050490 | nmdc:mga03n38_292890_c1 | nmdc:mga03n38_292890_c1_360_824 | 142 |
| 148 | 3300050507 | nmdc:mga05p37_24411_c1 | nmdc:mga05p37_24411_c1_5585_6034 | 142 |
| 149 | 3300050507 | nmdc:mga05p37_308112_c1 | nmdc:mga05p37_308112_c1_939_1400 | 142 |
| 150 | 3300050510 | nmdc:mga06r32_39256_c1 | nmdc:mga06r32_39256_c1_222_671 | 142 |
| 151 | 3300050512 | nmdc:mga0n895_773897_c1 | nmdc:mga0n895_773897_c1_220_681 | 142 |
| 152 | 3300050513 | nmdc:mga0rr50_275124_c1 | nmdc:mga0rr50_275124_c1_178_639 | 142 |
| 153 | 3300050513 | nmdc:mga0rr50_85516_c1 | nmdc:mga0rr50_85516_c1_1912_2373 | 142 |
| 154 | 3300050514 | nmdc:mga08x19_223834_c1 | nmdc:mga08x19_223834_c1_748_1209 | 142 |
| 155 | 3300050515 | nmdc:mga0a205_1002437_c1 | nmdc:mga0a205_1002437_c1_164_625 | 142 |
| 156 | 3300003911 | JGI25405J52794_10010926 | JGI25405J52794_100109262 | 143 |
| 157 | 3300005356 | Ga0070674_101220057 | Ga0070674_1012200571 | 143 |
| 158 | 3300005937 | Ga0081455_10018742 | Ga0081455_100187425 | 143 |
| 159 | 3300005937 | Ga0081455_10183573 | Ga0081455_101835732 | 143 |
| 160 | 3300005937 | Ga0081455_10272105 | Ga0081455_102721052 | 143 |
| 161 | 3300005983 | Ga0081540_1042912 | Ga0081540_10429122 | 143 |
| 162 | 3300005985 | Ga0081539_10049156 | Ga0081539_100491565 | 143 |
| 163 | 3300006038 | Ga0075365_10737306 | Ga0075365_107373061 | 143 |
| 164 | 3300006051 | Ga0075364_10241864 | Ga0075364_102418642 | 143 |
| 165 | 3300006163 | Ga0070715_10172234 | Ga0070715_101722342 | 143 |
| 166 | 3300006173 | Ga0070716_100146413 | Ga0070716_1001464131 | 143 |
| 167 | 3300006173 | Ga0070716_100367275 | Ga0070716_1003672752 | 143 |
| 168 | 3300006175 | Ga0070712_100967831 | Ga0070712_1009678311 | 143 |
| 169 | 3300006186 | Ga0075369_10396823 | Ga0075369_103968232 | 143 |
| 170 | 3300006844 | Ga0075428_100174653 | Ga0075428_1001746533 | 143 |
| 171 | 3300006846 | Ga0075430_100045229 | Ga0075430_1000452294 | 143 |
| 172 | 3300006847 | Ga0075431_100054699 | Ga0075431_1000546995 | 143 |
| 173 | 3300006880 | Ga0075429_100799895 | Ga0075429_1007998952 | 143 |
| 174 | 3300009094 | Ga0111539_10838454 | Ga0111539_108384542 | 143 |
| 175 | 3300009147 | Ga0114129_10530565 | Ga0114129_105305652 | 143 |
| 176 | 3300009553 | Ga0105249_10780461 | Ga0105249_107804612 | 143 |
| 177 | 3300025906 | Ga0207699_10234770 | Ga0207699_102347702 | 143 |
| 178 | 3300025915 | Ga0207693_10238127 | Ga0207693_102381272 | 143 |
| 179 | 3300025939 | Ga0207665_10337792 | Ga0207665_103377923 | 143 |
| 180 | 3300025972 | Ga0207668_11275738 | Ga0207668_112757382 | 143 |
| 181 | 3300039437 | Ga0436365_1098622 | Ga0436365_1098622_557_1000 | 143 |
| 182 | 3300046459 | Ga0495629_0075660 | Ga0495629_0075660_1042_1506 | 143 |
| 183 | 3300046476 | Ga0495662_0102954 | Ga0495662_0102954_825_1283 | 143 |
| 184 | 3300046500 | Ga0495596_0229315 | Ga0495596_0229315_89_535 | 143 |
| 185 | 3300046531 | Ga0495665_0071093 | Ga0495665_0071093_1206_1670 | 143 |
| 186 | 3300046533 | Ga0495640_0014540 | Ga0495640_0014540_2514_2972 | 143 |
| 187 | 3300047315 | Ga0495581_0124534 | Ga0495581_0124534_119_577 | 143 |
| 188 | 3300047319 | Ga0495674_0403046 | Ga0495674_0403046_301_765 | 143 |
| 189 | 3300048920 | Ga0496117_0140566 | Ga0496117_0140566_12_461 | 143 |
| 190 | 3300049590 | Ga0501074_1253733 | Ga0501074_1253733_50_502 | 143 |
| 191 | 3300049743 | Ga0501081_0552876 | Ga0501081_0552876_77_559 | 143 |
| 192 | 3300050489 | nmdc:mga03683_133716_c1 | nmdc:mga03683_133716_c1_574_1056 | 143 |
| 193 | 3300050491 | nmdc:mga00v17_196555_c1 | nmdc:mga00v17_196555_c1_323_805 | 143 |
| 194 | 3300050492 | nmdc:mga0yw44_553900_c1 | nmdc:mga0yw44_553900_c1_216_698 | 143 |
| 195 | 3300050492 | nmdc:mga0yw44_697023_c1 | nmdc:mga0yw44_697023_c1_67_549 | 143 |
| 196 | 3300050508 | nmdc:mga09592_210496_c1 | nmdc:mga09592_210496_c1_1080_1562 | 143 |
| 197 | 3300050509 | nmdc:mga0qj67_62573_c1 | nmdc:mga0qj67_62573_c1_1141_1623 | 143 |
| 198 | 3300050510 | nmdc:mga06r32_207606_c1 | nmdc:mga06r32_207606_c1_262_744 | 143 |
| 199 | 3300050511 | nmdc:mga08y16_795482_c1 | nmdc:mga08y16_795482_c1_53_535 | 143 |
| 200 | 3300053077 | Ga0495601_0214700 | Ga0495601_0214700_661_1119 | 143 |
| 201 | 3300001991 | JGI24743J22301_10003589 | JGI24743J22301_100035892 | 144 |
| 202 | 3300002070 | JGI24750J21931_1004772 | JGI24750J21931_10047722 | 144 |
| 203 | 3300002073 | JGI24745J21846_1017131 | JGI24745J21846_10171312 | 144 |
| 204 | 3300002244 | JGI24742J22300_10003072 | JGI24742J22300_100030724 | 144 |
| 205 | 3300005328 | Ga0070676_10018217 | Ga0070676_100182174 | 144 |
| 206 | 3300005329 | Ga0070683_100196963 | Ga0070683_1001969631 | 144 |
| 207 | 3300005329 | Ga0070683_100208787 | Ga0070683_1002087872 | 144 |
| 208 | 3300005330 | Ga0070690_100013918 | Ga0070690_1000139184 | 144 |
| 209 | 3300005331 | Ga0070670_100001910 | Ga0070670_1000019107 | 144 |
| 210 | 3300005331 | Ga0070670_100256415 | Ga0070670_1002564152 | 144 |
| 211 | 3300005333 | Ga0070677_10590609 | Ga0070677_105906091 | 144 |
| 212 | 3300005334 | Ga0068869_100175136 | Ga0068869_1001751362 | 144 |
