F474146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 300 | 1342 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300006048|Ga0075363_100009589|Ga0075363_1000095893 |
| Length | 264 |
| Sequence | MIFKRAVQRYGRTPQPETPYQRAGQLWDERIGSARVQARNWRLMAFGTLTLTCAMSGALIWQSLQSRVTPYEVDRLGEARAVTEAEAGYKPTDPQVAWHLAKFIENVRGISLDPVLMRRDWLSAYGFVTDRGARFLDDYARAADPFAGIGERTVSVQVTSVVRASDRSFQVKWTETAYERGSEAGSSHWTGILTIVTKPPVSADTLRKNPLGIYVDAIDWSRELEAPATTAVPRTPSPPSNLPLGSPLDPNLAAHPPVKTETQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 94 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 171 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 172 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 173 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 174 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 175 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 176 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 208 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 217 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 225 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 229 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 230 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 231 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 232 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 237 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 240 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 242 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 243 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 244 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 245 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 246 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 247 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 248 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 249 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 250 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 251 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 253 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 254 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 255 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 256 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 257 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 259 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 260 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 261 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 263 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 264 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 265 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 266 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 267 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 268 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 269 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 270 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 271 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 272 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 273 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 274 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 275 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 276 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 277 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 278 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 279 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 280 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 281 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 282 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 283 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 284 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 285 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 286 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 287 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 288 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 289 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 290 | 2906610324 | |||
| 291 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 292 | 2922425934 | |||
| 293 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 294 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 295 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 296 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 297 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 298 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 299 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 300 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.57 |
| Metatranscriptomes | 0 |
| Isolates | 6.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.61 |
| Nodule | 2.38 |
| Rhizoplane | 2.24 |
| Rhizosphere | 70.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075363_100009589 | 3300006048 | Bacteria | 4557 |
| 2 | SwRhRL2b_contig_195601 | 2162886007 | Bacteria | 6790 |
| 3 | JGI24740J21852_10000086 | 3300001979 | Bacteria | 32047 |
| 4 | JGI24740J21852_10006157 | 3300001979 | Bacteria | 5004 |
| 5 | JGI24740J21852_10011901 | 3300001979 | Bacteria | 3298 |
| 6 | JGI24740J21852_10020475 | 3300001979 | Bacteria | 2306 |
| 7 | JGI24739J22299_10000303 | 3300001989 | Bacteria | 16724 |
| 8 | JGI24737J22298_10000127 | 3300001990 | Bacteria | 23226 |
| 9 | JGI24737J22298_10000793 | 3300001990 | Bacteria | 11195 |
| 10 | JGI24737J22298_10009384 | 3300001990 | Bacteria | 3258 |
| 11 | JGI24735J21928_10000302 | 3300002067 | Bacteria | 17212 |
| 12 | JGI24735J21928_10007017 | 3300002067 | Bacteria | 3682 |
| 13 | JGI24735J21928_10009083 | 3300002067 | Bacteria | 3199 |
| 14 | JGI24735J21928_10014034 | 3300002067 | Bacteria | 2512 |
| 15 | JGI24738J21930_10000028 | 3300002075 | Bacteria | 27115 |
| 16 | JGI24738J21930_10000183 | 3300002075 | Bacteria | 16183 |
| 17 | JGI24751J29686_10000331 | 3300002459 | Bacteria | 17241 |
| 18 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 19 | JGI25165J46597_1000109 | 3300003214 | Bacteria | 149484 |
| 20 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 21 | rootH1_10054095 | 3300003316 | Bacteria | 5285 |
| 22 | rootH1_10117209 | 3300003316 | Bacteria | 3308 |
| 23 | rootH2_10043023 | 3300003320 | Bacteria | 6510 |
| 24 | rootL2_10016666 | 3300003322 | Bacteria | 1779 |
| 25 | rootH1_10007994 | 3300003323 | Bacteria | 4824 |
| 26 | rootH1_10225907 | 3300003323 | Bacteria | 2560 |
| 27 | Ga0055542_1000115 | 3300003762 | Bacteria | 106506 |
| 28 | Ga0055529_1000052 | 3300003763 | Bacteria | 203029 |
| 29 | Ga0055536_1013449 | 3300003781 | Bacteria | 2951 |
| 30 | Ga0055530_10000249 | 3300003791 | Bacteria | 48825 |
| 31 | Ga0055531_10000008 | 3300003794 | Bacteria | 222269 |
| 32 | Ga0065704_10083051 | 3300005289 | Bacteria | 3515 |
| 33 | Ga0065704_10107146 | 3300005289 | Bacteria | 2063 |
| 34 | Ga0070658_10000088 | 3300005327 | Bacteria | 85441 |
| 35 | Ga0070658_10011856 | 3300005327 | Bacteria | 6998 |
| 36 | Ga0070658_10066477 | 3300005327 | Bacteria | 2945 |
| 37 | Ga0070658_10077023 | 3300005327 | Bacteria | 2735 |
| 38 | Ga0070658_10350541 | 3300005327 | Bacteria | 1263 |
| 39 | Ga0070683_100001387 | 3300005329 | Bacteria | 18596 |
| 40 | Ga0070683_100233947 | 3300005329 | Bacteria | 1747 |
| 41 | Ga0070670_100000563 | 3300005331 | Bacteria | 29384 |
| 42 | Ga0070670_100299953 | 3300005331 | Bacteria | 1405 |
| 43 | Ga0068868_100086391 | 3300005338 | Bacteria | 2521 |
| 44 | Ga0070660_100004577 | 3300005339 | Bacteria | 9559 |
| 45 | Ga0070660_100005553 | 3300005339 | Bacteria | 8736 |
| 46 | Ga0070660_100005665 | 3300005339 | Bacteria | 8654 |
| 47 | Ga0070660_100007802 | 3300005339 | Bacteria | 7465 |
| 48 | Ga0070661_100024423 | 3300005344 | Bacteria | 4335 |
| 49 | Ga0070661_100214368 | 3300005344 | Bacteria | 1475 |
| 50 | Ga0070692_10020889 | 3300005345 | Bacteria | 3179 |
| 51 | Ga0070668_100002984 | 3300005347 | Bacteria | 12515 |
| 52 | Ga0070668_100014600 | 3300005347 | Bacteria | 5871 |
| 53 | Ga0070668_100033908 | 3300005347 | Bacteria | 3890 |
| 54 | Ga0070668_100035177 | 3300005347 | Bacteria | 3819 |
| 55 | Ga0070668_100222786 | 3300005347 | Bacteria | 1556 |
| 56 | Ga0070669_100000048 | 3300005353 | Bacteria | 118472 |
| 57 | Ga0070669_100000192 | 3300005353 | Bacteria | 53873 |
| 58 | Ga0070671_100000065 | 3300005355 | Bacteria | 71901 |
| 59 | Ga0070674_100000013 | 3300005356 | Bacteria | 121838 |
| 60 | Ga0070673_100010293 | 3300005364 | Bacteria | 6327 |
| 61 | Ga0070659_100066717 | 3300005366 | Bacteria | 2852 |
| 62 | Ga0070659_100177053 | 3300005366 | Bacteria | 1749 |
| 63 | Ga0070667_100000523 | 3300005367 | Bacteria | 38602 |
| 64 | Ga0070667_100002964 | 3300005367 | Bacteria | 14592 |
| 65 | Ga0070667_100136887 | 3300005367 | Bacteria | 2142 |
| 66 | Ga0070662_100007482 | 3300005457 | Bacteria | 7083 |
| 67 | Ga0070662_100027094 | 3300005457 | Bacteria | 3975 |
| 68 | Ga0070662_100622271 | 3300005457 | Bacteria | 909 |
| 69 | Ga0070681_10570207 | 3300005458 | Bacteria | 1046 |
| 70 | Ga0068867_100011083 | 3300005459 | Bacteria | 6360 |
| 71 | Ga0070679_100010488 | 3300005530 | Bacteria | 8790 |
| 72 | Ga0070679_100042614 | 3300005530 | Bacteria | 4521 |
| 73 | Ga0070679_100231733 | 3300005530 | Bacteria | 1806 |
| 74 | Ga0070679_100408132 | 3300005530 | Bacteria | 1304 |
| 75 | Ga0070684_100000637 | 3300005535 | Bacteria | 24083 |
| 76 | Ga0068853_100000373 | 3300005539 | Bacteria | 30758 |
| 77 | Ga0068853_100000873 | 3300005539 | Bacteria | 21069 |
| 78 | Ga0068853_100032735 | 3300005539 | Bacteria | 4406 |
| 79 | Ga0068853_100046492 | 3300005539 | Bacteria | 3722 |
| 80 | Ga0068853_100182241 | 3300005539 | Bacteria | 1905 |
| 81 | Ga0068853_100234434 | 3300005539 | Bacteria | 1680 |
| 82 | Ga0068853_100300156 | 3300005539 | Bacteria | 1484 |
| 83 | Ga0068853_100309836 | 3300005539 | Bacteria | 1461 |
| 84 | Ga0070672_100135211 | 3300005543 | Bacteria | 2030 |
| 85 | Ga0070665_100093895 | 3300005548 | Bacteria | 3005 |
| 86 | Ga0068855_100000173 | 3300005563 | Bacteria | 82962 |
| 87 | Ga0068855_100002262 | 3300005563 | Bacteria | 23756 |
| 88 | Ga0068855_100014300 | 3300005563 | Bacteria | 9557 |
| 89 | Ga0068855_100021485 | 3300005563 | Bacteria | 7739 |
| 90 | Ga0068855_100026215 | 3300005563 | Bacteria | 6974 |
| 91 | Ga0068855_100065454 | 3300005563 | Bacteria | 4238 |
| 92 | Ga0068855_100071857 | 3300005563 | Bacteria | 4022 |
| 93 | Ga0070664_100010514 | 3300005564 | Bacteria | 7500 |
| 94 | Ga0070664_100017462 | 3300005564 | Bacteria | 5892 |
| 95 | Ga0070664_100223355 | 3300005564 | Bacteria | 1686 |
| 96 | Ga0068857_100004617 | 3300005577 | Bacteria | 11667 |
| 97 | Ga0068857_100006948 | 3300005577 | Bacteria | 9739 |
| 98 | Ga0068857_100010210 | 3300005577 | Bacteria | 8164 |
| 99 | Ga0068857_100014446 | 3300005577 | Bacteria | 6888 |
| 100 | Ga0068857_100059197 | 3300005577 | Bacteria | 3402 |
| 101 | Ga0068857_100111605 | 3300005577 | Bacteria | 2458 |
| 102 | Ga0068857_100133017 | 3300005577 | Bacteria | 2244 |
| 103 | Ga0068854_100000071 | 3300005578 | Bacteria | 73211 |
| 104 | Ga0068854_100000295 | 3300005578 | Bacteria | 33183 |
| 105 | Ga0068854_100088992 | 3300005578 | Bacteria | 2294 |
| 106 | Ga0068854_100091762 | 3300005578 | Bacteria | 2261 |
| 107 | Ga0068854_100160548 | 3300005578 | Bacteria | 1740 |
| 108 | Ga0068854_100300419 | 3300005578 | Bacteria | 1298 |
| 109 | Ga0068856_100000785 | 3300005614 | Bacteria | 34421 |
| 110 | Ga0068856_100001545 | 3300005614 | Bacteria | 24115 |
| 111 | Ga0068852_100000060 | 3300005616 | Bacteria | 73764 |
| 112 | Ga0068852_100001458 | 3300005616 | Bacteria | 15978 |
| 113 | Ga0068852_100018212 | 3300005616 | Bacteria | 5530 |
| 114 | Ga0068852_100018586 | 3300005616 | Bacteria | 5479 |
| 115 | Ga0068852_100030161 | 3300005616 | Bacteria | 4461 |
| 116 | Ga0068852_100037350 | 3300005616 | Bacteria | 4071 |
| 117 | Ga0068859_100001206 | 3300005617 | Bacteria | 26384 |
| 118 | Ga0068859_100001920 | 3300005617 | Bacteria | 21196 |
| 119 | Ga0068859_100003753 | 3300005617 | Bacteria | 15492 |
| 120 | Ga0068859_100046142 | 3300005617 | Bacteria | 4377 |
| 121 | Ga0068859_100375687 | 3300005617 | Bacteria | 1517 |
| 122 | Ga0068864_100000109 | 3300005618 | Bacteria | 80156 |
| 123 | Ga0068861_100000017 | 3300005719 | Bacteria | 78362 |
| 124 | Ga0068861_100000124 | 3300005719 | Bacteria | 39677 |
| 125 | Ga0068861_100000201 | 3300005719 | Bacteria | 31934 |
| 126 | Ga0068861_100054709 | 3300005719 | Bacteria | 3041 |
| 127 | Ga0068851_10000666 | 3300005834 | Bacteria | 14670 |
| 128 | Ga0068863_100000168 | 3300005841 | Bacteria | 70935 |
| 129 | Ga0068863_100000403 | 3300005841 | Bacteria | 44004 |
| 130 | Ga0068863_100000936 | 3300005841 | Bacteria | 29333 |
| 131 | Ga0068858_100000104 | 3300005842 | Bacteria | 88260 |
| 132 | Ga0068858_100002215 | 3300005842 | Bacteria | 19678 |
| 133 | Ga0068860_100001426 | 3300005843 | Bacteria | 25889 |
| 134 | Ga0068860_100006530 | 3300005843 | Bacteria | 11707 |
| 135 | Ga0068860_100015898 | 3300005843 | Bacteria | 7345 |
| 136 | Ga0068860_100036308 | 3300005843 | Bacteria | 4723 |
| 137 | Ga0068862_100000128 | 3300005844 | Bacteria | 88625 |
| 138 | Ga0068862_100002200 | 3300005844 | Bacteria | 17498 |
| 139 | Ga0068862_100030459 | 3300005844 | Bacteria | 4548 |
| 140 | Ga0081539_10032076 | 3300005985 | Bacteria | 3223 |
| 141 | Ga0075365_10002107 | 3300006038 | Bacteria | 9518 |
| 142 | Ga0075365_10011285 | 3300006038 | Bacteria | 5248 |
| 143 | Ga0075365_10399349 | 3300006038 | Bacteria | 970 |
| 144 | Ga0075368_10000046 | 3300006042 | Bacteria | 29118 |
| 145 | Ga0075368_10000089 | 3300006042 | Bacteria | 22773 |
| 146 | Ga0075368_10082395 | 3300006042 | Bacteria | 1310 |
| 147 | Ga0075363_100000664 | 3300006048 | Bacteria | 11479 |
| 148 | Ga0075364_10000007 | 3300006051 | Bacteria | 73806 |
| 149 | Ga0070712_100475232 | 3300006175 | Bacteria | 1044 |
| 150 | Ga0075362_10001665 | 3300006177 | Bacteria | 7207 |
| 151 | Ga0075367_10000037 | 3300006178 | Bacteria | 29457 |
| 152 | Ga0075367_10000962 | 3300006178 | Bacteria | 11762 |
| 153 | Ga0075369_10000954 | 3300006186 | Bacteria | 9628 |
| 154 | Ga0075369_10089962 | 3300006186 | Bacteria | 1369 |
| 155 | Ga0075366_10018330 | 3300006195 | Bacteria | 4040 |
| 156 | Ga0075370_10000371 | 3300006353 | Bacteria | 16477 |
| 157 | Ga0075370_10019290 | 3300006353 | Bacteria | 3713 |
| 158 | Ga0068865_100000006 | 3300006881 | Bacteria | 201186 |
| 159 | Ga0097620_100001206 | 3300006931 | Bacteria | 26384 |
| 160 | Ga0097620_100001920 | 3300006931 | Bacteria | 21196 |
| 161 | Ga0097620_100003753 | 3300006931 | Bacteria | 15492 |
| 162 | Ga0097620_100046142 | 3300006931 | Bacteria | 4377 |
| 163 | Ga0097620_100375664 | 3300006931 | Bacteria | 1517 |
| 164 | Ga0105251_10000132 | 3300009011 | Bacteria | 75189 |
| 165 | Ga0105250_10006219 | 3300009092 | Bacteria | 5241 |
| 166 | Ga0105240_10007247 | 3300009093 | Bacteria | 16146 |
| 167 | Ga0105240_10014342 | 3300009093 | Bacteria | 10823 |
| 168 | Ga0105240_10030377 | 3300009093 | Bacteria | 7023 |
| 169 | Ga0105240_10091495 | 3300009093 | Bacteria | 3716 |
| 170 | Ga0105243_10001647 | 3300009148 | Bacteria | 19389 |
| 171 | Ga0105241_10130703 | 3300009174 | Bacteria | 2032 |
| 172 | Ga0105248_10000561 | 3300009177 | Bacteria | 42112 |
| 173 | Ga0105248_10001759 | 3300009177 | Bacteria | 24104 |
| 174 | Ga0105248_10271489 | 3300009177 | Bacteria | 1910 |
| 175 | Ga0105237_10000378 | 3300009545 | Bacteria | 63407 |
| 176 | Ga0105237_10006024 | 3300009545 | Bacteria | 13569 |
| 177 | Ga0105237_10022170 | 3300009545 | Bacteria | 6517 |
| 178 | Ga0105237_10184277 | 3300009545 | Bacteria | 2088 |
| 179 | Ga0105237_10310984 | 3300009545 | Bacteria | 1579 |
| 180 | Ga0105238_10000647 | 3300009551 | Bacteria | 36611 |
| 181 | Ga0105238_10000912 | 3300009551 | Bacteria | 30323 |
| 182 | Ga0105238_10001356 | 3300009551 | Bacteria | 24564 |
| 183 | Ga0105238_10009276 | 3300009551 | Bacteria | 9848 |
| 184 | Ga0105238_10020241 | 3300009551 | Bacteria | 6772 |
| 185 | Ga0105238_10038255 | 3300009551 | Bacteria | 4872 |
| 186 | Ga0105238_10048636 | 3300009551 | Bacteria | 4273 |
| 187 | Ga0105249_10144289 | 3300009553 | Bacteria | 2286 |
| 188 | Ga0105148_100638 | 3300009978 | Bacteria | 2854 |
| 189 | Ga0105239_10000232 | 3300010375 | Bacteria | 82037 |
| 190 | Ga0105239_10005393 | 3300010375 | Bacteria | 15012 |
| 191 | Ga0105239_10009359 | 3300010375 | Bacteria | 11057 |
| 192 | Ga0105239_10010609 | 3300010375 | Bacteria | 10304 |
| 193 | Ga0157326_1000258 | 3300012513 | Bacteria | 6193 |
| 194 | Ga0157373_10002657 | 3300013100 | Bacteria | 13561 |
| 195 | Ga0157373_10157933 | 3300013100 | Bacteria | 1595 |
| 196 | Ga0157371_10001141 | 3300013102 | Bacteria | 28613 |
| 197 | Ga0157371_10003271 | 3300013102 | Bacteria | 14854 |
| 198 | Ga0157371_10032675 | 3300013102 | Bacteria | 3743 |
| 199 | Ga0157370_10000782 | 3300013104 | Bacteria | 39909 |
| 200 | Ga0157370_10001089 | 3300013104 | Bacteria | 34040 |
| 201 | Ga0157370_10006168 | 3300013104 | Bacteria | 13298 |
| 202 | Ga0157370_10006494 | 3300013104 | Bacteria | 12882 |
| 203 | Ga0157370_10044866 | 3300013104 | Bacteria | 4245 |
| 204 | Ga0157370_10057225 | 3300013104 | Bacteria | 3709 |