| 213 | 3300005335 | Ga0070666_10049186 | Ga0070666_100491863 | 144 |
| 214 | 3300005338 | Ga0068868_100014860 | Ga0068868_1000148604 | 144 |
| 215 | 3300005340 | Ga0070689_100027535 | Ga0070689_1000275354 | 144 |
| 216 | 3300005343 | Ga0070687_100047358 | Ga0070687_1000473583 | 144 |
| 217 | 3300005344 | Ga0070661_100122348 | Ga0070661_1001223483 | 144 |
| 218 | 3300005353 | Ga0070669_100174579 | Ga0070669_1001745793 | 144 |
| 219 | 3300005354 | Ga0070675_100102198 | Ga0070675_1001021983 | 144 |
| 220 | 3300005355 | Ga0070671_100270746 | Ga0070671_1002707463 | 144 |
| 221 | 3300005364 | Ga0070673_100142725 | Ga0070673_1001427252 | 144 |
| 222 | 3300005364 | Ga0070673_100313996 | Ga0070673_1003139962 | 144 |
| 223 | 3300005366 | Ga0070659_100067305 | Ga0070659_1000673053 | 144 |
| 224 | 3300005367 | Ga0070667_100013697 | Ga0070667_1000136973 | 144 |
| 225 | 3300005436 | Ga0070713_100116409 | Ga0070713_1001164092 | 144 |
| 226 | 3300005436 | Ga0070713_100804633 | Ga0070713_1008046332 | 144 |
| 227 | 3300005437 | Ga0070710_10255568 | Ga0070710_102555681 | 144 |
| 228 | 3300005437 | Ga0070710_11078029 | Ga0070710_110780291 | 144 |
| 229 | 3300005438 | Ga0070701_10040627 | Ga0070701_100406272 | 144 |
| 230 | 3300005440 | Ga0070705_100181035 | Ga0070705_1001810352 | 144 |
| 231 | 3300005441 | Ga0070700_100007273 | Ga0070700_1000072734 | 144 |
| 232 | 3300005455 | Ga0070663_100013463 | Ga0070663_1000134633 | 144 |
| 233 | 3300005455 | Ga0070663_100147032 | Ga0070663_1001470322 | 144 |
| 234 | 3300005457 | Ga0070662_100007330 | Ga0070662_1000073304 | 144 |
| 235 | 3300005459 | Ga0068867_100043619 | Ga0068867_1000436193 | 144 |
| 236 | 3300005466 | Ga0070685_10495005 | Ga0070685_104950052 | 144 |
| 237 | 3300005467 | Ga0070706_100683017 | Ga0070706_1006830172 | 144 |
| 238 | 3300005518 | Ga0070699_100044916 | Ga0070699_1000449163 | 144 |
| 239 | 3300005518 | Ga0070699_100086784 | Ga0070699_1000867843 | 144 |
| 240 | 3300005535 | Ga0070684_100024113 | Ga0070684_1000241132 | 144 |
| 241 | 3300005535 | Ga0070684_100294234 | Ga0070684_1002942341 | 144 |
| 242 | 3300005539 | Ga0068853_100279975 | Ga0068853_1002799751 | 144 |
| 243 | 3300005543 | Ga0070672_100019109 | Ga0070672_1000191094 | 144 |
| 244 | 3300005543 | Ga0070672_100852828 | Ga0070672_1008528282 | 144 |
| 245 | 3300005544 | Ga0070686_100008180 | Ga0070686_1000081802 | 144 |
| 246 | 3300005545 | Ga0070695_100123321 | Ga0070695_1001233211 | 144 |
| 247 | 3300005548 | Ga0070665_100066968 | Ga0070665_1000669684 | 144 |
| 248 | 3300005548 | Ga0070665_101508848 | Ga0070665_1015088481 | 144 |
| 249 | 3300005564 | Ga0070664_100248604 | Ga0070664_1002486042 | 144 |
| 250 | 3300005564 | Ga0070664_100654000 | Ga0070664_1006540002 | 144 |
| 251 | 3300005577 | Ga0068857_100811931 | Ga0068857_1008119311 | 144 |
| 252 | 3300005578 | Ga0068854_100034569 | Ga0068854_1000345694 | 144 |
| 253 | 3300005614 | Ga0068856_101104957 | Ga0068856_1011049572 | 144 |
| 254 | 3300005615 | Ga0070702_100020572 | Ga0070702_1000205722 | 144 |
| 255 | 3300005616 | Ga0068852_100065349 | Ga0068852_1000653493 | 144 |
| 256 | 3300005617 | Ga0068859_100147525 | Ga0068859_1001475251 | 144 |
| 257 | 3300005617 | Ga0068859_100442521 | Ga0068859_1004425212 | 144 |
| 258 | 3300005618 | Ga0068864_100126329 | Ga0068864_1001263293 | 144 |
| 259 | 3300005718 | Ga0068866_10010810 | Ga0068866_100108102 | 144 |
| 260 | 3300005719 | Ga0068861_100011281 | Ga0068861_1000112813 | 144 |
| 261 | 3300005840 | Ga0068870_10003512 | Ga0068870_100035127 | 144 |
| 262 | 3300005842 | Ga0068858_100032563 | Ga0068858_1000325634 | 144 |
| 263 | 3300005842 | Ga0068858_100958179 | Ga0068858_1009581792 | 144 |
| 264 | 3300005843 | Ga0068860_100041885 | Ga0068860_1000418854 | 144 |
| 265 | 3300005843 | Ga0068860_101057255 | Ga0068860_1010572552 | 144 |
| 266 | 3300005844 | Ga0068862_100090331 | Ga0068862_1000903311 | 144 |
| 267 | 3300005937 | Ga0081455_10013304 | Ga0081455_100133044 | 144 |
| 268 | 3300006028 | Ga0070717_10164880 | Ga0070717_101648802 | 144 |
| 269 | 3300006028 | Ga0070717_10290752 | Ga0070717_102907522 | 144 |
| 270 | 3300006038 | Ga0075365_10055888 | Ga0075365_100558883 | 144 |
| 271 | 3300006038 | Ga0075365_10125591 | Ga0075365_101255912 | 144 |
| 272 | 3300006038 | Ga0075365_10150464 | Ga0075365_101504642 | 144 |
| 273 | 3300006042 | Ga0075368_10100105 | Ga0075368_101001052 | 144 |
| 274 | 3300006048 | Ga0075363_100273578 | Ga0075363_1002735782 | 144 |
| 275 | 3300006051 | Ga0075364_10163586 | Ga0075364_101635862 | 144 |
| 276 | 3300006051 | Ga0075364_10263272 | Ga0075364_102632722 | 144 |
| 277 | 3300006163 | Ga0070715_10731852 | Ga0070715_107318521 | 144 |
| 278 | 3300006173 | Ga0070716_100125323 | Ga0070716_1001253232 | 144 |
| 279 | 3300006175 | Ga0070712_100352172 | Ga0070712_1003521722 | 144 |
| 280 | 3300006177 | Ga0075362_10020464 | Ga0075362_100204642 | 144 |
| 281 | 3300006178 | Ga0075367_10330271 | Ga0075367_103302711 | 144 |
| 282 | 3300006186 | Ga0075369_10048892 | Ga0075369_100488923 | 144 |
| 283 | 3300006237 | Ga0097621_100016214 | Ga0097621_1000162147 | 144 |
| 284 | 3300006358 | Ga0068871_100043533 | Ga0068871_1000435333 | 144 |
| 285 | 3300006844 | Ga0075428_100065772 | Ga0075428_1000657723 | 144 |
| 286 | 3300006844 | Ga0075428_100144544 | Ga0075428_1001445442 | 144 |
| 287 | 3300006846 | Ga0075430_100032718 | Ga0075430_1000327182 | 144 |
| 288 | 3300006847 | Ga0075431_100023249 | Ga0075431_1000232493 | 144 |
| 289 | 3300006852 | Ga0075433_10206011 | Ga0075433_102060112 | 144 |
| 290 | 3300006871 | Ga0075434_100034613 | Ga0075434_1000346132 | 144 |
| 291 | 3300006871 | Ga0075434_101765230 | Ga0075434_1017652301 | 144 |
| 292 | 3300006880 | Ga0075429_100012864 | Ga0075429_1000128645 | 144 |
| 293 | 3300006880 | Ga0075429_100201436 | Ga0075429_1002014362 | 144 |
| 294 | 3300006931 | Ga0097620_100147534 | Ga0097620_1001475343 | 144 |
| 295 | 3300006931 | Ga0097620_100442478 | Ga0097620_1004424782 | 144 |
| 296 | 3300007265 | Ga0099794_10028683 | Ga0099794_100286832 | 144 |
| 297 | 3300007788 | Ga0099795_10001119 | Ga0099795_100011192 | 144 |
| 298 | 3300009094 | Ga0111539_10101233 | Ga0111539_101012332 | 144 |
| 299 | 3300009094 | Ga0111539_10115691 | Ga0111539_101156913 | 144 |
| 300 | 3300009098 | Ga0105245_10058772 | Ga0105245_100587724 | 144 |
| 301 | 3300009098 | Ga0105245_12264343 | Ga0105245_122643432 | 144 |
| 302 | 3300009101 | Ga0105247_10006172 | Ga0105247_100061726 | 144 |
| 303 | 3300009147 | Ga0114129_10011285 | Ga0114129_100112854 | 144 |
| 304 | 3300009147 | Ga0114129_10039522 | Ga0114129_100395226 | 144 |
| 305 | 3300009148 | Ga0105243_10140290 | Ga0105243_101402902 | 144 |
| 306 | 3300009176 | Ga0105242_10350170 | Ga0105242_103501702 | 144 |
| 307 | 3300009176 | Ga0105242_11904560 | Ga0105242_119045601 | 144 |
| 308 | 3300009177 | Ga0105248_10010977 | Ga0105248_100109772 | 144 |
| 309 | 3300009545 | Ga0105237_10035802 | Ga0105237_100358022 | 144 |
| 310 | 3300009545 | Ga0105237_10243475 | Ga0105237_102434752 | 144 |
| 311 | 3300009551 | Ga0105238_10016854 | Ga0105238_1001685410 | 144 |
| 312 | 3300009553 | Ga0105249_10065054 | Ga0105249_100650544 | 144 |
| 313 | 3300010159 | Ga0099796_10000877 | Ga0099796_100008774 | 144 |
| 314 | 3300010375 | Ga0105239_10106857 | Ga0105239_101068573 | 144 |
| 315 | 3300010375 | Ga0105239_10346130 | Ga0105239_103461302 | 144 |
| 316 | 3300011119 | Ga0105246_10023628 | Ga0105246_100236283 | 144 |
| 317 | 3300011119 | Ga0105246_10077777 | Ga0105246_100777772 | 144 |
| 318 | 3300011119 | Ga0105246_11439627 | Ga0105246_114396271 | 144 |
| 319 | 3300012477 | Ga0157336_1010167 | Ga0157336_10101672 | 144 |
| 320 | 3300013296 | Ga0157374_10002466 | Ga0157374_100024667 | 144 |
| 321 | 3300013297 | Ga0157378_11005618 | Ga0157378_110056182 | 144 |
| 322 | 3300013307 | Ga0157372_11548250 | Ga0157372_115482501 | 144 |
| 323 | 3300013308 | Ga0157375_10045749 | Ga0157375_100457493 | 144 |
| 324 | 3300013308 | Ga0157375_10797496 | Ga0157375_107974962 | 144 |
| 325 | 3300014325 | Ga0163163_10024687 | Ga0163163_100246873 | 144 |
| 326 | 3300014326 | Ga0157380_10044463 | Ga0157380_100444634 | 144 |
| 327 | 3300014745 | Ga0157377_10012638 | Ga0157377_100126382 | 144 |
| 328 | 3300014968 | Ga0157379_10039921 | Ga0157379_100399213 | 144 |
| 329 | 3300017792 | Ga0163161_10039612 | Ga0163161_100396122 | 144 |
| 330 | 3300021361 | Ga0213872_10089660 | Ga0213872_100896602 | 144 |
| 331 | 3300025315 | Ga0207697_10194933 | Ga0207697_101949332 | 144 |
| 332 | 3300025898 | Ga0207692_10040961 | Ga0207692_100409612 | 144 |
| 333 | 3300025898 | Ga0207692_10330109 | Ga0207692_103301091 | 144 |
| 334 | 3300025900 | Ga0207710_10015598 | Ga0207710_100155983 | 144 |
| 335 | 3300025901 | Ga0207688_10000117 | Ga0207688_1000011729 | 144 |
| 336 | 3300025903 | Ga0207680_10050728 | Ga0207680_100507282 | 144 |
| 337 | 3300025904 | Ga0207647_10024618 | Ga0207647_100246182 | 144 |
| 338 | 3300025907 | Ga0207645_10018258 | Ga0207645_100182584 | 144 |
| 339 | 3300025908 | Ga0207643_10000291 | Ga0207643_1000029127 | 144 |
| 340 | 3300025910 | Ga0207684_10060885 | Ga0207684_100608852 | 144 |
| 341 | 3300025914 | Ga0207671_10060060 | Ga0207671_100600603 | 144 |
| 342 | 3300025914 | Ga0207671_10177522 | Ga0207671_101775221 | 144 |
| 343 | 3300025915 | Ga0207693_10044042 | Ga0207693_100440423 | 144 |
| 344 | 3300025916 | Ga0207663_10612737 | Ga0207663_106127371 | 144 |
| 345 | 3300025918 | Ga0207662_10004840 | Ga0207662_100048402 | 144 |
| 346 | 3300025919 | Ga0207657_10054531 | Ga0207657_100545312 | 144 |
| 347 | 3300025920 | Ga0207649_10030096 | Ga0207649_100300964 | 144 |
| 348 | 3300025922 | Ga0207646_10427537 | Ga0207646_104275372 | 144 |
| 349 | 3300025923 | Ga0207681_10048673 | Ga0207681_100486732 | 144 |
| 350 | 3300025924 | Ga0207694_10070158 | Ga0207694_100701581 | 144 |
| 351 | 3300025925 | Ga0207650_10007981 | Ga0207650_100079813 | 144 |
| 352 | 3300025925 | Ga0207650_10256966 | Ga0207650_102569662 | 144 |
| 353 | 3300025926 | Ga0207659_10016345 | Ga0207659_100163454 | 144 |
| 354 | 3300025927 | Ga0207687_10183490 | Ga0207687_101834902 | 144 |
| 355 | 3300025928 | Ga0207700_10108611 | Ga0207700_101086112 | 144 |