| 205 | Ga0157369_10000220 | 3300013105 | Bacteria | 79213 |
| 206 | Ga0157369_10000632 | 3300013105 | Bacteria | 45648 |
| 207 | Ga0157369_10003995 | 3300013105 | Bacteria | 17496 |
| 208 | Ga0157369_10007094 | 3300013105 | Bacteria | 12922 |
| 209 | Ga0157369_10009285 | 3300013105 | Bacteria | 11249 |
| 210 | Ga0157369_10017891 | 3300013105 | Bacteria | 7956 |
| 211 | Ga0157369_10027809 | 3300013105 | Bacteria | 6265 |
| 212 | Ga0157369_10094798 | 3300013105 | Bacteria | 3186 |
| 213 | Ga0157369_10156086 | 3300013105 | Bacteria | 2410 |
| 214 | Ga0157369_10234178 | 3300013105 | Bacteria | 1919 |
| 215 | Ga0157374_10009422 | 3300013296 | Bacteria | 8381 |
| 216 | Ga0157378_10000050 | 3300013297 | Bacteria | 102138 |
| 217 | Ga0157378_10607330 | 3300013297 | Bacteria | 1106 |
| 218 | Ga0163162_10000261 | 3300013306 | Bacteria | 48037 |
| 219 | Ga0163162_10001322 | 3300013306 | Bacteria | 23153 |
| 220 | Ga0163162_10005897 | 3300013306 | Bacteria | 11850 |
| 221 | Ga0157372_10001385 | 3300013307 | Bacteria | 26160 |
| 222 | Ga0157372_10003423 | 3300013307 | Bacteria | 17122 |
| 223 | Ga0157372_10004488 | 3300013307 | Bacteria | 14886 |
| 224 | Ga0157372_10333581 | 3300013307 | Bacteria | 1766 |
| 225 | Ga0157380_10000029 | 3300014326 | Bacteria | 98248 |
| 226 | Ga0157377_10207376 | 3300014745 | Bacteria | 1248 |
| 227 | Ga0157379_10003369 | 3300014968 | Bacteria | 13521 |
| 228 | Ga0163161_10045261 | 3300017792 | Bacteria | 3173 |
| 229 | Ga0163161_10072291 | 3300017792 | Bacteria | 2525 |
| 230 | Ga0163161_10093937 | 3300017792 | Bacteria | 2223 |
| 231 | Ga0214544_1009140 | 3300021320 | Bacteria | 15797 |
| 232 | Ga0209147_100482 | 3300025229 | Bacteria | 24036 |
| 233 | Ga0209563_100047 | 3300025230 | Bacteria | 366620 |
| 234 | Ga0209437_114980 | 3300025233 | Bacteria | 1068 |
| 235 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 236 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 237 | Ga0209233_1000167 | 3300025261 | Bacteria | 149536 |
| 238 | Ga0209233_1007274 | 3300025261 | Bacteria | 3516 |
| 239 | Ga0209233_1035826 | 3300025261 | Bacteria | 1117 |
| 240 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 241 | Ga0209676_1000077 | 3300025292 | Bacteria | 298831 |
| 242 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 243 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 244 | Ga0209050_1005513 | 3300025298 | Bacteria | 7909 |
| 245 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 246 | Ga0209257_1006476 | 3300025304 | Bacteria | 7514 |
| 247 | Ga0207697_10000315 | 3300025315 | Bacteria | 27117 |
| 248 | Ga0207697_10013988 | 3300025315 | Bacteria | 3340 |
| 249 | Ga0207656_10000058 | 3300025321 | Bacteria | 43858 |
| 250 | Ga0207696_1002176 | 3300025711 | Bacteria | 9828 |
| 251 | Ga0207713_1000224 | 3300025735 | Bacteria | 76504 |
| 252 | Ga0207713_1025534 | 3300025735 | Bacteria | 2725 |
| 253 | Ga0207647_10006429 | 3300025904 | Bacteria | 8541 |
| 254 | Ga0207647_10038705 | 3300025904 | Bacteria | 3014 |
| 255 | Ga0207705_10000071 | 3300025909 | Bacteria | 128862 |
| 256 | Ga0207705_10000138 | 3300025909 | Bacteria | 78969 |
| 257 | Ga0207705_10000266 | 3300025909 | Bacteria | 50282 |
| 258 | Ga0207705_10005208 | 3300025909 | Bacteria | 9749 |
| 259 | Ga0207705_10084091 | 3300025909 | Bacteria | 2323 |
| 260 | Ga0207705_10340541 | 3300025909 | Bacteria | 1154 |
| 261 | Ga0207705_10436713 | 3300025909 | Bacteria | 1014 |
| 262 | Ga0207654_10143323 | 3300025911 | Bacteria | 1526 |
| 263 | Ga0207707_10300551 | 3300025912 | Bacteria | 1388 |
| 264 | Ga0207695_10000525 | 3300025913 | Bacteria | 81111 |
| 265 | Ga0207695_10001920 | 3300025913 | Bacteria | 32321 |
| 266 | Ga0207695_10012067 | 3300025913 | Bacteria | 10387 |
| 267 | Ga0207695_10030763 | 3300025913 | Bacteria | 5906 |
| 268 | Ga0207695_10039507 | 3300025913 | Bacteria | 5072 |
| 269 | Ga0207695_10077854 | 3300025913 | Bacteria | 3366 |
| 270 | Ga0207695_10111809 | 3300025913 | Bacteria | 2710 |
| 271 | Ga0207671_10000222 | 3300025914 | Bacteria | 85244 |
| 272 | Ga0207671_10015756 | 3300025914 | Bacteria | 5904 |
| 273 | Ga0207671_10018414 | 3300025914 | Bacteria | 5358 |
| 274 | Ga0207660_10017144 | 3300025917 | Bacteria | 4806 |
| 275 | Ga0207660_10078180 | 3300025917 | Bacteria | 2424 |
| 276 | Ga0207657_10000020 | 3300025919 | Bacteria | 157826 |
| 277 | Ga0207657_10001528 | 3300025919 | Bacteria | 24769 |
| 278 | Ga0207657_10003535 | 3300025919 | Bacteria | 16692 |
| 279 | Ga0207657_10005598 | 3300025919 | Bacteria | 13118 |
| 280 | Ga0207657_10007994 | 3300025919 | Bacteria | 10785 |
| 281 | Ga0207657_10008495 | 3300025919 | Bacteria | 10416 |
| 282 | Ga0207657_10020437 | 3300025919 | Bacteria | 6257 |
| 283 | Ga0207657_10307044 | 3300025919 | Bacteria | 1256 |
| 284 | Ga0207649_10000034 | 3300025920 | Bacteria | 136049 |
| 285 | Ga0207649_10008333 | 3300025920 | Bacteria | 5650 |
| 286 | Ga0207649_10338543 | 3300025920 | Bacteria | 1110 |
| 287 | Ga0207652_10044778 | 3300025921 | Bacteria | 3771 |
| 288 | Ga0207652_10242056 | 3300025921 | Bacteria | 1626 |
| 289 | Ga0207681_10000037 | 3300025923 | Bacteria | 154417 |
| 290 | Ga0207681_10000050 | 3300025923 | Bacteria | 118481 |
| 291 | Ga0207694_10000611 | 3300025924 | Bacteria | 32401 |
| 292 | Ga0207694_10001992 | 3300025924 | Bacteria | 16904 |
| 293 | Ga0207694_10002066 | 3300025924 | Bacteria | 16586 |
| 294 | Ga0207694_10002827 | 3300025924 | Bacteria | 14002 |
| 295 | Ga0207694_10002967 | 3300025924 | Bacteria | 13625 |
| 296 | Ga0207694_10020108 | 3300025924 | Bacteria | 5050 |
| 297 | Ga0207694_10031448 | 3300025924 | Bacteria | 4054 |
| 298 | Ga0207694_10081805 | 3300025924 | Bacteria | 2537 |
| 299 | Ga0207650_10000039 | 3300025925 | Bacteria | 204737 |
| 300 | Ga0207650_10305267 | 3300025925 | Bacteria | 1301 |
| 301 | Ga0207644_10000045 | 3300025931 | Bacteria | 105495 |
| 302 | Ga0207644_10075999 | 3300025931 | Bacteria | 2470 |
| 303 | Ga0207706_10014734 | 3300025933 | Bacteria | 7081 |
| 304 | Ga0207706_10031349 | 3300025933 | Bacteria | 4737 |
| 305 | Ga0207709_10001104 | 3300025935 | Bacteria | 19781 |
| 306 | Ga0207669_10000011 | 3300025937 | Bacteria | 142774 |
| 307 | Ga0207704_10000022 | 3300025938 | Bacteria | 146109 |
| 308 | Ga0207691_10033497 | 3300025940 | Bacteria | 4783 |
| 309 | Ga0207711_10000676 | 3300025941 | Bacteria | 33882 |
| 310 | Ga0207711_10028349 | 3300025941 | Bacteria | 4711 |
| 311 | Ga0207711_10069242 | 3300025941 | Bacteria | 3058 |
| 312 | Ga0207711_10497729 | 3300025941 | Bacteria | 1136 |
| 313 | Ga0207689_10005004 | 3300025942 | Bacteria | 11936 |
| 314 | Ga0207661_10002993 | 3300025944 | Bacteria | 11688 |
| 315 | Ga0207679_10006486 | 3300025945 | Bacteria | 7398 |
| 316 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 317 | Ga0207667_10005828 | 3300025949 | Bacteria | 15013 |
| 318 | Ga0207667_10024820 | 3300025949 | Bacteria | 6573 |
| 319 | Ga0207667_10025344 | 3300025949 | Bacteria | 6493 |
| 320 | Ga0207667_10039581 | 3300025949 | Bacteria | 5024 |
| 321 | Ga0207667_10462769 | 3300025949 | Bacteria | 1288 |
| 322 | Ga0207667_10522872 | 3300025949 | Bacteria | 1202 |
| 323 | Ga0207667_10535213 | 3300025949 | Bacteria | 1186 |
| 324 | Ga0207651_10178717 | 3300025960 | Bacteria | 1681 |
| 325 | Ga0207651_10664857 | 3300025960 | Bacteria | 915 |
| 326 | Ga0207712_10125847 | 3300025961 | Bacteria | 1945 |
| 327 | Ga0207668_10000055 | 3300025972 | Bacteria | 94786 |
| 328 | Ga0207668_10005353 | 3300025972 | Bacteria | 7548 |
| 329 | Ga0207668_10005413 | 3300025972 | Bacteria | 7520 |
| 330 | Ga0207668_10013328 | 3300025972 | Bacteria | 5058 |
| 331 | Ga0207668_10051936 | 3300025972 | Bacteria | 2834 |
| 332 | Ga0207668_10111769 | 3300025972 | Bacteria | 2051 |
| 333 | Ga0207640_10000041 | 3300025981 | Bacteria | 105374 |
| 334 | Ga0207640_10004501 | 3300025981 | Bacteria | 7561 |
| 335 | Ga0207640_10012720 | 3300025981 | Bacteria | 4802 |
| 336 | Ga0207640_10040536 | 3300025981 | Bacteria | 2955 |
| 337 | Ga0207640_10081189 | 3300025981 | Bacteria | 2216 |
| 338 | Ga0207640_10188531 | 3300025981 | Bacteria | 1552 |
| 339 | Ga0207658_10001363 | 3300025986 | Bacteria | 19075 |
| 340 | Ga0207658_10004471 | 3300025986 | Bacteria | 9718 |
| 341 | Ga0207677_10000164 | 3300026023 | Bacteria | 52688 |
| 342 | Ga0207703_10000136 | 3300026035 | Bacteria | 89612 |
| 343 | Ga0207703_10002249 | 3300026035 | Bacteria | 16867 |
| 344 | Ga0207703_10007960 | 3300026035 | Bacteria | 8377 |
| 345 | Ga0207639_10000081 | 3300026041 | Bacteria | 82747 |
| 346 | Ga0207639_10000779 | 3300026041 | Bacteria | 21675 |
| 347 | Ga0207639_10005959 | 3300026041 | Bacteria | 8269 |
| 348 | Ga0207639_10130019 | 3300026041 | Bacteria | 2083 |
| 349 | Ga0207639_10147518 | 3300026041 | Bacteria | 1967 |
| 350 | Ga0207639_10262181 | 3300026041 | Bacteria | 1512 |
| 351 | Ga0207678_10043529 | 3300026067 | Bacteria | 3885 |
| 352 | Ga0207678_10150495 | 3300026067 | Bacteria | 1987 |
| 353 | Ga0207702_10000211 | 3300026078 | Bacteria | 69152 |
| 354 | Ga0207702_10001302 | 3300026078 | Bacteria | 24991 |
| 355 | Ga0207702_10030790 | 3300026078 | Bacteria | 4470 |
| 356 | Ga0207641_10000165 | 3300026088 | Bacteria | 93436 |
| 357 | Ga0207641_10000241 | 3300026088 | Bacteria | 71027 |
| 358 | Ga0207641_10000504 | 3300026088 | Bacteria | 43890 |
| 359 | Ga0207676_10000035 | 3300026095 | Bacteria | 204737 |
| 360 | Ga0207674_10005761 | 3300026116 | Bacteria | 14694 |
| 361 | Ga0207674_10008818 | 3300026116 | Bacteria | 11607 |
| 362 | Ga0207674_10021570 | 3300026116 | Bacteria | 6934 |
| 363 | Ga0207674_10037386 | 3300026116 | Bacteria | 5049 |
| 364 | Ga0207674_10040705 | 3300026116 | Bacteria | 4812 |
| 365 | Ga0207674_10055105 | 3300026116 | Bacteria | 4045 |
| 366 | Ga0207674_10066239 | 3300026116 | Bacteria | 3639 |
| 367 | Ga0207674_10108367 | 3300026116 | Bacteria | 2754 |
| 368 | Ga0207674_10157292 | 3300026116 | Bacteria | 2228 |
| 369 | Ga0207674_10227228 | 3300026116 | Bacteria | 1814 |
| 370 | Ga0207675_100000018 | 3300026118 | Bacteria | 124200 |
| 371 | Ga0207675_100000458 | 3300026118 | Bacteria | 39635 |
| 372 | Ga0207675_100000462 | 3300026118 | Bacteria | 39560 |
| 373 | Ga0207675_100232019 | 3300026118 | Bacteria | 1781 |
| 374 | Ga0207698_10000054 | 3300026142 | Bacteria | 82681 |
| 375 | Ga0207698_10001032 | 3300026142 | Bacteria | 16209 |
| 376 | Ga0207698_10001871 | 3300026142 | Bacteria | 12297 |
| 377 | Ga0207698_10012887 | 3300026142 | Bacteria | 5493 |
| 378 | Ga0207698_10024017 | 3300026142 | Bacteria | 4270 |
| 379 | Ga0207698_10151949 | 3300026142 | Bacteria | 2011 |
| 380 | Ga0209813_10000050 | 3300027866 | Bacteria | 48358 |
| 381 | Ga0209813_10000073 | 3300027866 | Bacteria | 37553 |
| 382 | Ga0268266_10032876 | 3300028379 | Bacteria | 4408 |
| 383 | Ga0268266_10566017 | 3300028379 | Bacteria | 1090 |
| 384 | Ga0268265_10000102 | 3300028380 | Bacteria | 106737 |
| 385 | Ga0268265_10002307 | 3300028380 | Bacteria | 14530 |
| 386 | Ga0268265_10069645 | 3300028380 | Bacteria | 2732 |
| 387 | Ga0268265_10115322 | 3300028380 | Bacteria | 2202 |
| 388 | Ga0268264_10000154 | 3300028381 | Bacteria | 156992 |
| 389 | Ga0268264_10001686 | 3300028381 | Bacteria | 20359 |
| 390 | Ga0268264_10011539 | 3300028381 | Bacteria | 7301 |
| 391 | Ga0268264_10024547 | 3300028381 | Bacteria | 4922 |
| 392 | Ga0307517_10003177 | 3300028786 | Bacteria | 25825 |
| 393 | Ga0307517_10045513 | 3300028786 | Bacteria | 4606 |
| 394 | Ga0265338_10159120 | 3300028800 | Bacteria | 1746 |
| 395 | Ga0307513_10479462 | 3300031456 | Bacteria | 964 |
| 396 | Ga0307408_100001033 | 3300031548 | Bacteria | 21395 |
| 397 | Ga0307408_100001589 | 3300031548 | Bacteria | 16769 |
| 398 | Ga0307408_100001936 | 3300031548 | Bacteria | 15015 |
| 399 | Ga0307408_100039288 | 3300031548 | Bacteria | 3344 |
| 400 | Ga0307405_10000583 | 3300031731 | Bacteria | 13988 |
| 401 | Ga0307413_10001271 | 3300031824 | Bacteria | 9414 |
| 402 | Ga0307406_10000490 | 3300031901 | Bacteria | 22793 |
| 403 | Ga0307406_10007007 | 3300031901 | Bacteria | 6240 |
| 404 | Ga0307412_10000525 | 3300031911 | Bacteria | 22799 |
| 405 | Ga0307412_10028911 | 3300031911 | Bacteria | 3474 |
| 406 | Ga0307412_10065507 | 3300031911 | Bacteria | 2459 |
| 407 | Ga0307416_100040623 | 3300032002 | Bacteria | 3616 |
| 408 | Ga0307414_10000135 | 3300032004 | Bacteria | 50571 |
| 409 | Ga0307414_10073332 | 3300032004 | Bacteria | 2476 |
| 410 | Ga0307411_10000688 | 3300032005 | Bacteria | 12419 |
| 411 | Ga0307510_10005547 | 3300033180 | Bacteria | 15039 |
| 412 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 413 | Ga0373947_0202285 | 3300035725 | Bacteria | 1300 |
| 414 | Ga0395899_0000366 | 3300037312 | Bacteria | 54708 |
| 415 | Ga0395899_0000387 | 3300037312 | Bacteria | 52472 |
| 416 | Ga0395899_0071151 | 3300037312 | Bacteria | 2545 |
| 417 | Ga0395899_0124956 | 3300037312 | Bacteria | 1840 |
| 418 | Ga0395900_0000130 | 3300037418 | Bacteria | 126231 |
| 419 | Ga0395900_0000756 | 3300037418 | Bacteria | 42958 |
| 420 | Ga0395900_0009767 | 3300037418 | Bacteria | 9833 |
| 421 | Ga0395900_0039938 | 3300037418 | Bacteria | 4836 |
| 422 | Ga0395900_0152989 | 3300037418 | Bacteria | 2356 |
| 423 | Ga0395900_0189393 | 3300037418 | Bacteria | 2087 |
| 424 | Ga0395900_0210964 | 3300037418 | Bacteria | 1961 |
| 425 | Ga0395900_0218966 | 3300037418 | Bacteria | 1920 |
| 426 | Ga0395900_0289144 | 3300037418 | Bacteria | 1628 |
| 427 | Ga0395900_0310244 | 3300037418 | Bacteria | 1561 |
| 428 | Ga0395900_0313680 | 3300037418 | Bacteria | 1551 |
| 429 | Ga0395898_0000274 | 3300037466 | Bacteria | 125922 |
| 430 | Ga0395898_0042237 | 3300037466 | Bacteria | 4500 |
| 431 | Ga0395898_0070335 | 3300037466 | Bacteria | 3384 |
| 432 | Ga0395898_0213805 | 3300037466 | Bacteria | 1839 |
| 433 | Ga0395898_0448438 | 3300037466 | Bacteria | 1229 |
| 434 | Ga0395905_0000287 | 3300037471 | Bacteria | 73803 |
| 435 | Ga0395905_0002377 | 3300037471 | Bacteria | 20963 |
| 436 | Ga0395905_0015566 | 3300037471 | Bacteria | 7227 |
| 437 | Ga0395905_0061887 | 3300037471 | Bacteria | 3501 |
| 438 | Ga0395905_0096184 | 3300037471 | Bacteria | 2780 |
| 439 | Ga0395905_0124111 | 3300037471 | Bacteria | 2428 |
| 440 | Ga0395905_0177307 | 3300037471 | Bacteria | 2000 |
| 441 | Ga0395905_0296171 | 3300037471 | Bacteria | 1505 |
| 442 | Ga0395905_0442758 | 3300037471 | Bacteria | 1197 |
| 443 | Ga0395901_0000108 | 3300038443 | Bacteria | 113046 |
| 444 | Ga0395901_0096916 | 3300038443 | Bacteria | 3091 |
| 445 | Ga0395901_0145472 | 3300038443 | Bacteria | 2491 |
| 446 | Ga0395901_0183378 | 3300038443 | Bacteria | 2195 |
| 447 | Ga0395901_0253338 | 3300038443 | Bacteria | 1834 |
| 448 | Ga0395901_0282625 | 3300038443 | Bacteria | 1724 |
| 449 | Ga0395901_0491217 | 3300038443 | Bacteria | 1251 |
| 450 | Ga0395901_0680481 | 3300038443 | Bacteria | 1028 |
| 451 | Ga0237819_00451 | 3300038705 | Bacteria | 13995 |
| 452 | Ga0237819_06546 | 3300038705 | Bacteria | 1738 |
| 453 | Ga0450912_000046 | 3300042116 | Bacteria | 4108 |
| 454 | Ga0450894_006902 | 3300042131 | Bacteria | 1463 |
| 455 | Ga0450898_001596 | 3300042134 | Bacteria | 3030 |
| 456 | Ga0439459_0003296 | 3300042438 | Bacteria | 2548 |
| 457 | Ga0450893_0001915 | 3300042532 | Bacteria | 3230 |
| 458 | Ga0466969_0111377 | 3300044656 | Bacteria | 1281 |
| 459 | Ga0466957_0058378 | 3300044842 | Bacteria | 2364 |
| 460 | Ga0495627_000409 | 3300046453 | Bacteria | 37928 |
| 461 | Ga0495627_000883 | 3300046453 | Bacteria | 21095 |
| 462 | Ga0495627_001643 | 3300046453 | Bacteria | 12428 |
| 463 | Ga0495627_001780 | 3300046453 | Bacteria | 11539 |
| 464 | Ga0495627_011562 | 3300046453 | Bacteria | 3164 |
| 465 | Ga0495650_0001552 | 3300046471 | Bacteria | 21682 |
| 466 | Ga0495650_0001944 | 3300046471 | Bacteria | 18278 |
| 467 | Ga0495585_0144684 | 3300046492 | Bacteria | 1243 |
| 468 | Ga0495583_0000120 | 3300046506 | Bacteria | 133285 |
| 469 | Ga0495583_0050151 | 3300046506 | Bacteria | 1909 |
| 470 | Ga0495606_0061141 | 3300046507 | Bacteria | 2410 |
| 471 | Ga0495610_0000094 | 3300046512 | Bacteria | 105131 |
| 472 | Ga0495610_0011765 | 3300046512 | Bacteria | 5316 |
| 473 | Ga0495610_0028312 | 3300046512 | Bacteria | 2964 |
| 474 | Ga0495616_0000009 | 3300046513 | Bacteria | 225502 |
| 475 | Ga0495632_0001232 | 3300046519 | Bacteria | 21721 |
| 476 | Ga0495637_0010985 | 3300046520 | Bacteria | 4363 |
| 477 | Ga0495643_0000054 | 3300046522 | Bacteria | 198757 |
| 478 | Ga0495643_0009112 | 3300046522 | Bacteria | 6215 |
| 479 | Ga0495648_0011032 | 3300046524 | Bacteria | 6846 |
| 480 | Ga0495648_0036330 | 3300046524 | Bacteria | 3181 |
| 481 | Ga0495654_0017583 | 3300046530 | Bacteria | 3755 |
| 482 | Ga0495633_0000054 | 3300046558 | Bacteria | 151646 |
| 483 | Ga0495633_0000145 | 3300046558 | Bacteria | 94380 |
| 484 | Ga0495633_0111085 | 3300046558 | Bacteria | 1271 |
| 485 | Ga0495661_0139020 | 3300046665 | Bacteria | 1323 |
| 486 | Ga0495687_000200 | 3300047443 | Bacteria | 85752 |
| 487 | Ga0495677_0002742 | 3300047445 | Bacteria | 6885 |
| 488 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 489 | Ga0495681_0007128 | 3300047470 | Bacteria | 7203 |
| 490 | Ga0495681_0053740 | 3300047470 | Bacteria | 1884 |