| 356 | 3300025928 | Ga0207700_10195977 | Ga0207700_101959773 | 144 |
| 357 | 3300025931 | Ga0207644_10180125 | Ga0207644_101801253 | 144 |
| 358 | 3300025931 | Ga0207644_10361623 | Ga0207644_103616231 | 144 |
| 359 | 3300025932 | Ga0207690_10056792 | Ga0207690_100567923 | 144 |
| 360 | 3300025932 | Ga0207690_10059084 | Ga0207690_100590842 | 144 |
| 361 | 3300025933 | Ga0207706_10022984 | Ga0207706_100229844 | 144 |
| 362 | 3300025934 | Ga0207686_10007270 | Ga0207686_100072703 | 144 |
| 363 | 3300025934 | Ga0207686_11475772 | Ga0207686_114757721 | 144 |
| 364 | 3300025935 | Ga0207709_10071644 | Ga0207709_100716442 | 144 |
| 365 | 3300025936 | Ga0207670_10311262 | Ga0207670_103112622 | 144 |
| 366 | 3300025938 | Ga0207704_10278966 | Ga0207704_102789662 | 144 |
| 367 | 3300025939 | Ga0207665_10192106 | Ga0207665_101921062 | 144 |
| 368 | 3300025940 | Ga0207691_10012255 | Ga0207691_100122555 | 144 |
| 369 | 3300025941 | Ga0207711_10055291 | Ga0207711_100552913 | 144 |
| 370 | 3300025942 | Ga0207689_10018113 | Ga0207689_100181132 | 144 |
| 371 | 3300025944 | Ga0207661_10228448 | Ga0207661_102284481 | 144 |
| 372 | 3300025945 | Ga0207679_10065067 | Ga0207679_100650672 | 144 |
| 373 | 3300025949 | Ga0207667_10533632 | Ga0207667_105336322 | 144 |
| 374 | 3300025960 | Ga0207651_10034648 | Ga0207651_100346482 | 144 |
| 375 | 3300025960 | Ga0207651_10261877 | Ga0207651_102618772 | 144 |
| 376 | 3300025961 | Ga0207712_10066107 | Ga0207712_100661071 | 144 |
| 377 | 3300025972 | Ga0207668_10005839 | Ga0207668_100058396 | 144 |
| 378 | 3300025981 | Ga0207640_10013472 | Ga0207640_100134725 | 144 |
| 379 | 3300025986 | Ga0207658_10088942 | Ga0207658_100889422 | 144 |
| 380 | 3300026023 | Ga0207677_10019084 | Ga0207677_100190845 | 144 |
| 381 | 3300026035 | Ga0207703_10050960 | Ga0207703_100509603 | 144 |
| 382 | 3300026035 | Ga0207703_10324521 | Ga0207703_103245212 | 144 |
| 383 | 3300026067 | Ga0207678_10121486 | Ga0207678_101214862 | 144 |
| 384 | 3300026067 | Ga0207678_10167598 | Ga0207678_101675982 | 144 |
| 385 | 3300026075 | Ga0207708_10001828 | Ga0207708_100018289 | 144 |
| 386 | 3300026078 | Ga0207702_10283733 | Ga0207702_102837333 | 144 |
| 387 | 3300026078 | Ga0207702_10510880 | Ga0207702_105108802 | 144 |
| 388 | 3300026088 | Ga0207641_10072273 | Ga0207641_100722732 | 144 |
| 389 | 3300026089 | Ga0207648_10028571 | Ga0207648_100285714 | 144 |
| 390 | 3300026095 | Ga0207676_10036735 | Ga0207676_100367352 | 144 |
| 391 | 3300026116 | Ga0207674_10504821 | Ga0207674_105048212 | 144 |
| 392 | 3300026118 | Ga0207675_100037669 | Ga0207675_1000376693 | 144 |
| 393 | 3300026142 | Ga0207698_10311949 | Ga0207698_103119492 | 144 |
| 394 | 3300027671 | Ga0209588_1064242 | Ga0209588_10642422 | 144 |
| 395 | 3300027907 | Ga0207428_10519932 | Ga0207428_105199322 | 144 |
| 396 | 3300028379 | Ga0268266_10050992 | Ga0268266_100509924 | 144 |
| 397 | 3300028379 | Ga0268266_10271728 | Ga0268266_102717282 | 144 |
| 398 | 3300028380 | Ga0268265_10173676 | Ga0268265_101736762 | 144 |
| 399 | 3300028381 | Ga0268264_10037501 | Ga0268264_100375013 | 144 |
| 400 | 3300035111 | Ga0373923_0316902 | Ga0373923_0316902_59_535 | 144 |
| 401 | 3300035113 | Ga0373936_0052186 | Ga0373936_0052186_71_547 | 144 |
| 402 | 3300035170 | Ga0373943_0398493 | Ga0373943_0398493_237_713 | 144 |
| 403 | 3300035171 | Ga0373946_0019631 | Ga0373946_0019631_443_919 | 144 |
| 404 | 3300035691 | Ga0373931_0147176 | Ga0373931_0147176_193_666 | 144 |
| 405 | 3300035691 | Ga0373931_0148597 | Ga0373931_0148597_605_1051 | 144 |
| 406 | 3300035691 | Ga0373931_0191953 | Ga0373931_0191953_508_1005 | 144 |
| 407 | 3300035691 | Ga0373931_0346757 | Ga0373931_0346757_250_726 | 144 |
| 408 | 3300035692 | Ga0373935_0071894 | Ga0373935_0071894_566_1063 | 144 |
| 409 | 3300035692 | Ga0373935_0264463 | Ga0373935_0264463_316_792 | 144 |
| 410 | 3300035695 | Ga0373927_0024586 | Ga0373927_0024586_120_596 | 144 |
| 411 | 3300035695 | Ga0373927_0211595 | Ga0373927_0211595_189_665 | 144 |
| 412 | 3300035725 | Ga0373947_0005360 | Ga0373947_0005360_4952_5428 | 144 |
| 413 | 3300037068 | Ga0373925_0394981 | Ga0373925_0394981_493_987 | 144 |
| 414 | 3300039447 | Ga0436361_0416025 | Ga0436361_0416025_4861_5316 | 144 |
| 415 | 3300039453 | Ga0436362_0106370 | Ga0436362_0106370_87_533 | 144 |
| 416 | 3300039453 | Ga0436362_0276156 | Ga0436362_0276156_56_511 | 144 |
| 417 | 3300041456 | Ga0451795_0313201 | Ga0451795_0313201_90_566 | 144 |
| 418 | 3300041460 | Ga0451802_1451856 | Ga0451802_1451856_177_653 | 144 |
| 419 | 3300046452 | Ga0495617_099212 | Ga0495617_099212_417_893 | 144 |
| 420 | 3300046455 | Ga0495603_0020414 | Ga0495603_0020414_2466_2942 | 144 |
| 421 | 3300046458 | Ga0495591_066331 | Ga0495591_066331_218_694 | 144 |
| 422 | 3300046474 | Ga0495605_0025009 | Ga0495605_0025009_1809_2285 | 144 |
| 423 | 3300046474 | Ga0495605_0130673 | Ga0495605_0130673_601_1077 | 144 |
| 424 | 3300046491 | Ga0495584_0014161 | Ga0495584_0014161_297_764 | 144 |
| 425 | 3300046491 | Ga0495584_0015339 | Ga0495584_0015339_1112_1588 | 144 |
| 426 | 3300046492 | Ga0495585_0004639 | Ga0495585_0004639_2465_2941 | 144 |
| 427 | 3300046499 | Ga0495594_0083137 | Ga0495594_0083137_1282_1776 | 144 |
| 428 | 3300046500 | Ga0495596_0021949 | Ga0495596_0021949_1576_2052 | 144 |
| 429 | 3300046501 | Ga0495607_0182328 | Ga0495607_0182328_186_662 | 144 |
| 430 | 3300046514 | Ga0495618_0517197 | Ga0495618_0517197_14_505 | 144 |
| 431 | 3300046515 | Ga0495620_0097447 | Ga0495620_0097447_424_912 | 144 |
| 432 | 3300046517 | Ga0495630_0309993 | Ga0495630_0309993_459_935 | 144 |
| 433 | 3300046518 | Ga0495631_0039464 | Ga0495631_0039464_1278_1754 | 144 |
| 434 | 3300046518 | Ga0495631_0201996 | Ga0495631_0201996_232_708 | 144 |
| 435 | 3300046520 | Ga0495637_0057033 | Ga0495637_0057033_541_1017 | 144 |
| 436 | 3300046525 | Ga0495663_0003607 | Ga0495663_0003607_1164_1640 | 144 |
| 437 | 3300046537 | Ga0495598_0022026 | Ga0495598_0022026_457_933 | 144 |
| 438 | 3300046539 | Ga0495621_0032439 | Ga0495621_0032439_144_620 | 144 |
| 439 | 3300046539 | Ga0495621_0372604 | Ga0495621_0372604_50_505 | 144 |
| 440 | 3300046558 | Ga0495633_0114777 | Ga0495633_0114777_490_966 | 144 |
| 441 | 3300046648 | Ga0495611_0158563 | Ga0495611_0158563_387_863 | 144 |
| 442 | 3300046664 | Ga0495659_0181370 | Ga0495659_0181370_154_648 | 144 |
| 443 | 3300046665 | Ga0495661_0493282 | Ga0495661_0493282_74_550 | 144 |
| 444 | 3300046681 | Ga0495647_0016089 | Ga0495647_0016089_603_1079 | 144 |
| 445 | 3300046681 | Ga0495647_0191018 | Ga0495647_0191018_329_826 | 144 |
| 446 | 3300046683 | Ga0495658_0115688 | Ga0495658_0115688_644_1120 | 144 |
| 447 | 3300046689 | Ga0495613_0043735 | Ga0495613_0043735_2624_3100 | 144 |
| 448 | 3300046690 | Ga0495624_0039728 | Ga0495624_0039728_2114_2590 | 144 |
| 449 | 3300046692 | Ga0495671_0074213 | Ga0495671_0074213_342_818 | 144 |
| 450 | 3300046694 | Ga0495649_0019711 | Ga0495649_0019711_1736_2212 | 144 |
| 451 | 3300046794 | Ga0495589_0051663 | Ga0495589_0051663_153_644 | 144 |
| 452 | 3300047315 | Ga0495581_0086007 | Ga0495581_0086007_819_1295 | 144 |
| 453 | 3300047315 | Ga0495581_0098661 | Ga0495581_0098661_189_686 | 144 |
| 454 | 3300047315 | Ga0495581_0498423 | Ga0495581_0498423_30_476 | 144 |
| 455 | 3300047320 | Ga0495672_0038267 | Ga0495672_0038267_1206_1685 | 144 |
| 456 | 3300047321 | Ga0495676_0178746 | Ga0495676_0178746_44_520 | 144 |
| 457 | 3300047321 | Ga0495676_0182041 | Ga0495676_0182041_308_805 | 144 |
| 458 | 3300047321 | Ga0495676_0426215 | Ga0495676_0426215_221_697 | 144 |
| 459 | 3300047323 | Ga0495683_0291312 | Ga0495683_0291312_153_644 | 144 |
| 460 | 3300047673 | Ga0495593_0039641 | Ga0495593_0039641_2029_2526 | 144 |
| 461 | 3300048089 | Ga0495614_0266897 | Ga0495614_0266897_131_625 | 144 |
| 462 | 3300048903 | Ga0496100_0034871 | Ga0496100_0034871_2155_2631 | 144 |
| 463 | 3300048903 | Ga0496100_0138972 | Ga0496100_0138972_579_1076 | 144 |
| 464 | 3300048904 | Ga0496101_0006780 | Ga0496101_0006780_310_786 | 144 |
| 465 | 3300048904 | Ga0496101_0109660 | Ga0496101_0109660_474_971 | 144 |
| 466 | 3300048904 | Ga0496101_0282178 | Ga0496101_0282178_753_1229 | 144 |
| 467 | 3300048904 | Ga0496101_0578467 | Ga0496101_0578467_10_486 | 144 |
| 468 | 3300048905 | Ga0496102_0016244 | Ga0496102_0016244_5589_6086 | 144 |
| 469 | 3300048905 | Ga0496102_0051818 | Ga0496102_0051818_1895_2371 | 144 |
| 470 | 3300048905 | Ga0496102_0236631 | Ga0496102_0236631_243_719 | 144 |
| 471 | 3300048906 | Ga0496103_0005487 | Ga0496103_0005487_4671_5147 | 144 |
| 472 | 3300048906 | Ga0496103_0070261 | Ga0496103_0070261_1082_1579 | 144 |
| 473 | 3300048907 | Ga0496104_0001787 | Ga0496104_0001787_4052_4525 | 144 |
| 474 | 3300048907 | Ga0496104_0019430 | Ga0496104_0019430_3173_3670 | 144 |
| 475 | 3300048907 | Ga0496104_0090210 | Ga0496104_0090210_1368_1844 | 144 |
| 476 | 3300048908 | Ga0496105_0005141 | Ga0496105_0005141_8360_8836 | 144 |
| 477 | 3300048908 | Ga0496105_0013382 | Ga0496105_0013382_529_1026 | 144 |
| 478 | 3300048909 | Ga0496106_0081808 | Ga0496106_0081808_638_1114 | 144 |
| 479 | 3300048909 | Ga0496106_0130364 | Ga0496106_0130364_1075_1572 | 144 |
| 480 | 3300048909 | Ga0496106_0380848 | Ga0496106_0380848_427_951 | 144 |
| 481 | 3300048910 | Ga0496107_0001577 | Ga0496107_0001577_2798_3274 | 144 |
| 482 | 3300048910 | Ga0496107_0135608 | Ga0496107_0135608_907_1404 | 144 |
| 483 | 3300048910 | Ga0496107_0224009 | Ga0496107_0224009_458_931 | 144 |
| 484 | 3300048911 | Ga0496108_0004907 | Ga0496108_0004907_3685_4182 | 144 |
| 485 | 3300048911 | Ga0496108_0023055 | Ga0496108_0023055_3685_4209 | 144 |
| 486 | 3300048911 | Ga0496108_0117243 | Ga0496108_0117243_310_786 | 144 |
| 487 | 3300048911 | Ga0496108_0680538 | Ga0496108_0680538_94_570 | 144 |
| 488 | 3300048912 | Ga0496109_0001273 | Ga0496109_0001273_15036_15533 | 144 |
| 489 | 3300048912 | Ga0496109_0007347 | Ga0496109_0007347_1465_1941 | 144 |
| 490 | 3300048912 | Ga0496109_0589290 | Ga0496109_0589290_290_745 | 144 |
| 491 | 3300048913 | Ga0496110_0008474 | Ga0496110_0008474_1915_2391 | 144 |
| 492 | 3300048913 | Ga0496110_0010029 | Ga0496110_0010029_694_1191 | 144 |