| 491 | Ga0495686_0150308 | 3300047472 | Bacteria | 1367 |
| 492 | Ga0495626_0005504 | 3300048091 | Bacteria | 7376 |
| 493 | Ga0496100_0006587 | 3300048903 | Bacteria | 6345 |
| 494 | Ga0496101_0038514 | 3300048904 | Bacteria | 3396 |
| 495 | Ga0496104_0016538 | 3300048907 | Bacteria | 6703 |
| 496 | Ga0496105_0002439 | 3300048908 | Bacteria | 13462 |
| 497 | Ga0496105_0023910 | 3300048908 | Bacteria | 4962 |
| 498 | Ga0496106_0440360 | 3300048909 | Bacteria | 1047 |
| 499 | Ga0496110_0225406 | 3300048913 | Bacteria | 1704 |
| 500 | Ga0496111_0016199 | 3300048914 | Bacteria | 5135 |
| 501 | Ga0496111_0086353 | 3300048914 | Bacteria | 2296 |
| 502 | Ga0496113_0075468 | 3300048916 | Bacteria | 2573 |
| 503 | Ga0496115_0040957 | 3300048918 | Bacteria | 3684 |
| 504 | Ga0496116_0003877 | 3300048919 | Bacteria | 14579 |
| 505 | Ga0496116_0003989 | 3300048919 | Bacteria | 14316 |
| 506 | Ga0496116_0068909 | 3300048919 | Bacteria | 2252 |
| 507 | Ga0496117_0011550 | 3300048920 | Bacteria | 7901 |
| 508 | Ga0496117_0170022 | 3300048920 | Bacteria | 1266 |
| 509 | Ga0496118_0005823 | 3300048921 | Bacteria | 13813 |
| 510 | Ga0496118_0109123 | 3300048921 | Bacteria | 1843 |
| 511 | Ga0496118_0164981 | 3300048921 | Bacteria | 1363 |
| 512 | Ga0496120_0033259 | 3300048923 | Bacteria | 3099 |
| 513 | Ga0496120_0036230 | 3300048923 | Bacteria | 2938 |
| 514 | Ga0496121_0000472 | 3300048924 | Bacteria | 78334 |
| 515 | Ga0496121_0001255 | 3300048924 | Bacteria | 43938 |
| 516 | Ga0496121_0001383 | 3300048924 | Bacteria | 41083 |
| 517 | Ga0496121_0002146 | 3300048924 | Bacteria | 30925 |
| 518 | Ga0496121_0140930 | 3300048924 | Bacteria | 1789 |
| 519 | Ga0496121_0157741 | 3300048924 | Bacteria | 1663 |
| 520 | Ga0496122_0001258 | 3300048925 | Bacteria | 42409 |
| 521 | Ga0496122_0001624 | 3300048925 | Bacteria | 35073 |
| 522 | Ga0496122_0001950 | 3300048925 | Bacteria | 30922 |
| 523 | Ga0496122_0001993 | 3300048925 | Bacteria | 30434 |
| 524 | Ga0496122_0043737 | 3300048925 | Bacteria | 3505 |
| 525 | Ga0496123_0001440 | 3300048926 | Bacteria | 33152 |
| 526 | Ga0496123_0001459 | 3300048926 | Bacteria | 32922 |
| 527 | Ga0496123_0001523 | 3300048926 | Bacteria | 32024 |
| 528 | Ga0496123_0002778 | 3300048926 | Bacteria | 20862 |
| 529 | Ga0496123_0055943 | 3300048926 | Bacteria | 2584 |
| 530 | Ga0496124_0000011 | 3300048927 | Bacteria | 524145 |
| 531 | Ga0496124_0000188 | 3300048927 | Bacteria | 122361 |
| 532 | Ga0496124_0001591 | 3300048927 | Bacteria | 32694 |
| 533 | Ga0496124_0001870 | 3300048927 | Bacteria | 28977 |
| 534 | Ga0496124_0004286 | 3300048927 | Bacteria | 16754 |
| 535 | Ga0496124_0008338 | 3300048927 | Bacteria | 10853 |
| 536 | Ga0496124_0009721 | 3300048927 | Bacteria | 9844 |
| 537 | Ga0496124_0013548 | 3300048927 | Bacteria | 7951 |
| 538 | Ga0496124_0043826 | 3300048927 | Bacteria | 3843 |
| 539 | Ga0496124_0107628 | 3300048927 | Bacteria | 2249 |
| 540 | Ga0496125_0001456 | 3300048928 | Bacteria | 34314 |
| 541 | Ga0496125_0001686 | 3300048928 | Bacteria | 30917 |
| 542 | Ga0496125_0033035 | 3300048928 | Bacteria | 4586 |
| 543 | Ga0496125_0039537 | 3300048928 | Bacteria | 4059 |
| 544 | Ga0496125_0084294 | 3300048928 | Bacteria | 2414 |
| 545 | Ga0496125_0136047 | 3300048928 | Bacteria | 1719 |
| 546 | Ga0496125_0218162 | 3300048928 | Bacteria | 1231 |
| 547 | Ga0496126_0000041 | 3300048929 | Bacteria | 340389 |
| 548 | Ga0496126_0000202 | 3300048929 | Bacteria | 132786 |
| 549 | Ga0496126_0006033 | 3300048929 | Bacteria | 13598 |
| 550 | Ga0496126_0023544 | 3300048929 | Bacteria | 5967 |
| 551 | Ga0496126_0058871 | 3300048929 | Bacteria | 3462 |
| 552 | Ga0496126_0067751 | 3300048929 | Bacteria | 3189 |
| 553 | Ga0496126_0500496 | 3300048929 | Bacteria | 971 |
| 554 | Ga0495678_017497 | 3300049459 | Bacteria | 3247 |
| 555 | Ga0501031_0179842 | 3300049568 | Bacteria | 1382 |
| 556 | Ga0501034_0213687 | 3300049571 | Bacteria | 1883 |
| 557 | Ga0501037_0195299 | 3300049573 | Bacteria | 1432 |
| 558 | Ga0501038_0034087 | 3300049574 | Bacteria | 4478 |
| 559 | Ga0501047_0065479 | 3300049581 | Bacteria | 3503 |
| 560 | Ga0501047_0491454 | 3300049581 | Bacteria | 1054 |
| 561 | Ga0501233_000039 | 3300049668 | Bacteria | 17480 |
| 562 | Ga0501249_000069 | 3300049679 | Bacteria | 36407 |
| 563 | Ga0501249_000114 | 3300049679 | Bacteria | 24796 |
| 564 | Ga0501225_0014815 | 3300049705 | Bacteria | 2174 |
| 565 | Ga0501035_0079249 | 3300049822 | Bacteria | 2901 |
| 566 | Ga0501044_0011071 | 3300049823 | Bacteria | 9783 |
| 567 | Ga0501044_0097444 | 3300049823 | Bacteria | 2962 |
| 568 | Ga0501204_000619 | 3300049850 | Bacteria | 3161 |
| 569 | Ga0501204_001691 | 3300049850 | Bacteria | 2194 |
| 570 | Ga0501220_00697 | 3300049852 | Bacteria | 1075 |
| 571 | nmdc:mga03683_161_c1 | 3300050489 | Bacteria | 22524 |
| 572 | nmdc:mga03n38_287_c1 | 3300050490 | Bacteria | 12037 |
| 573 | nmdc:mga00v17_29_c1 | 3300050491 | Bacteria | 89620 |
| 574 | nmdc:mga0yw44_1026_c1 | 3300050492 | Bacteria | 10710 |
| 575 | nmdc:mga0k408_17368_c1 | 3300050493 | Bacteria | 4009 |
| 576 | nmdc:mga06z11_165_c1 | 3300050494 | Bacteria | 25978 |
| 577 | nmdc:mga06z11_54_c1 | 3300050494 | Bacteria | 48385 |
| 578 | nmdc:mga04h51_15_c1 | 3300050495 | Bacteria | 76646 |
| 579 | nmdc:mga04h51_32_c1 | 3300050495 | Bacteria | 48953 |
| 580 | nmdc:mga04h51_58946_c1 | 3300050495 | Bacteria | 1310 |
| 581 | nmdc:mga07m45_128508_c1 | 3300050496 | Bacteria | 1466 |
| 582 | nmdc:mga07m45_188505_c1 | 3300050496 | Bacteria | 1199 |
| 583 | nmdc:mga07m45_5_c2 | 3300050496 | Bacteria | 297012 |
| 584 | nmdc:mga07m45_71301_c1 | 3300050496 | Bacteria | 1977 |
| 585 | nmdc:mga0sz30_1471_c1 | 3300050516 | Bacteria | 8403 |
| 586 | Ga0500643_000090 | 3300053087 | Bacteria | 93938 |
| 587 | Ga0500643_002703 | 3300053087 | Bacteria | 8911 |
| 588 | Ga0500643_060487 | 3300053087 | Bacteria | 1064 |
| 589 | Ga0500644_0004961 | 3300053088 | Bacteria | 3347 |
| 590 | Ga0500651_0068605 | 3300053093 | Bacteria | 2208 |
| 591 | Ga0500651_0118336 | 3300053093 | Bacteria | 1611 |
| 592 | Ga0500566_0005930 | 3300053094 | Bacteria | 7266 |
| 593 | Ga0500555_000043 | 3300053103 | Bacteria | 64581 |
| 594 | Ga0500555_065950 | 3300053103 | Bacteria | 964 |
| 595 | Ga0500556_0000340 | 3300053104 | Bacteria | 34916 |
| 596 | Ga0500556_0003117 | 3300053104 | Bacteria | 4948 |
| 597 | Ga0500556_0009190 | 3300053104 | Bacteria | 2867 |
| 598 | Ga0500556_0010063 | 3300053104 | Bacteria | 2766 |
| 599 | Ga0500597_002992 | 3300053120 | Bacteria | 4860 |
| 600 | Ga0500607_006304 | 3300053121 | Bacteria | 7535 |
| 601 | Ga0500608_000212 | 3300053122 | Bacteria | 23229 |
| 602 | Ga0500608_044878 | 3300053122 | Bacteria | 2123 |
| 603 | Ga0500614_006597 | 3300053123 | Bacteria | 2439 |
| 604 | Ga0500642_0010358 | 3300053130 | Bacteria | 3283 |
| 605 | Ga0500652_142551 | 3300053131 | Bacteria | 997 |
| 606 | Ga0500658_0012952 | 3300053134 | Bacteria | 3080 |
| 607 | Ga0500559_0008092 | 3300053136 | Bacteria | 4627 |
| 608 | Ga0500559_0014883 | 3300053136 | Bacteria | 3287 |
| 609 | Ga0500559_0079482 | 3300053136 | Bacteria | 1489 |
| 610 | Ga0500559_0102753 | 3300053136 | Bacteria | 1318 |
| 611 | Ga0500577_0016437 | 3300053142 | Bacteria | 2333 |
| 612 | Ga0500590_000019 | 3300053148 | Bacteria | 44823 |
| 613 | Ga0500590_005685 | 3300053148 | Bacteria | 6015 |
| 614 | Ga0500622_0003674 | 3300053156 | Bacteria | 10072 |
| 615 | Ga0500624_000002 | 3300053157 | Bacteria | 257900 |
| 616 | Ga0500624_000437 | 3300053157 | Bacteria | 12611 |
| 617 | Ga0500627_0000024 | 3300053158 | Bacteria | 104034 |
| 618 | Ga0500627_0000971 | 3300053158 | Bacteria | 7770 |
| 619 | Ga0500627_0020249 | 3300053158 | Bacteria | 2665 |
| 620 | Ga0500639_022852 | 3300053163 | Bacteria | 3303 |
| 621 | Ga0500639_130109 | 3300053163 | Bacteria | 1194 |
| 622 | Ga0500637_0000186 | 3300053178 | Bacteria | 23129 |
| 623 | Ga0500570_029627 | 3300053724 | Bacteria | 2970 |
| 624 | Ga0500645_007445 | 3300053730 | Bacteria | 3810 |
| 625 | Ga0500596_001450 | 3300053735 | Bacteria | 4801 |
| 626 | Ga0500596_017818 | 3300053735 | Bacteria | 1065 |
| 627 | 2509151412 | 2508501128 | Bacteria | 8613869 |
| 628 | 2511124861 | 2510917020 | Bacteria | 5657507 |
| 629 | 2513677669 | 2513237098 | Bacteria | 9902361 |
| 630 | 2513696812 | 2513237101 | Bacteria | 7952346 |
| 631 | 2513863597 | 2513237137 | Bacteria | 9558895 |
| 632 | 2514012738 | 2513237161 | Bacteria | 8871253 |
| 633 | 2524441926 | 2524023205 | Bacteria | 8918781 |
| 634 | 2528848827 | 2528768022 | Bacteria | 10457665 |
| 635 | 2585154386 | 2582581280 | Bacteria | 5994497 |
| 636 | 2585197951 | 2582581293 | Bacteria | 5907401 |
| 637 | 2585261034 | 2582581305 | Bacteria | 4895574 |
| 638 | 2600202142 | 2599185354 | Bacteria | 4398675 |
| 639 | 2600204224 | 2599185354 | Bacteria | 4398675 |
| 640 | 2600227307 | 2599185359 | Bacteria | 4772316 |
| 641 | 2617375308 | 2617270741 | Bacteria | 8201522 |
| 642 | 2671118251 | 2667528175 | Bacteria | 7532676 |
| 643 | 2753767651 | 2751185897 | Bacteria | 5322941 |
| 644 | 2778125234 | 2775507255 | Bacteria | 3945731 |
| 645 | 2778125862 | 2775507255 | Bacteria | 3945731 |
| 646 | 2809063761 | 2808606401 | Bacteria | 4586670 |
| 647 | 2809065658 | 2808606401 | Bacteria | 4586670 |
| 648 | 2809079621 | 2808606404 | Bacteria | 4652788 |
| 649 | 2809081669 | 2808606404 | Bacteria | 4652788 |
| 650 | 2809083986 | 2808606405 | Bacteria | 4586632 |
| 651 | 2809086048 | 2808606405 | Bacteria | 4586632 |
| 652 | 2819553630 | 2818991438 | Bacteria | 5793701 |
| 653 | 2874605685 | 2874604998 | Bacteria | 7834745 |
| 654 | 2879108486 | 2879099564 | Bacteria | 10442239 |
| 655 | 2880519309 | 2880518877 | Bacteria | 5012590 |
| 656 | 2880520903 | 2880518877 | Bacteria | 5012590 |
| 657 | 2885379929 | 2885374607 | Bacteria | 8927485 |
| 658 | 2885416846 | 2885409591 | Bacteria | 9235467 |
| 659 | 2903775665 | 2903768456 | Bacteria | 9749579 |
| 660 | 2906617049 | |||
| 661 | 2919712246 | 2919709256 | Bacteria | 4318106 |
| 662 | 2922428859 | |||
| 663 | 2928104251 | 2928100450 | Bacteria | 4837635 |
| 664 | 2928104444 | 2928100450 | Bacteria | 4837635 |
| 665 | 2928529236 | 2928526807 | Bacteria | 4760224 |
| 666 | 2935813648 | 2935810662 | Bacteria | 9401221 |
| 667 | 2936042821 | 2936037263 | Bacteria | 9446081 |
| 668 | 3005597987 | 3005594810 | Bacteria | 8716512 |
| 669 | 8054305518 | 8054302542 | Bacteria | 5698134 |
| 670 | 8056677056 | 8056673599 | Bacteria | 7871253 |
| 671 | 8057105185 | 8057101203 | Bacteria | 5034064 |
| 672 | Ga0075363_100009589 | |||
| 673 | SwRhRL2b_contig_195601 | |||
| 674 | JGI24740J21852_10000086 | |||
| 675 | JGI24740J21852_10006157 | |||
| 676 | JGI24740J21852_10011901 | |||
| 677 | JGI24740J21852_10020475 | |||
| 678 | JGI24739J22299_10000303 | |||
| 679 | JGI24737J22298_10000127 | |||
| 680 | JGI24737J22298_10000793 | |||
| 681 | JGI24737J22298_10009384 | |||
| 682 | JGI24735J21928_10000302 | |||
| 683 | JGI24735J21928_10007017 | |||
| 684 | JGI24735J21928_10009083 | |||
| 685 | JGI24735J21928_10014034 | |||
| 686 | JGI24738J21930_10000028 | |||
| 687 | JGI24738J21930_10000183 | |||
| 688 | JGI24751J29686_10000331 | |||
| 689 | JGI25165J46597_1000010 | |||
| 690 | JGI25165J46597_1000109 | |||
| 691 | JGI25153J46596_10000007 | |||
| 692 | rootH1_10054095 | |||
| 693 | rootH1_10117209 | |||
| 694 | rootH2_10043023 | |||
| 695 | rootL2_10016666 | |||
| 696 | rootH1_10007994 | |||
| 697 | rootH1_10225907 | |||
| 698 | Ga0055542_1000115 | |||
| 699 | Ga0055529_1000052 | |||
| 700 | Ga0055536_1013449 | |||
| 701 | Ga0055530_10000249 | |||
| 702 | Ga0055531_10000008 | |||
| 703 | Ga0065704_10083051 | |||
| 704 | Ga0065704_10107146 | |||
| 705 | Ga0070658_10000088 | |||
| 706 | Ga0070658_10011856 | |||
| 707 | Ga0070658_10066477 | |||
| 708 | Ga0070658_10077023 | |||
| 709 | Ga0070658_10350541 | |||
| 710 | Ga0070683_100001387 | |||
| 711 | Ga0070683_100233947 | |||
| 712 | Ga0070670_100000563 | |||
| 713 | Ga0070670_100299953 | |||
| 714 | Ga0068868_100086391 | |||
| 715 | Ga0070660_100004577 | |||
| 716 | Ga0070660_100005553 | |||
| 717 | Ga0070660_100005665 | |||
| 718 | Ga0070660_100007802 | |||
| 719 | Ga0070661_100024423 | |||
| 720 | Ga0070661_100214368 | |||
| 721 | Ga0070692_10020889 | |||
| 722 | Ga0070668_100002984 | |||
| 723 | Ga0070668_100014600 | |||
| 724 | Ga0070668_100033908 | |||
| 725 | Ga0070668_100035177 | |||
| 726 | Ga0070668_100222786 | |||
| 727 | Ga0070669_100000048 | |||
| 728 | Ga0070669_100000192 | |||
| 729 | Ga0070671_100000065 | |||
| 730 | Ga0070674_100000013 | |||
| 731 | Ga0070673_100010293 | |||
| 732 | Ga0070659_100066717 | |||
| 733 | Ga0070659_100177053 | |||
| 734 | Ga0070667_100000523 | |||
| 735 | Ga0070667_100002964 | |||
| 736 | Ga0070667_100136887 | |||
| 737 | Ga0070662_100007482 | |||
| 738 | Ga0070662_100027094 | |||
| 739 | Ga0070662_100622271 | |||
| 740 | Ga0070681_10570207 | |||
| 741 | Ga0068867_100011083 | |||
| 742 | Ga0070679_100010488 | |||
| 743 | Ga0070679_100042614 | |||
| 744 | Ga0070679_100231733 | |||
| 745 | Ga0070679_100408132 | |||
| 746 | Ga0070684_100000637 | |||
| 747 | Ga0068853_100000373 | |||
| 748 | Ga0068853_100000873 | |||
| 749 | Ga0068853_100032735 | |||
| 750 | Ga0068853_100046492 | |||
| 751 | Ga0068853_100182241 | |||
| 752 | Ga0068853_100234434 | |||
| 753 | Ga0068853_100300156 | |||
| 754 | Ga0068853_100309836 | |||
| 755 | Ga0070672_100135211 | |||
| 756 | Ga0070665_100093895 | |||
| 757 | Ga0068855_100000173 | |||
| 758 | Ga0068855_100002262 | |||
| 759 | Ga0068855_100014300 | |||
| 760 | Ga0068855_100021485 | |||
| 761 | Ga0068855_100026215 | |||
| 762 | Ga0068855_100065454 | |||
| 763 | Ga0068855_100071857 | |||
| 764 | Ga0070664_100010514 | |||
| 765 | Ga0070664_100017462 | |||
| 766 | Ga0070664_100223355 | |||
| 767 | Ga0068857_100004617 | |||
| 768 | Ga0068857_100006948 | |||
| 769 | Ga0068857_100010210 | |||
| 770 | Ga0068857_100014446 | |||
| 771 | Ga0068857_100059197 | |||
| 772 | Ga0068857_100111605 | |||
| 773 | Ga0068857_100133017 | |||
| 774 | Ga0068854_100000071 | |||
| 775 | Ga0068854_100000295 | |||
| 776 | Ga0068854_100088992 | |||
| 777 | Ga0068854_100091762 | |||
| 778 | Ga0068854_100160548 | |||
| 779 | Ga0068854_100300419 | |||
| 780 | Ga0068856_100000785 | |||
| 781 | Ga0068856_100001545 | |||
| 782 | Ga0068852_100000060 | |||
| 783 | Ga0068852_100001458 | |||
| 784 | Ga0068852_100018212 | |||
| 785 | Ga0068852_100018586 | |||
| 786 | Ga0068852_100030161 | |||
| 787 | Ga0068852_100037350 | |||
| 788 | Ga0068859_100001206 | |||
| 789 | Ga0068859_100001920 | |||
| 790 | Ga0068859_100003753 | |||
| 791 | Ga0068859_100046142 | |||
| 792 | Ga0068859_100375687 | |||
| 793 | Ga0068864_100000109 | |||
| 794 | Ga0068861_100000017 | |||
| 795 | Ga0068861_100000124 | |||
| 796 | Ga0068861_100000201 | |||
| 797 | Ga0068861_100054709 | |||
| 798 | Ga0068851_10000666 | |||
| 799 | Ga0068863_100000168 | |||
| 800 | Ga0068863_100000403 | |||
| 801 | Ga0068863_100000936 | |||
| 802 | Ga0068858_100000104 | |||
| 803 | Ga0068858_100002215 | |||
| 804 | Ga0068860_100001426 | |||
| 805 | Ga0068860_100006530 | |||
| 806 | Ga0068860_100015898 | |||
| 807 | Ga0068860_100036308 | |||
| 808 | Ga0068862_100000128 | |||
| 809 | Ga0068862_100002200 | |||
| 810 | Ga0068862_100030459 | |||
| 811 | Ga0081539_10032076 | |||
| 812 | Ga0075365_10002107 | |||
| 813 | Ga0075365_10011285 | |||
| 814 | Ga0075365_10399349 | |||
| 815 | Ga0075368_10000046 | |||
| 816 | Ga0075368_10000089 | |||
| 817 | Ga0075368_10082395 | |||
| 818 | Ga0075363_100000664 | |||
| 819 | Ga0075364_10000007 | |||
| 820 | Ga0070712_100475232 | |||
| 821 | Ga0075362_10001665 | |||
| 822 | Ga0075367_10000037 | |||
| 823 | Ga0075367_10000962 | |||
| 824 | Ga0075369_10000954 | |||
| 825 | Ga0075369_10089962 | |||
| 826 | Ga0075366_10018330 | |||
| 827 | Ga0075370_10000371 | |||
| 828 | Ga0075370_10019290 | |||
| 829 | Ga0068865_100000006 | |||
| 830 | Ga0097620_100001206 | |||
| 831 | Ga0097620_100001920 | |||
| 832 | Ga0097620_100003753 | |||
| 833 | Ga0097620_100046142 | |||
| 834 | Ga0097620_100375664 | |||
| 835 | Ga0105251_10000132 | |||
| 836 | Ga0105250_10006219 | |||
| 837 | Ga0105240_10007247 | |||
| 838 | Ga0105240_10014342 | |||
| 839 | Ga0105240_10030377 | |||
| 840 | Ga0105240_10091495 | |||
| 841 | Ga0105243_10001647 | |||
| 842 | Ga0105241_10130703 | |||
| 843 | Ga0105248_10000561 | |||
| 844 | Ga0105248_10001759 | |||
| 845 | Ga0105248_10271489 | |||
| 846 | Ga0105237_10000378 | |||
| 847 | Ga0105237_10006024 | |||
| 848 | Ga0105237_10022170 | |||
| 849 | Ga0105237_10184277 | |||
| 850 | Ga0105237_10310984 | |||
| 851 | Ga0105238_10000647 | |||
| 852 | Ga0105238_10000912 | |||
| 853 | Ga0105238_10001356 | |||
| 854 | Ga0105238_10009276 | |||
| 855 | Ga0105238_10020241 | |||
| 856 | Ga0105238_10038255 | |||
| 857 | Ga0105238_10048636 | |||
| 858 | Ga0105249_10144289 | |||
| 859 | Ga0105148_100638 | |||
| 860 | Ga0105239_10000232 | |||
| 861 | Ga0105239_10005393 | |||
| 862 | Ga0105239_10009359 | |||
| 863 | Ga0105239_10010609 | |||
| 864 | Ga0157326_1000258 | |||
| 865 | Ga0157373_10002657 | |||
| 866 | Ga0157373_10157933 | |||
| 867 | Ga0157371_10001141 | |||
| 868 | Ga0157371_10003271 | |||
| 869 | Ga0157371_10032675 | |||
| 870 | Ga0157370_10000782 | |||
| 871 | Ga0157370_10001089 | |||
| 872 | Ga0157370_10006168 | |||
| 873 | Ga0157370_10006494 | |||
| 874 | Ga0157370_10044866 | |||
| 875 | Ga0157370_10057225 | |||
| 876 | Ga0157369_10000220 | |||
| 877 | Ga0157369_10000632 | |||
| 878 | Ga0157369_10003995 | |||
| 879 | Ga0157369_10007094 | |||
| 880 | Ga0157369_10009285 | |||
| 881 | Ga0157369_10017891 | |||
| 882 | Ga0157369_10027809 | |||
| 883 | Ga0157369_10094798 | |||
| 884 | Ga0157369_10156086 | |||
| 885 | Ga0157369_10234178 | |||
| 886 | Ga0157374_10009422 | |||
| 887 | Ga0157378_10000050 | |||
| 888 | Ga0157378_10607330 | |||
| 889 | Ga0163162_10000261 | |||
| 890 | Ga0163162_10001322 | |||
| 891 | Ga0163162_10005897 | |||
| 892 | Ga0157372_10001385 | |||
| 893 | Ga0157372_10003423 | |||
| 894 | Ga0157372_10004488 | |||
| 895 | Ga0157372_10333581 | |||
| 896 | Ga0157380_10000029 | |||
| 897 | Ga0157377_10207376 | |||
| 898 | Ga0157379_10003369 | |||
| 899 | Ga0163161_10045261 | |||
| 900 | Ga0163161_10072291 | |||
| 901 | Ga0163161_10093937 | |||
| 902 | Ga0214544_1009140 | |||
| 903 | Ga0209147_100482 | |||
| 904 | Ga0209563_100047 | |||
| 905 | Ga0209437_114980 | |||
| 906 | Ga0209148_1000011 | |||
| 907 | Ga0209233_1000044 | |||
| 908 | Ga0209233_1000167 | |||
| 909 | Ga0209233_1007274 | |||
| 910 | Ga0209233_1035826 | |||
| 911 | Ga0209455_1000006 | |||
| 912 | Ga0209676_1000077 | |||
| 913 | Ga0209758_1000017 | |||
| 914 | Ga0209050_1000026 | |||
| 915 | Ga0209050_1005513 | |||
| 916 | Ga0209257_1000009 | |||
| 917 | Ga0209257_1006476 | |||
| 918 | Ga0207697_10000315 | |||
| 919 | Ga0207697_10013988 | |||
| 920 | Ga0207656_10000058 | |||
| 921 | Ga0207696_1002176 | |||
| 922 | Ga0207713_1000224 | |||
| 923 | Ga0207713_1025534 | |||
| 924 | Ga0207647_10006429 | |||
| 925 | Ga0207647_10038705 | |||
| 926 | Ga0207705_10000071 | |||
| 927 | Ga0207705_10000138 | |||
| 928 | Ga0207705_10000266 | |||
| 929 | Ga0207705_10005208 | |||
| 930 | Ga0207705_10084091 | |||
| 931 | Ga0207705_10340541 | |||
| 932 | Ga0207705_10436713 | |||
| 933 | Ga0207654_10143323 | |||
| 934 | Ga0207707_10300551 | |||
| 935 | Ga0207695_10000525 | |||
| 936 | Ga0207695_10001920 | |||
| 937 | Ga0207695_10012067 | |||
| 938 | Ga0207695_10030763 | |||
| 939 | Ga0207695_10039507 | |||
| 940 | Ga0207695_10077854 | |||
| 941 | Ga0207695_10111809 | |||
| 942 | Ga0207671_10000222 | |||
| 943 | Ga0207671_10015756 | |||
| 944 | Ga0207671_10018414 | |||
| 945 | Ga0207660_10017144 | |||
| 946 | Ga0207660_10078180 | |||
| 947 | Ga0207657_10000020 | |||
| 948 | Ga0207657_10001528 | |||
| 949 | Ga0207657_10003535 | |||
| 950 | Ga0207657_10005598 | |||
| 951 | Ga0207657_10007994 | |||
| 952 | Ga0207657_10008495 | |||
| 953 | Ga0207657_10020437 | |||
| 954 | Ga0207657_10307044 | |||
| 955 | Ga0207649_10000034 | |||
| 956 | Ga0207649_10008333 | |||
| 957 | Ga0207649_10338543 | |||
| 958 | Ga0207652_10044778 | |||
| 959 | Ga0207652_10242056 | |||
| 960 | Ga0207681_10000037 | |||
| 961 | Ga0207681_10000050 | |||
| 962 | Ga0207694_10000611 | |||
| 963 | Ga0207694_10001992 | |||
| 964 | Ga0207694_10002066 | |||
| 965 | Ga0207694_10002827 | |||
| 966 | Ga0207694_10002967 | |||
| 967 | Ga0207694_10020108 | |||
| 968 | Ga0207694_10031448 | |||
| 969 | Ga0207694_10081805 | |||
| 970 | Ga0207650_10000039 | |||
| 971 | Ga0207650_10305267 | |||
| 972 | Ga0207644_10000045 | |||
| 973 | Ga0207644_10075999 | |||
| 974 | Ga0207706_10014734 | |||
| 975 | Ga0207706_10031349 | |||
| 976 | Ga0207709_10001104 | |||
| 977 | Ga0207669_10000011 | |||
| 978 | Ga0207704_10000022 | |||
| 979 | Ga0207691_10033497 | |||
| 980 | Ga0207711_10000676 | |||
| 981 | Ga0207711_10028349 | |||
| 982 | Ga0207711_10069242 | |||
| 983 | Ga0207711_10497729 | |||
| 984 | Ga0207689_10005004 | |||
| 985 | Ga0207661_10002993 | |||
| 986 | Ga0207679_10006486 | |||
| 987 | Ga0207667_10000001 | |||
| 988 | Ga0207667_10005828 | |||
| 989 | Ga0207667_10024820 | |||
| 990 | Ga0207667_10025344 | |||
| 991 | Ga0207667_10039581 | |||
| 992 | Ga0207667_10462769 | |||
| 993 | Ga0207667_10522872 | |||
| 994 | Ga0207667_10535213 | |||
| 995 | Ga0207651_10178717 | |||
| 996 | Ga0207651_10664857 | |||
| 997 | Ga0207712_10125847 | |||
| 998 | Ga0207668_10000055 | |||
| 999 | Ga0207668_10005353 | |||
| 1000 | Ga0207668_10005413 | |||
| 1001 | Ga0207668_10013328 | |||
| 1002 | Ga0207668_10051936 | |||
| 1003 | Ga0207668_10111769 | |||
| 1004 | Ga0207640_10000041 | |||
| 1005 | Ga0207640_10004501 | |||
| 1006 | Ga0207640_10012720 | |||
| 1007 | Ga0207640_10040536 | |||
| 1008 | Ga0207640_10081189 | |||
| 1009 | Ga0207640_10188531 | |||
| 1010 | Ga0207658_10001363 | |||
| 1011 | Ga0207658_10004471 | |||
| 1012 | Ga0207677_10000164 | |||
| 1013 | Ga0207703_10000136 | |||
| 1014 | Ga0207703_10002249 | |||
| 1015 | Ga0207703_10007960 | |||
| 1016 | Ga0207639_10000081 | |||
| 1017 | Ga0207639_10000779 | |||
| 1018 | Ga0207639_10005959 | |||
| 1019 | Ga0207639_10130019 | |||
| 1020 | Ga0207639_10147518 | |||
| 1021 | Ga0207639_10262181 | |||
| 1022 | Ga0207678_10043529 | |||
| 1023 | Ga0207678_10150495 | |||
| 1024 | Ga0207702_10000211 | |||
| 1025 | Ga0207702_10001302 | |||
| 1026 | Ga0207702_10030790 | |||
| 1027 | Ga0207641_10000165 | |||
| 1028 | Ga0207641_10000241 | |||
| 1029 | Ga0207641_10000504 | |||
| 1030 | Ga0207676_10000035 | |||
| 1031 | Ga0207674_10005761 | |||
| 1032 | Ga0207674_10008818 | |||
| 1033 | Ga0207674_10021570 | |||
| 1034 | Ga0207674_10037386 | |||
| 1035 | Ga0207674_10040705 | |||
| 1036 | Ga0207674_10055105 | |||
| 1037 | Ga0207674_10066239 | |||
| 1038 | Ga0207674_10108367 | |||
| 1039 | Ga0207674_10157292 | |||
| 1040 | Ga0207674_10227228 | |||
| 1041 | Ga0207675_100000018 | |||
| 1042 | Ga0207675_100000458 | |||
| 1043 | Ga0207675_100000462 | |||
| 1044 | Ga0207675_100232019 | |||
| 1045 | Ga0207698_10000054 | |||
| 1046 | Ga0207698_10001032 | |||
| 1047 | Ga0207698_10001871 | |||
| 1048 | Ga0207698_10012887 | |||
| 1049 | Ga0207698_10024017 | |||
| 1050 | Ga0207698_10151949 | |||
| 1051 | Ga0209813_10000050 | |||
| 1052 | Ga0209813_10000073 | |||
| 1053 | Ga0268266_10032876 | |||
| 1054 | Ga0268266_10566017 | |||
| 1055 | Ga0268265_10000102 | |||
| 1056 | Ga0268265_10002307 | |||
| 1057 | Ga0268265_10069645 | |||
| 1058 | Ga0268265_10115322 | |||
| 1059 | Ga0268264_10000154 | |||
| 1060 | Ga0268264_10001686 | |||
| 1061 | Ga0268264_10011539 | |||
| 1062 | Ga0268264_10024547 | |||
| 1063 | Ga0307517_10003177 | |||
| 1064 | Ga0307517_10045513 | |||
| 1065 | Ga0265338_10159120 | |||
| 1066 | Ga0307513_10479462 | |||
| 1067 | Ga0307408_100001033 | |||
| 1068 | Ga0307408_100001589 | |||
| 1069 | Ga0307408_100001936 | |||
| 1070 | Ga0307408_100039288 | |||
| 1071 | Ga0307405_10000583 | |||
| 1072 | Ga0307413_10001271 | |||
| 1073 | Ga0307406_10000490 | |||
| 1074 | Ga0307406_10007007 | |||
| 1075 | Ga0307412_10000525 | |||
| 1076 | Ga0307412_10028911 | |||
| 1077 | Ga0307412_10065507 | |||
| 1078 | Ga0307416_100040623 | |||
| 1079 | Ga0307414_10000135 | |||
| 1080 | Ga0307414_10073332 | |||
| 1081 | Ga0307411_10000688 | |||
| 1082 | Ga0307510_10005547 | |||
| 1083 | Ga0315911_1000002 | |||
| 1084 | Ga0373947_0202285 | |||
| 1085 | Ga0395899_0000366 | |||
| 1086 | Ga0395899_0000387 | |||
| 1087 | Ga0395899_0071151 | |||
| 1088 | Ga0395899_0124956 | |||
| 1089 | Ga0395900_0000130 | |||
| 1090 | Ga0395900_0000756 | |||
| 1091 | Ga0395900_0009767 | |||
| 1092 | Ga0395900_0039938 | |||
| 1093 | Ga0395900_0152989 | |||
| 1094 | Ga0395900_0189393 | |||
| 1095 | Ga0395900_0210964 | |||
| 1096 | Ga0395900_0218966 | |||
| 1097 | Ga0395900_0289144 | |||
| 1098 | Ga0395900_0310244 | |||
| 1099 | Ga0395900_0313680 | |||
| 1100 | Ga0395898_0000274 | |||
| 1101 | Ga0395898_0042237 | |||
| 1102 | Ga0395898_0070335 | |||
| 1103 | Ga0395898_0213805 | |||
| 1104 | Ga0395898_0448438 | |||
| 1105 | Ga0395905_0000287 | |||
| 1106 | Ga0395905_0002377 | |||
| 1107 | Ga0395905_0015566 | |||
| 1108 | Ga0395905_0061887 | |||
| 1109 | Ga0395905_0096184 | |||
| 1110 | Ga0395905_0124111 | |||
| 1111 | Ga0395905_0177307 | |||
| 1112 | Ga0395905_0296171 | |||
| 1113 | Ga0395905_0442758 | |||
| 1114 | Ga0395901_0000108 | |||
| 1115 | Ga0395901_0096916 | |||
| 1116 | Ga0395901_0145472 | |||
| 1117 | Ga0395901_0183378 | |||
| 1118 | Ga0395901_0253338 | |||
| 1119 | Ga0395901_0282625 | |||
| 1120 | Ga0395901_0491217 | |||
| 1121 | Ga0395901_0680481 | |||
| 1122 | Ga0237819_00451 | |||
| 1123 | Ga0237819_06546 | |||
| 1124 | Ga0450912_000046 | |||
| 1125 | Ga0450894_006902 | |||
| 1126 | Ga0450898_001596 | |||
| 1127 | Ga0439459_0003296 | |||
| 1128 | Ga0450893_0001915 | |||
| 1129 | Ga0466969_0111377 | |||
| 1130 | Ga0466957_0058378 | |||
| 1131 | Ga0495627_000409 | |||
| 1132 | Ga0495627_000883 | |||
| 1133 | Ga0495627_001643 | |||
| 1134 | Ga0495627_001780 | |||
| 1135 | Ga0495627_011562 | |||
| 1136 | Ga0495650_0001552 | |||
| 1137 | Ga0495650_0001944 | |||
| 1138 | Ga0495585_0144684 | |||
| 1139 | Ga0495583_0000120 | |||
| 1140 | Ga0495583_0050151 | |||
| 1141 | Ga0495606_0061141 | |||
| 1142 | Ga0495610_0000094 | |||
| 1143 | Ga0495610_0011765 | |||
| 1144 | Ga0495610_0028312 | |||
| 1145 | Ga0495616_0000009 | |||
| 1146 | Ga0495632_0001232 | |||
| 1147 | Ga0495637_0010985 | |||
| 1148 | Ga0495643_0000054 | |||
| 1149 | Ga0495643_0009112 | |||
| 1150 | Ga0495648_0011032 | |||
| 1151 | Ga0495648_0036330 | |||
| 1152 | Ga0495654_0017583 | |||
| 1153 | Ga0495633_0000054 | |||
| 1154 | Ga0495633_0000145 | |||
| 1155 | Ga0495633_0111085 | |||
| 1156 | Ga0495661_0139020 | |||
| 1157 | Ga0495687_000200 | |||
| 1158 | Ga0495677_0002742 | |||
| 1159 | Ga0495673_0000025 | |||
| 1160 | Ga0495681_0007128 | |||
| 1161 | Ga0495681_0053740 | |||
| 1162 | Ga0495686_0150308 | |||
| 1163 | Ga0495626_0005504 | |||
| 1164 | Ga0496100_0006587 | |||
| 1165 | Ga0496101_0038514 | |||
| 1166 | Ga0496104_0016538 | |||
| 1167 | Ga0496105_0002439 | |||
| 1168 | Ga0496105_0023910 | |||
| 1169 | Ga0496106_0440360 | |||
| 1170 | Ga0496110_0225406 | |||
| 1171 | Ga0496111_0016199 | |||
| 1172 | Ga0496111_0086353 | |||
| 1173 | Ga0496113_0075468 | |||
| 1174 | Ga0496115_0040957 | |||
| 1175 | Ga0496116_0003877 | |||
| 1176 | Ga0496116_0003989 | |||
| 1177 | Ga0496116_0068909 | |||
| 1178 | Ga0496117_0011550 | |||
| 1179 | Ga0496117_0170022 | |||
| 1180 | Ga0496118_0005823 | |||
| 1181 | Ga0496118_0109123 | |||
| 1182 | Ga0496118_0164981 | |||
| 1183 | Ga0496120_0033259 | |||
| 1184 | Ga0496120_0036230 | |||
| 1185 | Ga0496121_0000472 | |||
| 1186 | Ga0496121_0001255 | |||
| 1187 | Ga0496121_0001383 | |||
| 1188 | Ga0496121_0002146 | |||
| 1189 | Ga0496121_0140930 | |||
| 1190 | Ga0496121_0157741 | |||
| 1191 | Ga0496122_0001258 | |||
| 1192 | Ga0496122_0001624 | |||
| 1193 | Ga0496122_0001950 | |||
| 1194 | Ga0496122_0001993 | |||
| 1195 | Ga0496122_0043737 | |||
| 1196 | Ga0496123_0001440 | |||
| 1197 | Ga0496123_0001459 | |||
| 1198 | Ga0496123_0001523 | |||
| 1199 | Ga0496123_0002778 | |||
| 1200 | Ga0496123_0055943 | |||
| 1201 | Ga0496124_0000011 | |||
| 1202 | Ga0496124_0000188 | |||
| 1203 | Ga0496124_0001591 | |||
| 1204 | Ga0496124_0001870 | |||
| 1205 | Ga0496124_0004286 | |||
| 1206 | Ga0496124_0008338 | |||
| 1207 | Ga0496124_0009721 | |||
| 1208 | Ga0496124_0013548 | |||
| 1209 | Ga0496124_0043826 | |||
| 1210 | Ga0496124_0107628 | |||
| 1211 | Ga0496125_0001456 | |||
| 1212 | Ga0496125_0001686 | |||
| 1213 | Ga0496125_0033035 | |||
| 1214 | Ga0496125_0039537 | |||
| 1215 | Ga0496125_0084294 | |||
| 1216 | Ga0496125_0136047 | |||
| 1217 | Ga0496125_0218162 | |||
| 1218 | Ga0496126_0000041 | |||
| 1219 | Ga0496126_0000202 | |||
| 1220 | Ga0496126_0006033 | |||
| 1221 | Ga0496126_0023544 | |||
| 1222 | Ga0496126_0058871 | |||
| 1223 | Ga0496126_0067751 | |||
| 1224 | Ga0496126_0500496 | |||
| 1225 | Ga0495678_017497 | |||
| 1226 | Ga0501031_0179842 | |||
| 1227 | Ga0501034_0213687 | |||
| 1228 | Ga0501037_0195299 | |||
| 1229 | Ga0501038_0034087 | |||
| 1230 | Ga0501047_0065479 | |||
| 1231 | Ga0501047_0491454 | |||
| 1232 | Ga0501233_000039 | |||
| 1233 | Ga0501249_000069 | |||
| 1234 | Ga0501249_000114 | |||
| 1235 | Ga0501225_0014815 | |||
| 1236 | Ga0501035_0079249 | |||
| 1237 | Ga0501044_0011071 | |||
| 1238 | Ga0501044_0097444 | |||
| 1239 | Ga0501204_000619 | |||
| 1240 | Ga0501204_001691 | |||
| 1241 | Ga0501220_00697 | |||
| 1242 | nmdc:mga03683_161_c1 | |||
| 1243 | nmdc:mga03n38_287_c1 | |||
| 1244 | nmdc:mga00v17_29_c1 | |||
| 1245 | nmdc:mga0yw44_1026_c1 | |||
| 1246 | nmdc:mga0k408_17368_c1 | |||
| 1247 | nmdc:mga06z11_165_c1 | |||
| 1248 | nmdc:mga06z11_54_c1 | |||
| 1249 | nmdc:mga04h51_15_c1 | |||
| 1250 | nmdc:mga04h51_32_c1 | |||
| 1251 | nmdc:mga04h51_58946_c1 | |||
| 1252 | nmdc:mga07m45_128508_c1 | |||
| 1253 | nmdc:mga07m45_188505_c1 | |||
| 1254 | nmdc:mga07m45_5_c2 | |||
| 1255 | nmdc:mga07m45_71301_c1 | |||
| 1256 | nmdc:mga0sz30_1471_c1 | |||
| 1257 | Ga0500643_000090 | |||
| 1258 | Ga0500643_002703 | |||
| 1259 | Ga0500643_060487 | |||
| 1260 | Ga0500644_0004961 | |||
| 1261 | Ga0500651_0068605 | |||
| 1262 | Ga0500651_0118336 | |||
| 1263 | Ga0500566_0005930 | |||
| 1264 | Ga0500555_000043 | |||
| 1265 | Ga0500555_065950 | |||
| 1266 | Ga0500556_0000340 | |||
| 1267 | Ga0500556_0003117 | |||
| 1268 | Ga0500556_0009190 | |||
| 1269 | Ga0500556_0010063 | |||
| 1270 | Ga0500597_002992 | |||
| 1271 | Ga0500607_006304 | |||
| 1272 | Ga0500608_000212 | |||
| 1273 | Ga0500608_044878 | |||
| 1274 | Ga0500614_006597 | |||
| 1275 | Ga0500642_0010358 | |||
| 1276 | Ga0500652_142551 | |||
| 1277 | Ga0500658_0012952 | |||
| 1278 | Ga0500559_0008092 | |||
| 1279 | Ga0500559_0014883 | |||
| 1280 | Ga0500559_0079482 | |||
| 1281 | Ga0500559_0102753 | |||
| 1282 | Ga0500577_0016437 | |||
| 1283 | Ga0500590_000019 | |||
| 1284 | Ga0500590_005685 | |||
| 1285 | Ga0500622_0003674 | |||
| 1286 | Ga0500624_000002 | |||
| 1287 | Ga0500624_000437 | |||
| 1288 | Ga0500627_0000024 | |||
| 1289 | Ga0500627_0000971 | |||
| 1290 | Ga0500627_0020249 | |||
| 1291 | Ga0500639_022852 | |||
| 1292 | Ga0500639_130109 | |||
| 1293 | Ga0500637_0000186 | |||
| 1294 | Ga0500570_029627 | |||
| 1295 | Ga0500645_007445 | |||
| 1296 | Ga0500596_001450 | |||
| 1297 | Ga0500596_017818 | |||
| 1298 | 2509151412 | |||
| 1299 | 2511124861 | |||
| 1300 | 2513677669 | |||
| 1301 | 2513696812 | |||
| 1302 | 2513863597 | |||
| 1303 | 2514012738 | |||
| 1304 | 2524441926 | |||
| 1305 | 2528848827 | |||
| 1306 | 2585154386 | |||
| 1307 | 2585197951 | |||
| 1308 | 2585261034 | |||
| 1309 | 2600202142 | |||
| 1310 | 2600204224 | |||
| 1311 | 2600227307 | |||
| 1312 | 2617375308 | |||
| 1313 | 2671118251 | |||
| 1314 | 2753767651 | |||
| 1315 | 2778125234 | |||
| 1316 | 2778125862 | |||
| 1317 | 2809063761 | |||
| 1318 | 2809065658 | |||
| 1319 | 2809079621 | |||
| 1320 | 2809081669 | |||
| 1321 | 2809083986 | |||
| 1322 | 2809086048 | |||
| 1323 | 2819553630 | |||
| 1324 | 2874605685 | |||
| 1325 | 2879108486 | |||
| 1326 | 2880519309 | |||
| 1327 | 2880520903 | |||
| 1328 | 2885379929 | |||
| 1329 | 2885416846 | |||
| 1330 | 2903775665 | |||
| 1331 | 2906617049 | |||
| 1332 | 2919712246 | |||
| 1333 | 2922428859 | |||
| 1334 | 2928104251 | |||
| 1335 | 2928104444 | |||
| 1336 | 2928529236 | |||
| 1337 | 2935813648 | |||
| 1338 | 2936042821 | |||
| 1339 | 3005597987 | |||
| 1340 | 8054305518 | |||
| 1341 | 8056677056 | |||
| 1342 | 8057105185 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1q6w-assembly2.cif.gz_C | x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius | 0.8669 | 159 | 199 |
| 4mei-assembly1.cif.gz_A-2 | crystal structure of a virb8 type iv secretion system machinery soluble domain from bartonella tribocorum | 0.8524 | 98 | 231 |
| 2bhm-assembly2.cif.gz_D | crystal structure of virb8 from brucella suis | 0.8495 | 105 | 230 |
| 4kz1-assembly1.cif.gz_A-2 | crystal structure of the soluble domain of virb8 from bartonella grahamii | 0.8479 | 98 | 230 |
| 7q1v-assembly1.cif.gz_D | arches protomer (trimer of trwg/virb8peri) structure from the fully-assembled r388 type iv secretion system determined by cryo-em. | 0.8474 | 103 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O01913_702_992_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.9542 | 157 | 195 | 3.90.190.10 |
| 4akzD00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.8522 | 105 | 230 | 3.10.450.230 |
| 4kz1A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.8479 | 98 | 230 | 3.10.450.230 |
| 4kz1A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.8305 | 98 | 230 | 3.10.450.230 |
| 2cc3B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein | 0.8133 | 96 | 232 | 3.10.450.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E4QS16-F1-model_v4 | Conjugal transfer protein TrbF | 0.992 | 100 | 232 |
GO:0016020
|
| AF-A0A259JT73-F1-model_v4 | Conjugal transfer protein TrbF | 0.9917 | 162 | 232 |
GO:0012505
GO:0016020 |
| AF-A0A511XP97-F1-model_v4 | Bacterial virulence protein VirB8 domain-containing protein | 0.9792 | 167 | 232 |
GO:0016020
|
| AF-A0A2E4QS16-F1-model_v4 | Conjugal transfer protein TrbF | 0.9774 | 100 | 232 |
GO:0016020
|
| AF-A0A3D9X8D8-F1-model_v4 | VirB8 protein | 0.9715 | 115 | 197 |
GO:0016020
|