| 493 | 3300048913 | Ga0496110_0154263 | Ga0496110_0154263_911_1399 | 144 |
| 494 | 3300048913 | Ga0496110_0189820 | Ga0496110_0189820_656_1129 | 144 |
| 495 | 3300048914 | Ga0496111_0004907 | Ga0496111_0004907_2386_2883 | 144 |
| 496 | 3300048914 | Ga0496111_0026573 | Ga0496111_0026573_2206_2682 | 144 |
| 497 | 3300048915 | Ga0496112_0021566 | Ga0496112_0021566_2586_3083 | 144 |
| 498 | 3300048915 | Ga0496112_0139833 | Ga0496112_0139833_1041_1529 | 144 |
| 499 | 3300048915 | Ga0496112_0570047 | Ga0496112_0570047_437_913 | 144 |
| 500 | 3300048916 | Ga0496113_0000303 | Ga0496113_0000303_11820_12317 | 144 |
| 501 | 3300048916 | Ga0496113_0032411 | Ga0496113_0032411_2193_2669 | 144 |
| 502 | 3300048916 | Ga0496113_0277496 | Ga0496113_0277496_383_871 | 144 |
| 503 | 3300048916 | Ga0496113_0279872 | Ga0496113_0279872_372_848 | 144 |
| 504 | 3300048916 | Ga0496113_1051702 | Ga0496113_1051702_48_524 | 144 |
| 505 | 3300048917 | Ga0496114_0551285 | Ga0496114_0551285_290_787 | 144 |
| 506 | 3300048918 | Ga0496115_0018692 | Ga0496115_0018692_4670_5146 | 144 |
| 507 | 3300048918 | Ga0496115_0041111 | Ga0496115_0041111_418_915 | 144 |
| 508 | 3300048918 | Ga0496115_0051494 | Ga0496115_0051494_1486_2010 | 144 |
| 509 | 3300050490 | nmdc:mga03n38_61205_c1 | nmdc:mga03n38_61205_c1_503_979 | 144 |
| 510 | 3300050491 | nmdc:mga00v17_229611_c1 | nmdc:mga00v17_229611_c1_370_846 | 144 |
| 511 | 3300050491 | nmdc:mga00v17_260268_c1 | nmdc:mga00v17_260268_c1_596_1093 | 144 |
| 512 | 3300050492 | nmdc:mga0yw44_167927_c1 | nmdc:mga0yw44_167927_c1_305_781 | 144 |
| 513 | 3300050492 | nmdc:mga0yw44_41949_c1 | nmdc:mga0yw44_41949_c1_1196_1672 | 144 |
| 514 | 3300050494 | nmdc:mga06z11_49946_c1 | nmdc:mga06z11_49946_c1_632_1108 | 144 |
| 515 | 3300050496 | nmdc:mga07m45_298086_c1 | nmdc:mga07m45_298086_c1_252_728 | 144 |
| 516 | 3300050507 | nmdc:mga05p37_45362_c1 | nmdc:mga05p37_45362_c1_3756_4253 | 144 |
| 517 | 3300050507 | nmdc:mga05p37_510362_c1 | nmdc:mga05p37_510362_c1_743_1231 | 144 |
| 518 | 3300050507 | nmdc:mga05p37_865771_c1 | nmdc:mga05p37_865771_c1_163_672 | 144 |
| 519 | 3300050508 | nmdc:mga09592_241130_c1 | nmdc:mga09592_241130_c1_428_925 | 144 |
| 520 | 3300050510 | nmdc:mga06r32_207384_c1 | nmdc:mga06r32_207384_c1_1212_1661 | 144 |
| 521 | 3300050511 | nmdc:mga08y16_181244_c1 | nmdc:mga08y16_181244_c1_1580_2077 | 144 |
| 522 | 3300050512 | nmdc:mga0n895_832661_c1 | nmdc:mga0n895_832661_c1_18_539 | 144 |
| 523 | 3300053077 | Ga0495601_0048960 | Ga0495601_0048960_1762_2253 | 144 |
| 524 | 3300053083 | Ga0495655_0008425 | Ga0495655_0008425_612_1088 | 144 |
| 525 | 3300053085 | Ga0495619_0370517 | Ga0495619_0370517_184_675 | 144 |
| 526 | 3300053085 | Ga0495619_0409077 | Ga0495619_0409077_238_735 | 144 |
| 527 | 3300003203 | JGI25406J46586_10004605 | JGI25406J46586_100046053 | 145 |
| 528 | 3300005340 | Ga0070689_100356474 | Ga0070689_1003564742 | 145 |
| 529 | 3300005985 | Ga0081539_10172122 | Ga0081539_101721222 | 145 |
| 530 | 3300009094 | Ga0111539_10242870 | Ga0111539_102428703 | 145 |
| 531 | 3300009176 | Ga0105242_11167055 | Ga0105242_111670552 | 145 |
| 532 | 3300013297 | Ga0157378_10145081 | Ga0157378_101450812 | 145 |
| 533 | 3300014326 | Ga0157380_10922422 | Ga0157380_109224222 | 145 |
| 534 | 3300025936 | Ga0207670_10284947 | Ga0207670_102849472 | 145 |
| 535 | 3300050511 | nmdc:mga08y16_886865_c1 | nmdc:mga08y16_886865_c1_141_602 | 145 |
| 536 | 3300005343 | Ga0070687_100384039 | Ga0070687_1003840392 | 146 |
| 537 | 3300005985 | Ga0081539_10090932 | Ga0081539_100909322 | 146 |
| 538 | 3300006173 | Ga0070716_101265627 | Ga0070716_1012656271 | 146 |
| 539 | 3300006175 | Ga0070712_100001758 | Ga0070712_10000175813 | 146 |
| 540 | 3300013297 | Ga0157378_10849898 | Ga0157378_108498982 | 146 |
| 541 | 3300046460 | Ga0495638_0553777 | Ga0495638_0553777_35_481 | 146 |
| 542 | 3300053086 | Ga0500578_0588929 | Ga0500578_0588929_92_538 | 146 |
| 543 | 3300053122 | Ga0500608_303625 | Ga0500608_303625_76_522 | 146 |
| 544 | 3300005353 | Ga0070669_101518613 | Ga0070669_1015186131 | 147 |
| 545 | 3300006038 | Ga0075365_10119318 | Ga0075365_101193182 | 147 |
| 546 | 3300006048 | Ga0075363_100283071 | Ga0075363_1002830712 | 147 |
| 547 | 3300006051 | Ga0075364_10037264 | Ga0075364_100372642 | 147 |
| 548 | 3300006177 | Ga0075362_10036813 | Ga0075362_100368133 | 147 |
| 549 | 3300006177 | Ga0075362_10057502 | Ga0075362_100575023 | 147 |
| 550 | 3300006178 | Ga0075367_10043014 | Ga0075367_100430144 | 147 |
| 551 | 3300006178 | Ga0075367_10255499 | Ga0075367_102554992 | 147 |
| 552 | 3300006186 | Ga0075369_10021741 | Ga0075369_100217413 | 147 |
| 553 | 3300006195 | Ga0075366_10056361 | Ga0075366_100563613 | 147 |
| 554 | 3300006195 | Ga0075366_10461541 | Ga0075366_104615411 | 147 |
| 555 | 3300006353 | Ga0075370_10061104 | Ga0075370_100611043 | 147 |
| 556 | 3300006353 | Ga0075370_10374286 | Ga0075370_103742862 | 147 |
| 557 | 3300006353 | Ga0075370_10639621 | Ga0075370_106396211 | 147 |
| 558 | 3300009148 | Ga0105243_10220173 | Ga0105243_102201733 | 147 |
| 559 | 3300025927 | Ga0207687_10790182 | Ga0207687_107901822 | 147 |
| 560 | 3300026075 | Ga0207708_11258456 | Ga0207708_112584561 | 147 |
| 561 | 3300028381 | Ga0268264_10219335 | Ga0268264_102193352 | 147 |
| 562 | 3300041411 | Ga0439466_0112665 | Ga0439466_0112665_278_736 | 147 |
| 563 | 3300050489 | nmdc:mga03683_111289_c1 | nmdc:mga03683_111289_c1_472_948 | 147 |
| 564 | 3300050492 | nmdc:mga0yw44_222330_c1 | nmdc:mga0yw44_222330_c1_559_1050 | 147 |
| 565 | 3300050493 | nmdc:mga0k408_105348_c1 | nmdc:mga0k408_105348_c1_820_1311 | 147 |
| 566 | 3300050494 | nmdc:mga06z11_269318_c1 | nmdc:mga06z11_269318_c1_109_630 | 147 |
| 567 | 3300050516 | nmdc:mga0sz30_42439_c1 | nmdc:mga0sz30_42439_c1_322_813 | 147 |
| 568 | 3300053085 | Ga0495619_0814507 | Ga0495619_0814507_129_614 | 147 |
| 569 | 3300005331 | Ga0070670_100360453 | Ga0070670_1003604531 | 148 |
| 570 | 3300005340 | Ga0070689_100083702 | Ga0070689_1000837024 | 148 |
| 571 | 3300005343 | Ga0070687_100218784 | Ga0070687_1002187842 | 148 |
| 572 | 3300005365 | Ga0070688_100166558 | Ga0070688_1001665581 | 148 |
| 573 | 3300005365 | Ga0070688_100732368 | Ga0070688_1007323681 | 148 |
| 574 | 3300005434 | Ga0070709_10104819 | Ga0070709_101048193 | 148 |
| 575 | 3300005545 | Ga0070695_100506148 | Ga0070695_1005061482 | 148 |
| 576 | 3300005549 | Ga0070704_100140835 | Ga0070704_1001408352 | 148 |
| 577 | 3300005617 | Ga0068859_100186031 | Ga0068859_1001860312 | 148 |
| 578 | 3300005618 | Ga0068864_100363116 | Ga0068864_1003631162 | 148 |
| 579 | 3300005719 | Ga0068861_100251487 | Ga0068861_1002514872 | 148 |
| 580 | 3300005841 | Ga0068863_100282731 | Ga0068863_1002827312 | 148 |
| 581 | 3300005842 | Ga0068858_100547276 | Ga0068858_1005472761 | 148 |
| 582 | 3300005983 | Ga0081540_1039856 | Ga0081540_10398562 | 148 |
| 583 | 3300006038 | Ga0075365_10008586 | Ga0075365_100085864 | 148 |
| 584 | 3300006042 | Ga0075368_10059132 | Ga0075368_100591322 | 148 |
| 585 | 3300006048 | Ga0075363_100030948 | Ga0075363_1000309482 | 148 |
| 586 | 3300006051 | Ga0075364_10003031 | Ga0075364_100030312 | 148 |
| 587 | 3300006173 | Ga0070716_100588097 | Ga0070716_1005880972 | 148 |
| 588 | 3300006178 | Ga0075367_10004657 | Ga0075367_100046576 | 148 |
| 589 | 3300006852 | Ga0075433_10018481 | Ga0075433_100184814 | 148 |
| 590 | 3300006871 | Ga0075434_100050371 | Ga0075434_1000503713 | 148 |
| 591 | 3300006914 | Ga0075436_101400004 | Ga0075436_1014000041 | 148 |
| 592 | 3300006931 | Ga0097620_100186017 | Ga0097620_1001860172 | 148 |
| 593 | 3300007076 | Ga0075435_100038695 | Ga0075435_1000386954 | 148 |
| 594 | 3300007076 | Ga0075435_101173153 | Ga0075435_1011731531 | 148 |
| 595 | 3300009098 | Ga0105245_10407347 | Ga0105245_104073472 | 148 |
| 596 | 3300009177 | Ga0105248_10238720 | Ga0105248_102387202 | 148 |
| 597 | 3300010375 | Ga0105239_11071227 | Ga0105239_110712272 | 148 |
| 598 | 3300013306 | Ga0163162_10638510 | Ga0163162_106385102 | 148 |
| 599 | 3300013308 | Ga0157375_10307779 | Ga0157375_103077792 | 148 |
| 600 | 3300014325 | Ga0163163_10031093 | Ga0163163_100310935 | 148 |
| 601 | 3300017792 | Ga0163161_10188804 | Ga0163161_101888042 | 148 |
| 602 | 3300025925 | Ga0207650_10445359 | Ga0207650_104453592 | 148 |
| 603 | 3300025936 | Ga0207670_10195365 | Ga0207670_101953652 | 148 |
| 604 | 3300025939 | Ga0207665_10569866 | Ga0207665_105698661 | 148 |
| 605 | 3300026088 | Ga0207641_10360527 | Ga0207641_103605271 | 148 |
| 606 | 3300026095 | Ga0207676_10557770 | Ga0207676_105577702 | 148 |
| 607 | 3300026118 | Ga0207675_100023684 | Ga0207675_1000236846 | 148 |
| 608 | 3300026118 | Ga0207675_100799042 | Ga0207675_1007990422 | 148 |
| 609 | 3300027866 | Ga0209813_10007840 | Ga0209813_100078404 | 148 |
| 610 | 3300028381 | Ga0268264_10839258 | Ga0268264_108392582 | 148 |
| 611 | 3300035171 | Ga0373946_0325964 | Ga0373946_0325964_268_744 | 148 |
| 612 | 3300046457 | Ga0495590_0126746 | Ga0495590_0126746_279_743 | 148 |
| 613 | 3300046660 | Ga0495625_0185052 | Ga0495625_0185052_115_603 | 148 |
| 614 | 3300048905 | Ga0496102_0494203 | Ga0496102_0494203_563_1039 | 148 |
| 615 | 3300048907 | Ga0496104_0013709 | Ga0496104_0013709_2013_2495 | 148 |
| 616 | 3300048908 | Ga0496105_0320515 | Ga0496105_0320515_145_627 | 148 |
| 617 | 3300048910 | Ga0496107_0548098 | Ga0496107_0548098_35_511 | 148 |
| 618 | 3300048911 | Ga0496108_0293757 | Ga0496108_0293757_917_1399 | 148 |
| 619 | 3300048912 | Ga0496109_0012097 | Ga0496109_0012097_201_683 | 148 |
| 620 | 3300048913 | Ga0496110_0128093 | Ga0496110_0128093_551_1027 | 148 |
| 621 | 3300048914 | Ga0496111_0239192 | Ga0496111_0239192_335_817 | 148 |
| 622 | 3300048915 | Ga0496112_0271257 | Ga0496112_0271257_581_1057 | 148 |
| 623 | 3300048915 | Ga0496112_0536869 | Ga0496112_0536869_353_835 | 148 |
| 624 | 3300048916 | Ga0496113_0171762 | Ga0496113_0171762_739_1221 | 148 |
| 625 | 3300048918 | Ga0496115_0097278 | Ga0496115_0097278_332_814 | 148 |
| 626 | 3300050490 | nmdc:mga03n38_10892_c1 | nmdc:mga03n38_10892_c1_1752_2216 | 148 |
| 627 | 3300050490 | nmdc:mga03n38_16037_c1 | nmdc:mga03n38_16037_c1_2230_2694 | 148 |
| 628 | 3300050491 | nmdc:mga00v17_19320_c1 | nmdc:mga00v17_19320_c1_703_1167 | 148 |
| 629 | 3300050492 | nmdc:mga0yw44_17544_c1 | nmdc:mga0yw44_17544_c1_3037_3501 | 148 |
| 630 | 3300050494 | nmdc:mga06z11_89111_c1 | nmdc:mga06z11_89111_c1_1097_1561 | 148 |
| 631 | 3300050495 | nmdc:mga04h51_2637_c1 | nmdc:mga04h51_2637_c1_755_1219 | 148 |
| 632 | 3300050495 | nmdc:mga04h51_489262_c1 | nmdc:mga04h51_489262_c1_15_479 | 148 |
| 633 | 3300050512 | nmdc:mga0n895_47877_c1 | nmdc:mga0n895_47877_c1_2491_2973 | 148 |
| 634 | 3300050513 | nmdc:mga0rr50_30637_c1 | nmdc:mga0rr50_30637_c1_2102_2584 | 148 |
| 635 | 3300050513 | nmdc:mga0rr50_323808_c1 | nmdc:mga0rr50_323808_c1_380_856 | 148 |
| 636 | 3300050515 | nmdc:mga0a205_129262_c1 | nmdc:mga0a205_129262_c1_209_685 | 148 |
| 637 | 3300053153 | Ga0500616_0085862 | Ga0500616_0085862_687_1151 | 148 |
| 638 | 3300001989 | JGI24739J22299_10198634 | JGI24739J22299_101986341 | 149 |
| 639 | 3300002987 | JGI25159J45721_1024778 | JGI25159J45721_10247782 | 149 |
| 640 | 3300003354 | JGI25160J50197_1033099 | JGI25160J50197_10330992 | 149 |
| 641 | 3300005981 | Ga0081538_10020271 | Ga0081538_100202715 | 149 |
| 642 | 3300005985 | Ga0081539_10033395 | Ga0081539_100333953 | 149 |
| 643 | 3300006038 | Ga0075365_10009939 | Ga0075365_100099395 | 149 |
| 644 | 3300006038 | Ga0075365_10509971 | Ga0075365_105099712 | 149 |
| 645 | 3300006048 | Ga0075363_100007933 | Ga0075363_1000079334 | 149 |
| 646 | 3300006048 | Ga0075363_100049492 | Ga0075363_1000494922 | 149 |
| 647 | 3300006051 | Ga0075364_10007069 | Ga0075364_100070696 | 149 |
| 648 | 3300006177 | Ga0075362_10019895 | Ga0075362_100198953 | 149 |
| 649 | 3300006178 | Ga0075367_10001828 | Ga0075367_1000182810 | 149 |
| 650 | 3300006178 | Ga0075367_10007981 | Ga0075367_100079812 | 149 |
| 651 | 3300006178 | Ga0075367_10260671 | Ga0075367_102606711 | 149 |
| 652 | 3300006852 | Ga0075433_10365089 | Ga0075433_103650892 | 149 |
| 653 | 3300006871 | Ga0075434_100508608 | Ga0075434_1005086082 | 149 |
| 654 | 3300011119 | Ga0105246_10205392 | Ga0105246_102053923 | 149 |
| 655 | 3300014326 | Ga0157380_10428025 | Ga0157380_104280252 | 149 |
| 656 | 3300025284 | Ga0209130_1000909 | Ga0209130_10009099 | 149 |
| 657 | 3300025302 | Ga0207426_1000366 | Ga0207426_100036673 | 149 |
| 658 | 3300035691 | Ga0373931_0954204 | Ga0373931_0954204_59_511 | 149 |
| 659 | 3300042146 | Ga0450907_004366 | Ga0450907_004366_567_1040 | 149 |
| 660 | 3300046473 | Ga0495582_0220822 | Ga0495582_0220822_101_586 | 149 |
| 661 | 3300049576 | Ga0501040_1296955 | Ga0501040_1296955_36_515 | 149 |
| 662 | 3300049744 | Ga0501083_0298895 | Ga0501083_0298895_534_1013 | 149 |
| 663 | 3300050489 | nmdc:mga03683_96704_c1 | nmdc:mga03683_96704_c1_744_1196 | 149 |
| 664 | 3300050490 | nmdc:mga03n38_59336_c1 | nmdc:mga03n38_59336_c1_544_993 | 149 |
| 665 | 3300050491 | nmdc:mga00v17_3784_c1 | nmdc:mga00v17_3784_c1_734_1186 | 149 |
| 666 | 3300050492 | nmdc:mga0yw44_176099_c1 | nmdc:mga0yw44_176099_c1_618_1067 | 149 |
| 667 | 3300050492 | nmdc:mga0yw44_8043_c1 | nmdc:mga0yw44_8043_c1_4040_4492 | 149 |
| 668 | 3300050494 | nmdc:mga06z11_14465_c1 | nmdc:mga06z11_14465_c1_723_1175 | 149 |
| 669 | 3300050494 | nmdc:mga06z11_3590_c1 | nmdc:mga06z11_3590_c1_3856_4308 | 149 |
| 670 | 3300050496 | nmdc:mga07m45_254637_c1 | nmdc:mga07m45_254637_c1_510_962 | 149 |
| 671 | 3300053077 | Ga0495601_0619359 | Ga0495601_0619359_48_539 | 149 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zhe-assembly1.cif.gz_B | structure of the c. elegans smg5-smg7 complex | 0.952 | 64 | 125 |
| 3zhe-assembly2.cif.gz_D | structure of the c. elegans smg5-smg7 complex | 0.9461 | 64 | 125 |
| 3kd7-assembly5.cif.gz_E | designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) | 0.9381 | 35 | 127 |
| 3kd7-assembly2.cif.gz_B | designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) | 0.938 | 35 | 127 |
| 2wqh-assembly1.cif.gz_A-2 | crystal structure of ctpr3y3 | 0.9238 | 35 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IUR5_613_682_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9603 | 64 | 128 | 1.25.40.10 |
| af_Q58350_225_318_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9436 | 35 | 123 | 1.25.40.10 |
| af_A0A1D6J5H1_1_102_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.94 | 39 | 127 | 1.25.40.10 |
| af_Q86TZ1_263_346_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.939 | 47 | 128 | 1.25.40.10 |
| 3kd7E00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9381 | 35 | 127 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523FNY8-F1-model_v4 | Tetratricopeptide repeat protein | 0.9799 | 35 | 148 |
GO:0045892
|
| AF-A0A7X3MUP6-F1-model_v4 | Tetratricopeptide repeat protein | 0.9737 | 34 | 149 |
GO:0009279
GO:0046813 |
| AF-A0A6I6L1Y8-F1-model_v4 | Tetratricopeptide repeat protein | 0.9726 | 35 | 148 |
|
| AF-A0A239Q0T0-F1-model_v4 | Tetratricopeptide repeat-containing protein | 0.971 | 35 | 148 |
|
| AF-A0A6I4LSV8-F1-model_v4 | Tetratricopeptide repeat protein | 0.9707 | 35 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar