F474146

General Info

Members Datasets Scaffolds Average Seq Length
671 300 1342 259

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100009589|Ga0075363_1000095893
Length 264
Sequence MIFKRAVQRYGRTPQPETPYQRAGQLWDERIGSARVQARNWRLMAFGTLTLTCAMSGALIWQSLQSRVTPYEVDRLGEARAVTEAEAGYKPTDPQVAWHLAKFIENVRGISLDPVLMRRDWLSAYGFVTDRGARFLDDYARAADPFAGIGERTVSVQVTSVVRASDRSFQVKWTETAYERGSEAGSSHWTGILTIVTKPPVSADTLRKNPLGIYVDAIDWSRELEAPATTAVPRTPSPPSNLPLGSPLDPNLAAHPPVKTETQP

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
171 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
172 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
173 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
229 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
248 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
257 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
258 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
259 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
260 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
263 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
264 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
265 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
266 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
267 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
268 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
269 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
270 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
271 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
272 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
273 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
274 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
275 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
276 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
277 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
278 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
279 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
280 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
281 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
282 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
283 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
284 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
285 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
286 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
287 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
288 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
289 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
290 2906610324
291 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
292 2922425934
293 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
294 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
295 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
296 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
297 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
298 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
299 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
300 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.57
Metatranscriptomes 0
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.61
Nodule 2.38
Rhizoplane 2.24
Rhizosphere 70.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100009589 3300006048 Bacteria 4557
2 SwRhRL2b_contig_195601 2162886007 Bacteria 6790
3 JGI24740J21852_10000086 3300001979 Bacteria 32047
4 JGI24740J21852_10006157 3300001979 Bacteria 5004
5 JGI24740J21852_10011901 3300001979 Bacteria 3298
6 JGI24740J21852_10020475 3300001979 Bacteria 2306
7 JGI24739J22299_10000303 3300001989 Bacteria 16724
8 JGI24737J22298_10000127 3300001990 Bacteria 23226
9 JGI24737J22298_10000793 3300001990 Bacteria 11195
10 JGI24737J22298_10009384 3300001990 Bacteria 3258
11 JGI24735J21928_10000302 3300002067 Bacteria 17212
12 JGI24735J21928_10007017 3300002067 Bacteria 3682
13 JGI24735J21928_10009083 3300002067 Bacteria 3199
14 JGI24735J21928_10014034 3300002067 Bacteria 2512
15 JGI24738J21930_10000028 3300002075 Bacteria 27115
16 JGI24738J21930_10000183 3300002075 Bacteria 16183
17 JGI24751J29686_10000331 3300002459 Bacteria 17241
18 JGI25165J46597_1000010 3300003214 Bacteria 442113
19 JGI25165J46597_1000109 3300003214 Bacteria 149484
20 JGI25153J46596_10000007 3300003215 Bacteria 377573
21 rootH1_10054095 3300003316 Bacteria 5285
22 rootH1_10117209 3300003316 Bacteria 3308
23 rootH2_10043023 3300003320 Bacteria 6510
24 rootL2_10016666 3300003322 Bacteria 1779
25 rootH1_10007994 3300003323 Bacteria 4824
26 rootH1_10225907 3300003323 Bacteria 2560
27 Ga0055542_1000115 3300003762 Bacteria 106506
28 Ga0055529_1000052 3300003763 Bacteria 203029
29 Ga0055536_1013449 3300003781 Bacteria 2951
30 Ga0055530_10000249 3300003791 Bacteria 48825
31 Ga0055531_10000008 3300003794 Bacteria 222269
32 Ga0065704_10083051 3300005289 Bacteria 3515
33 Ga0065704_10107146 3300005289 Bacteria 2063
34 Ga0070658_10000088 3300005327 Bacteria 85441
35 Ga0070658_10011856 3300005327 Bacteria 6998
36 Ga0070658_10066477 3300005327 Bacteria 2945
37 Ga0070658_10077023 3300005327 Bacteria 2735
38 Ga0070658_10350541 3300005327 Bacteria 1263
39 Ga0070683_100001387 3300005329 Bacteria 18596
40 Ga0070683_100233947 3300005329 Bacteria 1747
41 Ga0070670_100000563 3300005331 Bacteria 29384
42 Ga0070670_100299953 3300005331 Bacteria 1405
43 Ga0068868_100086391 3300005338 Bacteria 2521
44 Ga0070660_100004577 3300005339 Bacteria 9559
45 Ga0070660_100005553 3300005339 Bacteria 8736
46 Ga0070660_100005665 3300005339 Bacteria 8654
47 Ga0070660_100007802 3300005339 Bacteria 7465
48 Ga0070661_100024423 3300005344 Bacteria 4335
49 Ga0070661_100214368 3300005344 Bacteria 1475
50 Ga0070692_10020889 3300005345 Bacteria 3179
51 Ga0070668_100002984 3300005347 Bacteria 12515
52 Ga0070668_100014600 3300005347 Bacteria 5871
53 Ga0070668_100033908 3300005347 Bacteria 3890
54 Ga0070668_100035177 3300005347 Bacteria 3819
55 Ga0070668_100222786 3300005347 Bacteria 1556
56 Ga0070669_100000048 3300005353 Bacteria 118472
57 Ga0070669_100000192 3300005353 Bacteria 53873
58 Ga0070671_100000065 3300005355 Bacteria 71901
59 Ga0070674_100000013 3300005356 Bacteria 121838
60 Ga0070673_100010293 3300005364 Bacteria 6327
61 Ga0070659_100066717 3300005366 Bacteria 2852
62 Ga0070659_100177053 3300005366 Bacteria 1749
63 Ga0070667_100000523 3300005367 Bacteria 38602
64 Ga0070667_100002964 3300005367 Bacteria 14592
65 Ga0070667_100136887 3300005367 Bacteria 2142
66 Ga0070662_100007482 3300005457 Bacteria 7083
67 Ga0070662_100027094 3300005457 Bacteria 3975
68 Ga0070662_100622271 3300005457 Bacteria 909
69 Ga0070681_10570207 3300005458 Bacteria 1046
70 Ga0068867_100011083 3300005459 Bacteria 6360
71 Ga0070679_100010488 3300005530 Bacteria 8790
72 Ga0070679_100042614 3300005530 Bacteria 4521
73 Ga0070679_100231733 3300005530 Bacteria 1806
74 Ga0070679_100408132 3300005530 Bacteria 1304
75 Ga0070684_100000637 3300005535 Bacteria 24083
76 Ga0068853_100000373 3300005539 Bacteria 30758
77 Ga0068853_100000873 3300005539 Bacteria 21069
78 Ga0068853_100032735 3300005539 Bacteria 4406
79 Ga0068853_100046492 3300005539 Bacteria 3722
80 Ga0068853_100182241 3300005539 Bacteria 1905
81 Ga0068853_100234434 3300005539 Bacteria 1680
82 Ga0068853_100300156 3300005539 Bacteria 1484
83 Ga0068853_100309836 3300005539 Bacteria 1461
84 Ga0070672_100135211 3300005543 Bacteria 2030
85 Ga0070665_100093895 3300005548 Bacteria 3005
86 Ga0068855_100000173 3300005563 Bacteria 82962
87 Ga0068855_100002262 3300005563 Bacteria 23756
88 Ga0068855_100014300 3300005563 Bacteria 9557
89 Ga0068855_100021485 3300005563 Bacteria 7739
90 Ga0068855_100026215 3300005563 Bacteria 6974
91 Ga0068855_100065454 3300005563 Bacteria 4238
92 Ga0068855_100071857 3300005563 Bacteria 4022
93 Ga0070664_100010514 3300005564 Bacteria 7500
94 Ga0070664_100017462 3300005564 Bacteria 5892
95 Ga0070664_100223355 3300005564 Bacteria 1686
96 Ga0068857_100004617 3300005577 Bacteria 11667
97 Ga0068857_100006948 3300005577 Bacteria 9739
98 Ga0068857_100010210 3300005577 Bacteria 8164
99 Ga0068857_100014446 3300005577 Bacteria 6888
100 Ga0068857_100059197 3300005577 Bacteria 3402
101 Ga0068857_100111605 3300005577 Bacteria 2458
102 Ga0068857_100133017 3300005577 Bacteria 2244
103 Ga0068854_100000071 3300005578 Bacteria 73211
104 Ga0068854_100000295 3300005578 Bacteria 33183
105 Ga0068854_100088992 3300005578 Bacteria 2294
106 Ga0068854_100091762 3300005578 Bacteria 2261
107 Ga0068854_100160548 3300005578 Bacteria 1740
108 Ga0068854_100300419 3300005578 Bacteria 1298
109 Ga0068856_100000785 3300005614 Bacteria 34421
110 Ga0068856_100001545 3300005614 Bacteria 24115
111 Ga0068852_100000060 3300005616 Bacteria 73764
112 Ga0068852_100001458 3300005616 Bacteria 15978
113 Ga0068852_100018212 3300005616 Bacteria 5530
114 Ga0068852_100018586 3300005616 Bacteria 5479
115 Ga0068852_100030161 3300005616 Bacteria 4461
116 Ga0068852_100037350 3300005616 Bacteria 4071
117 Ga0068859_100001206 3300005617 Bacteria 26384
118 Ga0068859_100001920 3300005617 Bacteria 21196
119 Ga0068859_100003753 3300005617 Bacteria 15492
120 Ga0068859_100046142 3300005617 Bacteria 4377
121 Ga0068859_100375687 3300005617 Bacteria 1517
122 Ga0068864_100000109 3300005618 Bacteria 80156
123 Ga0068861_100000017 3300005719 Bacteria 78362
124 Ga0068861_100000124 3300005719 Bacteria 39677
125 Ga0068861_100000201 3300005719 Bacteria 31934
126 Ga0068861_100054709 3300005719 Bacteria 3041
127 Ga0068851_10000666 3300005834 Bacteria 14670
128 Ga0068863_100000168 3300005841 Bacteria 70935
129 Ga0068863_100000403 3300005841 Bacteria 44004
130 Ga0068863_100000936 3300005841 Bacteria 29333
131 Ga0068858_100000104 3300005842 Bacteria 88260
132 Ga0068858_100002215 3300005842 Bacteria 19678
133 Ga0068860_100001426 3300005843 Bacteria 25889
134 Ga0068860_100006530 3300005843 Bacteria 11707
135 Ga0068860_100015898 3300005843 Bacteria 7345
136 Ga0068860_100036308 3300005843 Bacteria 4723
137 Ga0068862_100000128 3300005844 Bacteria 88625
138 Ga0068862_100002200 3300005844 Bacteria 17498
139 Ga0068862_100030459 3300005844 Bacteria 4548
140 Ga0081539_10032076 3300005985 Bacteria 3223
141 Ga0075365_10002107 3300006038 Bacteria 9518
142 Ga0075365_10011285 3300006038 Bacteria 5248
143 Ga0075365_10399349 3300006038 Bacteria 970
144 Ga0075368_10000046 3300006042 Bacteria 29118
145 Ga0075368_10000089 3300006042 Bacteria 22773
146 Ga0075368_10082395 3300006042 Bacteria 1310
147 Ga0075363_100000664 3300006048 Bacteria 11479
148 Ga0075364_10000007 3300006051 Bacteria 73806
149 Ga0070712_100475232 3300006175 Bacteria 1044
150 Ga0075362_10001665 3300006177 Bacteria 7207
151 Ga0075367_10000037 3300006178 Bacteria 29457
152 Ga0075367_10000962 3300006178 Bacteria 11762
153 Ga0075369_10000954 3300006186 Bacteria 9628
154 Ga0075369_10089962 3300006186 Bacteria 1369
155 Ga0075366_10018330 3300006195 Bacteria 4040
156 Ga0075370_10000371 3300006353 Bacteria 16477
157 Ga0075370_10019290 3300006353 Bacteria 3713
158 Ga0068865_100000006 3300006881 Bacteria 201186
159 Ga0097620_100001206 3300006931 Bacteria 26384
160 Ga0097620_100001920 3300006931 Bacteria 21196
161 Ga0097620_100003753 3300006931 Bacteria 15492
162 Ga0097620_100046142 3300006931 Bacteria 4377
163 Ga0097620_100375664 3300006931 Bacteria 1517
164 Ga0105251_10000132 3300009011 Bacteria 75189
165 Ga0105250_10006219 3300009092 Bacteria 5241
166 Ga0105240_10007247 3300009093 Bacteria 16146
167 Ga0105240_10014342 3300009093 Bacteria 10823
168 Ga0105240_10030377 3300009093 Bacteria 7023
169 Ga0105240_10091495 3300009093 Bacteria 3716
170 Ga0105243_10001647 3300009148 Bacteria 19389
171 Ga0105241_10130703 3300009174 Bacteria 2032
172 Ga0105248_10000561 3300009177 Bacteria 42112
173 Ga0105248_10001759 3300009177 Bacteria 24104
174 Ga0105248_10271489 3300009177 Bacteria 1910
175 Ga0105237_10000378 3300009545 Bacteria 63407
176 Ga0105237_10006024 3300009545 Bacteria 13569
177 Ga0105237_10022170 3300009545 Bacteria 6517
178 Ga0105237_10184277 3300009545 Bacteria 2088
179 Ga0105237_10310984 3300009545 Bacteria 1579
180 Ga0105238_10000647 3300009551 Bacteria 36611
181 Ga0105238_10000912 3300009551 Bacteria 30323
182 Ga0105238_10001356 3300009551 Bacteria 24564
183 Ga0105238_10009276 3300009551 Bacteria 9848
184 Ga0105238_10020241 3300009551 Bacteria 6772
185 Ga0105238_10038255 3300009551 Bacteria 4872
186 Ga0105238_10048636 3300009551 Bacteria 4273
187 Ga0105249_10144289 3300009553 Bacteria 2286
188 Ga0105148_100638 3300009978 Bacteria 2854
189 Ga0105239_10000232 3300010375 Bacteria 82037
190 Ga0105239_10005393 3300010375 Bacteria 15012
191 Ga0105239_10009359 3300010375 Bacteria 11057
192 Ga0105239_10010609 3300010375 Bacteria 10304
193 Ga0157326_1000258 3300012513 Bacteria 6193
194 Ga0157373_10002657 3300013100 Bacteria 13561
195 Ga0157373_10157933 3300013100 Bacteria 1595
196 Ga0157371_10001141 3300013102 Bacteria 28613
197 Ga0157371_10003271 3300013102 Bacteria 14854
198 Ga0157371_10032675 3300013102 Bacteria 3743
199 Ga0157370_10000782 3300013104 Bacteria 39909
200 Ga0157370_10001089 3300013104 Bacteria 34040
201 Ga0157370_10006168 3300013104 Bacteria 13298
202 Ga0157370_10006494 3300013104 Bacteria 12882
203 Ga0157370_10044866 3300013104 Bacteria 4245
204 Ga0157370_10057225 3300013104 Bacteria 3709
205 Ga0157369_10000220 3300013105 Bacteria 79213
206 Ga0157369_10000632 3300013105 Bacteria 45648
207 Ga0157369_10003995 3300013105 Bacteria 17496
208 Ga0157369_10007094 3300013105 Bacteria 12922
209 Ga0157369_10009285 3300013105 Bacteria 11249
210 Ga0157369_10017891 3300013105 Bacteria 7956
211 Ga0157369_10027809 3300013105 Bacteria 6265
212 Ga0157369_10094798 3300013105 Bacteria 3186
213 Ga0157369_10156086 3300013105 Bacteria 2410
214 Ga0157369_10234178 3300013105 Bacteria 1919
215 Ga0157374_10009422 3300013296 Bacteria 8381
216 Ga0157378_10000050 3300013297 Bacteria 102138
217 Ga0157378_10607330 3300013297 Bacteria 1106
218 Ga0163162_10000261 3300013306 Bacteria 48037
219 Ga0163162_10001322 3300013306 Bacteria 23153
220 Ga0163162_10005897 3300013306 Bacteria 11850
221 Ga0157372_10001385 3300013307 Bacteria 26160
222 Ga0157372_10003423 3300013307 Bacteria 17122
223 Ga0157372_10004488 3300013307 Bacteria 14886
224 Ga0157372_10333581 3300013307 Bacteria 1766
225 Ga0157380_10000029 3300014326 Bacteria 98248
226 Ga0157377_10207376 3300014745 Bacteria 1248
227 Ga0157379_10003369 3300014968 Bacteria 13521
228 Ga0163161_10045261 3300017792 Bacteria 3173
229 Ga0163161_10072291 3300017792 Bacteria 2525
230 Ga0163161_10093937 3300017792 Bacteria 2223
231 Ga0214544_1009140 3300021320 Bacteria 15797
232 Ga0209147_100482 3300025229 Bacteria 24036
233 Ga0209563_100047 3300025230 Bacteria 366620
234 Ga0209437_114980 3300025233 Bacteria 1068
235 Ga0209148_1000011 3300025254 Bacteria 1196503
236 Ga0209233_1000044 3300025261 Bacteria 489783
237 Ga0209233_1000167 3300025261 Bacteria 149536
238 Ga0209233_1007274 3300025261 Bacteria 3516
239 Ga0209233_1035826 3300025261 Bacteria 1117
240 Ga0209455_1000006 3300025272 Bacteria 1196503
241 Ga0209676_1000077 3300025292 Bacteria 298831
242 Ga0209758_1000017 3300025297 Bacteria 754393
243 Ga0209050_1000026 3300025298 Bacteria 499134
244 Ga0209050_1005513 3300025298 Bacteria 7909
245 Ga0209257_1000009 3300025304 Bacteria 1205047
246 Ga0209257_1006476 3300025304 Bacteria 7514
247 Ga0207697_10000315 3300025315 Bacteria 27117
248 Ga0207697_10013988 3300025315 Bacteria 3340
249 Ga0207656_10000058 3300025321 Bacteria 43858
250 Ga0207696_1002176 3300025711 Bacteria 9828
251 Ga0207713_1000224 3300025735 Bacteria 76504
252 Ga0207713_1025534 3300025735 Bacteria 2725
253 Ga0207647_10006429 3300025904 Bacteria 8541
254 Ga0207647_10038705 3300025904 Bacteria 3014
255 Ga0207705_10000071 3300025909 Bacteria 128862
256 Ga0207705_10000138 3300025909 Bacteria 78969
257 Ga0207705_10000266 3300025909 Bacteria 50282
258 Ga0207705_10005208 3300025909 Bacteria 9749
259 Ga0207705_10084091 3300025909 Bacteria 2323
260 Ga0207705_10340541 3300025909 Bacteria 1154
261 Ga0207705_10436713 3300025909 Bacteria 1014
262 Ga0207654_10143323 3300025911 Bacteria 1526
263 Ga0207707_10300551 3300025912 Bacteria 1388
264 Ga0207695_10000525 3300025913 Bacteria 81111
265 Ga0207695_10001920 3300025913 Bacteria 32321
266 Ga0207695_10012067 3300025913 Bacteria 10387
267 Ga0207695_10030763 3300025913 Bacteria 5906
268 Ga0207695_10039507 3300025913 Bacteria 5072
269 Ga0207695_10077854 3300025913 Bacteria 3366
270 Ga0207695_10111809 3300025913 Bacteria 2710
271 Ga0207671_10000222 3300025914 Bacteria 85244
272 Ga0207671_10015756 3300025914 Bacteria 5904
273 Ga0207671_10018414 3300025914 Bacteria 5358
274 Ga0207660_10017144 3300025917 Bacteria 4806
275 Ga0207660_10078180 3300025917 Bacteria 2424
276 Ga0207657_10000020 3300025919 Bacteria 157826
277 Ga0207657_10001528 3300025919 Bacteria 24769
278 Ga0207657_10003535 3300025919 Bacteria 16692
279 Ga0207657_10005598 3300025919 Bacteria 13118
280 Ga0207657_10007994 3300025919 Bacteria 10785
281 Ga0207657_10008495 3300025919 Bacteria 10416
282 Ga0207657_10020437 3300025919 Bacteria 6257
283 Ga0207657_10307044 3300025919 Bacteria 1256
284 Ga0207649_10000034 3300025920 Bacteria 136049
285 Ga0207649_10008333 3300025920 Bacteria 5650
286 Ga0207649_10338543 3300025920 Bacteria 1110
287 Ga0207652_10044778 3300025921 Bacteria 3771
288 Ga0207652_10242056 3300025921 Bacteria 1626
289 Ga0207681_10000037 3300025923 Bacteria 154417
290 Ga0207681_10000050 3300025923 Bacteria 118481
291 Ga0207694_10000611 3300025924 Bacteria 32401
292 Ga0207694_10001992 3300025924 Bacteria 16904
293 Ga0207694_10002066 3300025924 Bacteria 16586
294 Ga0207694_10002827 3300025924 Bacteria 14002
295 Ga0207694_10002967 3300025924 Bacteria 13625
296 Ga0207694_10020108 3300025924 Bacteria 5050
297 Ga0207694_10031448 3300025924 Bacteria 4054
298 Ga0207694_10081805 3300025924 Bacteria 2537
299 Ga0207650_10000039 3300025925 Bacteria 204737
300 Ga0207650_10305267 3300025925 Bacteria 1301
301 Ga0207644_10000045 3300025931 Bacteria 105495
302 Ga0207644_10075999 3300025931 Bacteria 2470
303 Ga0207706_10014734 3300025933 Bacteria 7081
304 Ga0207706_10031349 3300025933 Bacteria 4737
305 Ga0207709_10001104 3300025935 Bacteria 19781
306 Ga0207669_10000011 3300025937 Bacteria 142774
307 Ga0207704_10000022 3300025938 Bacteria 146109
308 Ga0207691_10033497 3300025940 Bacteria 4783
309 Ga0207711_10000676 3300025941 Bacteria 33882
310 Ga0207711_10028349 3300025941 Bacteria 4711
311 Ga0207711_10069242 3300025941 Bacteria 3058
312 Ga0207711_10497729 3300025941 Bacteria 1136
313 Ga0207689_10005004 3300025942 Bacteria 11936
314 Ga0207661_10002993 3300025944 Bacteria 11688
315 Ga0207679_10006486 3300025945 Bacteria 7398
316 Ga0207667_10000001 3300025949 Bacteria 1178522
317 Ga0207667_10005828 3300025949 Bacteria 15013
318 Ga0207667_10024820 3300025949 Bacteria 6573
319 Ga0207667_10025344 3300025949 Bacteria 6493
320 Ga0207667_10039581 3300025949 Bacteria 5024
321 Ga0207667_10462769 3300025949 Bacteria 1288
322 Ga0207667_10522872 3300025949 Bacteria 1202
323 Ga0207667_10535213 3300025949 Bacteria 1186
324 Ga0207651_10178717 3300025960 Bacteria 1681
325 Ga0207651_10664857 3300025960 Bacteria 915
326 Ga0207712_10125847 3300025961 Bacteria 1945
327 Ga0207668_10000055 3300025972 Bacteria 94786
328 Ga0207668_10005353 3300025972 Bacteria 7548
329 Ga0207668_10005413 3300025972 Bacteria 7520
330 Ga0207668_10013328 3300025972 Bacteria 5058
331 Ga0207668_10051936 3300025972 Bacteria 2834
332 Ga0207668_10111769 3300025972 Bacteria 2051
333 Ga0207640_10000041 3300025981 Bacteria 105374
334 Ga0207640_10004501 3300025981 Bacteria 7561
335 Ga0207640_10012720 3300025981 Bacteria 4802
336 Ga0207640_10040536 3300025981 Bacteria 2955
337 Ga0207640_10081189 3300025981 Bacteria 2216
338 Ga0207640_10188531 3300025981 Bacteria 1552
339 Ga0207658_10001363 3300025986 Bacteria 19075
340 Ga0207658_10004471 3300025986 Bacteria 9718
341 Ga0207677_10000164 3300026023 Bacteria 52688
342 Ga0207703_10000136 3300026035 Bacteria 89612
343 Ga0207703_10002249 3300026035 Bacteria 16867
344 Ga0207703_10007960 3300026035 Bacteria 8377
345 Ga0207639_10000081 3300026041 Bacteria 82747
346 Ga0207639_10000779 3300026041 Bacteria 21675
347 Ga0207639_10005959 3300026041 Bacteria 8269
348 Ga0207639_10130019 3300026041 Bacteria 2083
349 Ga0207639_10147518 3300026041 Bacteria 1967
350 Ga0207639_10262181 3300026041 Bacteria 1512
351 Ga0207678_10043529 3300026067 Bacteria 3885
352 Ga0207678_10150495 3300026067 Bacteria 1987
353 Ga0207702_10000211 3300026078 Bacteria 69152
354 Ga0207702_10001302 3300026078 Bacteria 24991
355 Ga0207702_10030790 3300026078 Bacteria 4470
356 Ga0207641_10000165 3300026088 Bacteria 93436
357 Ga0207641_10000241 3300026088 Bacteria 71027
358 Ga0207641_10000504 3300026088 Bacteria 43890
359 Ga0207676_10000035 3300026095 Bacteria 204737
360 Ga0207674_10005761 3300026116 Bacteria 14694
361 Ga0207674_10008818 3300026116 Bacteria 11607
362 Ga0207674_10021570 3300026116 Bacteria 6934
363 Ga0207674_10037386 3300026116 Bacteria 5049
364 Ga0207674_10040705 3300026116 Bacteria 4812
365 Ga0207674_10055105 3300026116 Bacteria 4045
366 Ga0207674_10066239 3300026116 Bacteria 3639
367 Ga0207674_10108367 3300026116 Bacteria 2754
368 Ga0207674_10157292 3300026116 Bacteria 2228
369 Ga0207674_10227228 3300026116 Bacteria 1814
370 Ga0207675_100000018 3300026118 Bacteria 124200
371 Ga0207675_100000458 3300026118 Bacteria 39635
372 Ga0207675_100000462 3300026118 Bacteria 39560
373 Ga0207675_100232019 3300026118 Bacteria 1781
374 Ga0207698_10000054 3300026142 Bacteria 82681
375 Ga0207698_10001032 3300026142 Bacteria 16209
376 Ga0207698_10001871 3300026142 Bacteria 12297
377 Ga0207698_10012887 3300026142 Bacteria 5493
378 Ga0207698_10024017 3300026142 Bacteria 4270
379 Ga0207698_10151949 3300026142 Bacteria 2011
380 Ga0209813_10000050 3300027866 Bacteria 48358
381 Ga0209813_10000073 3300027866 Bacteria 37553
382 Ga0268266_10032876 3300028379 Bacteria 4408
383 Ga0268266_10566017 3300028379 Bacteria 1090
384 Ga0268265_10000102 3300028380 Bacteria 106737
385 Ga0268265_10002307 3300028380 Bacteria 14530
386 Ga0268265_10069645 3300028380 Bacteria 2732
387 Ga0268265_10115322 3300028380 Bacteria 2202
388 Ga0268264_10000154 3300028381 Bacteria 156992
389 Ga0268264_10001686 3300028381 Bacteria 20359
390 Ga0268264_10011539 3300028381 Bacteria 7301
391 Ga0268264_10024547 3300028381 Bacteria 4922
392 Ga0307517_10003177 3300028786 Bacteria 25825
393 Ga0307517_10045513 3300028786 Bacteria 4606
394 Ga0265338_10159120 3300028800 Bacteria 1746
395 Ga0307513_10479462 3300031456 Bacteria 964
396 Ga0307408_100001033 3300031548 Bacteria 21395
397 Ga0307408_100001589 3300031548 Bacteria 16769
398 Ga0307408_100001936 3300031548 Bacteria 15015
399 Ga0307408_100039288 3300031548 Bacteria 3344
400 Ga0307405_10000583 3300031731 Bacteria 13988
401 Ga0307413_10001271 3300031824 Bacteria 9414
402 Ga0307406_10000490 3300031901 Bacteria 22793
403 Ga0307406_10007007 3300031901 Bacteria 6240
404 Ga0307412_10000525 3300031911 Bacteria 22799
405 Ga0307412_10028911 3300031911 Bacteria 3474
406 Ga0307412_10065507 3300031911 Bacteria 2459
407 Ga0307416_100040623 3300032002 Bacteria 3616
408 Ga0307414_10000135 3300032004 Bacteria 50571
409 Ga0307414_10073332 3300032004 Bacteria 2476
410 Ga0307411_10000688 3300032005 Bacteria 12419
411 Ga0307510_10005547 3300033180 Bacteria 15039
412 Ga0315911_1000002 3300033442 Bacteria 926833
413 Ga0373947_0202285 3300035725 Bacteria 1300
414 Ga0395899_0000366 3300037312 Bacteria 54708
415 Ga0395899_0000387 3300037312 Bacteria 52472
416 Ga0395899_0071151 3300037312 Bacteria 2545
417 Ga0395899_0124956 3300037312 Bacteria 1840
418 Ga0395900_0000130 3300037418 Bacteria 126231
419 Ga0395900_0000756 3300037418 Bacteria 42958
420 Ga0395900_0009767 3300037418 Bacteria 9833
421 Ga0395900_0039938 3300037418 Bacteria 4836
422 Ga0395900_0152989 3300037418 Bacteria 2356
423 Ga0395900_0189393 3300037418 Bacteria 2087
424 Ga0395900_0210964 3300037418 Bacteria 1961
425 Ga0395900_0218966 3300037418 Bacteria 1920
426 Ga0395900_0289144 3300037418 Bacteria 1628
427 Ga0395900_0310244 3300037418 Bacteria 1561
428 Ga0395900_0313680 3300037418 Bacteria 1551
429 Ga0395898_0000274 3300037466 Bacteria 125922
430 Ga0395898_0042237 3300037466 Bacteria 4500
431 Ga0395898_0070335 3300037466 Bacteria 3384
432 Ga0395898_0213805 3300037466 Bacteria 1839
433 Ga0395898_0448438 3300037466 Bacteria 1229
434 Ga0395905_0000287 3300037471 Bacteria 73803
435 Ga0395905_0002377 3300037471 Bacteria 20963
436 Ga0395905_0015566 3300037471 Bacteria 7227
437 Ga0395905_0061887 3300037471 Bacteria 3501
438 Ga0395905_0096184 3300037471 Bacteria 2780
439 Ga0395905_0124111 3300037471 Bacteria 2428
440 Ga0395905_0177307 3300037471 Bacteria 2000
441 Ga0395905_0296171 3300037471 Bacteria 1505
442 Ga0395905_0442758 3300037471 Bacteria 1197
443 Ga0395901_0000108 3300038443 Bacteria 113046
444 Ga0395901_0096916 3300038443 Bacteria 3091
445 Ga0395901_0145472 3300038443 Bacteria 2491
446 Ga0395901_0183378 3300038443 Bacteria 2195
447 Ga0395901_0253338 3300038443 Bacteria 1834
448 Ga0395901_0282625 3300038443 Bacteria 1724
449 Ga0395901_0491217 3300038443 Bacteria 1251
450 Ga0395901_0680481 3300038443 Bacteria 1028
451 Ga0237819_00451 3300038705 Bacteria 13995
452 Ga0237819_06546 3300038705 Bacteria 1738
453 Ga0450912_000046 3300042116 Bacteria 4108
454 Ga0450894_006902 3300042131 Bacteria 1463
455 Ga0450898_001596 3300042134 Bacteria 3030
456 Ga0439459_0003296 3300042438 Bacteria 2548
457 Ga0450893_0001915 3300042532 Bacteria 3230
458 Ga0466969_0111377 3300044656 Bacteria 1281
459 Ga0466957_0058378 3300044842 Bacteria 2364
460 Ga0495627_000409 3300046453 Bacteria 37928
461 Ga0495627_000883 3300046453 Bacteria 21095
462 Ga0495627_001643 3300046453 Bacteria 12428
463 Ga0495627_001780 3300046453 Bacteria 11539
464 Ga0495627_011562 3300046453 Bacteria 3164
465 Ga0495650_0001552 3300046471 Bacteria 21682
466 Ga0495650_0001944 3300046471 Bacteria 18278
467 Ga0495585_0144684 3300046492 Bacteria 1243
468 Ga0495583_0000120 3300046506 Bacteria 133285
469 Ga0495583_0050151 3300046506 Bacteria 1909
470 Ga0495606_0061141 3300046507 Bacteria 2410
471 Ga0495610_0000094 3300046512 Bacteria 105131
472 Ga0495610_0011765 3300046512 Bacteria 5316
473 Ga0495610_0028312 3300046512 Bacteria 2964
474 Ga0495616_0000009 3300046513 Bacteria 225502
475 Ga0495632_0001232 3300046519 Bacteria 21721
476 Ga0495637_0010985 3300046520 Bacteria 4363
477 Ga0495643_0000054 3300046522 Bacteria 198757
478 Ga0495643_0009112 3300046522 Bacteria 6215
479 Ga0495648_0011032 3300046524 Bacteria 6846
480 Ga0495648_0036330 3300046524 Bacteria 3181
481 Ga0495654_0017583 3300046530 Bacteria 3755
482 Ga0495633_0000054 3300046558 Bacteria 151646
483 Ga0495633_0000145 3300046558 Bacteria 94380
484 Ga0495633_0111085 3300046558 Bacteria 1271
485 Ga0495661_0139020 3300046665 Bacteria 1323
486 Ga0495687_000200 3300047443 Bacteria 85752
487 Ga0495677_0002742 3300047445 Bacteria 6885
488 Ga0495673_0000025 3300047469 Bacteria 512352
489 Ga0495681_0007128 3300047470 Bacteria 7203
490 Ga0495681_0053740 3300047470 Bacteria 1884
491 Ga0495686_0150308 3300047472 Bacteria 1367
492 Ga0495626_0005504 3300048091 Bacteria 7376
493 Ga0496100_0006587 3300048903 Bacteria 6345
494 Ga0496101_0038514 3300048904 Bacteria 3396
495 Ga0496104_0016538 3300048907 Bacteria 6703
496 Ga0496105_0002439 3300048908 Bacteria 13462
497 Ga0496105_0023910 3300048908 Bacteria 4962
498 Ga0496106_0440360 3300048909 Bacteria 1047
499 Ga0496110_0225406 3300048913 Bacteria 1704
500 Ga0496111_0016199 3300048914 Bacteria 5135
501 Ga0496111_0086353 3300048914 Bacteria 2296
502 Ga0496113_0075468 3300048916 Bacteria 2573
503 Ga0496115_0040957 3300048918 Bacteria 3684
504 Ga0496116_0003877 3300048919 Bacteria 14579
505 Ga0496116_0003989 3300048919 Bacteria 14316
506 Ga0496116_0068909 3300048919 Bacteria 2252
507 Ga0496117_0011550 3300048920 Bacteria 7901
508 Ga0496117_0170022 3300048920 Bacteria 1266
509 Ga0496118_0005823 3300048921 Bacteria 13813
510 Ga0496118_0109123 3300048921 Bacteria 1843
511 Ga0496118_0164981 3300048921 Bacteria 1363
512 Ga0496120_0033259 3300048923 Bacteria 3099
513 Ga0496120_0036230 3300048923 Bacteria 2938
514 Ga0496121_0000472 3300048924 Bacteria 78334
515 Ga0496121_0001255 3300048924 Bacteria 43938
516 Ga0496121_0001383 3300048924 Bacteria 41083
517 Ga0496121_0002146 3300048924 Bacteria 30925
518 Ga0496121_0140930 3300048924 Bacteria 1789
519 Ga0496121_0157741 3300048924 Bacteria 1663
520 Ga0496122_0001258 3300048925 Bacteria 42409
521 Ga0496122_0001624 3300048925 Bacteria 35073
522 Ga0496122_0001950 3300048925 Bacteria 30922
523 Ga0496122_0001993 3300048925 Bacteria 30434
524 Ga0496122_0043737 3300048925 Bacteria 3505
525 Ga0496123_0001440 3300048926 Bacteria 33152
526 Ga0496123_0001459 3300048926 Bacteria 32922
527 Ga0496123_0001523 3300048926 Bacteria 32024
528 Ga0496123_0002778 3300048926 Bacteria 20862
529 Ga0496123_0055943 3300048926 Bacteria 2584
530 Ga0496124_0000011 3300048927 Bacteria 524145
531 Ga0496124_0000188 3300048927 Bacteria 122361
532 Ga0496124_0001591 3300048927 Bacteria 32694
533 Ga0496124_0001870 3300048927 Bacteria 28977
534 Ga0496124_0004286 3300048927 Bacteria 16754
535 Ga0496124_0008338 3300048927 Bacteria 10853
536 Ga0496124_0009721 3300048927 Bacteria 9844
537 Ga0496124_0013548 3300048927 Bacteria 7951
538 Ga0496124_0043826 3300048927 Bacteria 3843
539 Ga0496124_0107628 3300048927 Bacteria 2249
540 Ga0496125_0001456 3300048928 Bacteria 34314
541 Ga0496125_0001686 3300048928 Bacteria 30917
542 Ga0496125_0033035 3300048928 Bacteria 4586
543 Ga0496125_0039537 3300048928 Bacteria 4059
544 Ga0496125_0084294 3300048928 Bacteria 2414
545 Ga0496125_0136047 3300048928 Bacteria 1719
546 Ga0496125_0218162 3300048928 Bacteria 1231
547 Ga0496126_0000041 3300048929 Bacteria 340389
548 Ga0496126_0000202 3300048929 Bacteria 132786
549 Ga0496126_0006033 3300048929 Bacteria 13598
550 Ga0496126_0023544 3300048929 Bacteria 5967
551 Ga0496126_0058871 3300048929 Bacteria 3462
552 Ga0496126_0067751 3300048929 Bacteria 3189
553 Ga0496126_0500496 3300048929 Bacteria 971
554 Ga0495678_017497 3300049459 Bacteria 3247
555 Ga0501031_0179842 3300049568 Bacteria 1382
556 Ga0501034_0213687 3300049571 Bacteria 1883
557 Ga0501037_0195299 3300049573 Bacteria 1432
558 Ga0501038_0034087 3300049574 Bacteria 4478
559 Ga0501047_0065479 3300049581 Bacteria 3503
560 Ga0501047_0491454 3300049581 Bacteria 1054
561 Ga0501233_000039 3300049668 Bacteria 17480
562 Ga0501249_000069 3300049679 Bacteria 36407
563 Ga0501249_000114 3300049679 Bacteria 24796
564 Ga0501225_0014815 3300049705 Bacteria 2174
565 Ga0501035_0079249 3300049822 Bacteria 2901
566 Ga0501044_0011071 3300049823 Bacteria 9783
567 Ga0501044_0097444 3300049823 Bacteria 2962
568 Ga0501204_000619 3300049850 Bacteria 3161
569 Ga0501204_001691 3300049850 Bacteria 2194
570 Ga0501220_00697 3300049852 Bacteria 1075
571 nmdc:mga03683_161_c1 3300050489 Bacteria 22524
572 nmdc:mga03n38_287_c1 3300050490 Bacteria 12037
573 nmdc:mga00v17_29_c1 3300050491 Bacteria 89620
574 nmdc:mga0yw44_1026_c1 3300050492 Bacteria 10710
575 nmdc:mga0k408_17368_c1 3300050493 Bacteria 4009
576 nmdc:mga06z11_165_c1 3300050494 Bacteria 25978
577 nmdc:mga06z11_54_c1 3300050494 Bacteria 48385
578 nmdc:mga04h51_15_c1 3300050495 Bacteria 76646
579 nmdc:mga04h51_32_c1 3300050495 Bacteria 48953
580 nmdc:mga04h51_58946_c1 3300050495 Bacteria 1310
581 nmdc:mga07m45_128508_c1 3300050496 Bacteria 1466
582 nmdc:mga07m45_188505_c1 3300050496 Bacteria 1199
583 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
584 nmdc:mga07m45_71301_c1 3300050496 Bacteria 1977
585 nmdc:mga0sz30_1471_c1 3300050516 Bacteria 8403
586 Ga0500643_000090 3300053087 Bacteria 93938
587 Ga0500643_002703 3300053087 Bacteria 8911
588 Ga0500643_060487 3300053087 Bacteria 1064
589 Ga0500644_0004961 3300053088 Bacteria 3347
590 Ga0500651_0068605 3300053093 Bacteria 2208
591 Ga0500651_0118336 3300053093 Bacteria 1611
592 Ga0500566_0005930 3300053094 Bacteria 7266
593 Ga0500555_000043 3300053103 Bacteria 64581
594 Ga0500555_065950 3300053103 Bacteria 964
595 Ga0500556_0000340 3300053104 Bacteria 34916
596 Ga0500556_0003117 3300053104 Bacteria 4948
597 Ga0500556_0009190 3300053104 Bacteria 2867
598 Ga0500556_0010063 3300053104 Bacteria 2766
599 Ga0500597_002992 3300053120 Bacteria 4860
600 Ga0500607_006304 3300053121 Bacteria 7535
601 Ga0500608_000212 3300053122 Bacteria 23229
602 Ga0500608_044878 3300053122 Bacteria 2123
603 Ga0500614_006597 3300053123 Bacteria 2439
604 Ga0500642_0010358 3300053130 Bacteria 3283
605 Ga0500652_142551 3300053131 Bacteria 997
606 Ga0500658_0012952 3300053134 Bacteria 3080
607 Ga0500559_0008092 3300053136 Bacteria 4627
608 Ga0500559_0014883 3300053136 Bacteria 3287
609 Ga0500559_0079482 3300053136 Bacteria 1489
610 Ga0500559_0102753 3300053136 Bacteria 1318
611 Ga0500577_0016437 3300053142 Bacteria 2333
612 Ga0500590_000019 3300053148 Bacteria 44823
613 Ga0500590_005685 3300053148 Bacteria 6015
614 Ga0500622_0003674 3300053156 Bacteria 10072
615 Ga0500624_000002 3300053157 Bacteria 257900
616 Ga0500624_000437 3300053157 Bacteria 12611
617 Ga0500627_0000024 3300053158 Bacteria 104034
618 Ga0500627_0000971 3300053158 Bacteria 7770
619 Ga0500627_0020249 3300053158 Bacteria 2665
620 Ga0500639_022852 3300053163 Bacteria 3303
621 Ga0500639_130109 3300053163 Bacteria 1194
622 Ga0500637_0000186 3300053178 Bacteria 23129
623 Ga0500570_029627 3300053724 Bacteria 2970
624 Ga0500645_007445 3300053730 Bacteria 3810
625 Ga0500596_001450 3300053735 Bacteria 4801
626 Ga0500596_017818 3300053735 Bacteria 1065
627 2509151412 2508501128 Bacteria 8613869
628 2511124861 2510917020 Bacteria 5657507
629 2513677669 2513237098 Bacteria 9902361
630 2513696812 2513237101 Bacteria 7952346
631 2513863597 2513237137 Bacteria 9558895
632 2514012738 2513237161 Bacteria 8871253
633 2524441926 2524023205 Bacteria 8918781
634 2528848827 2528768022 Bacteria 10457665
635 2585154386 2582581280 Bacteria 5994497
636 2585197951 2582581293 Bacteria 5907401
637 2585261034 2582581305 Bacteria 4895574
638 2600202142 2599185354 Bacteria 4398675
639 2600204224 2599185354 Bacteria 4398675
640 2600227307 2599185359 Bacteria 4772316
641 2617375308 2617270741 Bacteria 8201522
642 2671118251 2667528175 Bacteria 7532676
643 2753767651 2751185897 Bacteria 5322941
644 2778125234 2775507255 Bacteria 3945731
645 2778125862 2775507255 Bacteria 3945731
646 2809063761 2808606401 Bacteria 4586670
647 2809065658 2808606401 Bacteria 4586670
648 2809079621 2808606404 Bacteria 4652788
649 2809081669 2808606404 Bacteria 4652788
650 2809083986 2808606405 Bacteria 4586632
651 2809086048 2808606405 Bacteria 4586632
652 2819553630 2818991438 Bacteria 5793701
653 2874605685 2874604998 Bacteria 7834745
654 2879108486 2879099564 Bacteria 10442239
655 2880519309 2880518877 Bacteria 5012590
656 2880520903 2880518877 Bacteria 5012590
657 2885379929 2885374607 Bacteria 8927485
658 2885416846 2885409591 Bacteria 9235467
659 2903775665 2903768456 Bacteria 9749579
660 2906617049
661 2919712246 2919709256 Bacteria 4318106
662 2922428859
663 2928104251 2928100450 Bacteria 4837635
664 2928104444 2928100450 Bacteria 4837635
665 2928529236 2928526807 Bacteria 4760224
666 2935813648 2935810662 Bacteria 9401221
667 2936042821 2936037263 Bacteria 9446081
668 3005597987 3005594810 Bacteria 8716512
669 8054305518 8054302542 Bacteria 5698134
670 8056677056 8056673599 Bacteria 7871253
671 8057105185 8057101203 Bacteria 5034064
672 Ga0075363_100009589
673 SwRhRL2b_contig_195601
674 JGI24740J21852_10000086
675 JGI24740J21852_10006157
676 JGI24740J21852_10011901
677 JGI24740J21852_10020475
678 JGI24739J22299_10000303
679 JGI24737J22298_10000127
680 JGI24737J22298_10000793
681 JGI24737J22298_10009384
682 JGI24735J21928_10000302
683 JGI24735J21928_10007017
684 JGI24735J21928_10009083
685 JGI24735J21928_10014034
686 JGI24738J21930_10000028
687 JGI24738J21930_10000183
688 JGI24751J29686_10000331
689 JGI25165J46597_1000010
690 JGI25165J46597_1000109
691 JGI25153J46596_10000007
692 rootH1_10054095
693 rootH1_10117209
694 rootH2_10043023
695 rootL2_10016666
696 rootH1_10007994
697 rootH1_10225907
698 Ga0055542_1000115
699 Ga0055529_1000052
700 Ga0055536_1013449
701 Ga0055530_10000249
702 Ga0055531_10000008
703 Ga0065704_10083051
704 Ga0065704_10107146
705 Ga0070658_10000088
706 Ga0070658_10011856
707 Ga0070658_10066477
708 Ga0070658_10077023
709 Ga0070658_10350541
710 Ga0070683_100001387
711 Ga0070683_100233947
712 Ga0070670_100000563
713 Ga0070670_100299953
714 Ga0068868_100086391
715 Ga0070660_100004577
716 Ga0070660_100005553
717 Ga0070660_100005665
718 Ga0070660_100007802
719 Ga0070661_100024423
720 Ga0070661_100214368
721 Ga0070692_10020889
722 Ga0070668_100002984
723 Ga0070668_100014600
724 Ga0070668_100033908
725 Ga0070668_100035177
726 Ga0070668_100222786
727 Ga0070669_100000048
728 Ga0070669_100000192
729 Ga0070671_100000065
730 Ga0070674_100000013
731 Ga0070673_100010293
732 Ga0070659_100066717
733 Ga0070659_100177053
734 Ga0070667_100000523
735 Ga0070667_100002964
736 Ga0070667_100136887
737 Ga0070662_100007482
738 Ga0070662_100027094
739 Ga0070662_100622271
740 Ga0070681_10570207
741 Ga0068867_100011083
742 Ga0070679_100010488
743 Ga0070679_100042614
744 Ga0070679_100231733
745 Ga0070679_100408132
746 Ga0070684_100000637
747 Ga0068853_100000373
748 Ga0068853_100000873
749 Ga0068853_100032735
750 Ga0068853_100046492
751 Ga0068853_100182241
752 Ga0068853_100234434
753 Ga0068853_100300156
754 Ga0068853_100309836
755 Ga0070672_100135211
756 Ga0070665_100093895
757 Ga0068855_100000173
758 Ga0068855_100002262
759 Ga0068855_100014300
760 Ga0068855_100021485
761 Ga0068855_100026215
762 Ga0068855_100065454
763 Ga0068855_100071857
764 Ga0070664_100010514
765 Ga0070664_100017462
766 Ga0070664_100223355
767 Ga0068857_100004617
768 Ga0068857_100006948
769 Ga0068857_100010210
770 Ga0068857_100014446
771 Ga0068857_100059197
772 Ga0068857_100111605
773 Ga0068857_100133017
774 Ga0068854_100000071
775 Ga0068854_100000295
776 Ga0068854_100088992
777 Ga0068854_100091762
778 Ga0068854_100160548
779 Ga0068854_100300419
780 Ga0068856_100000785
781 Ga0068856_100001545
782 Ga0068852_100000060
783 Ga0068852_100001458
784 Ga0068852_100018212
785 Ga0068852_100018586
786 Ga0068852_100030161
787 Ga0068852_100037350
788 Ga0068859_100001206
789 Ga0068859_100001920
790 Ga0068859_100003753
791 Ga0068859_100046142
792 Ga0068859_100375687
793 Ga0068864_100000109
794 Ga0068861_100000017
795 Ga0068861_100000124
796 Ga0068861_100000201
797 Ga0068861_100054709
798 Ga0068851_10000666
799 Ga0068863_100000168
800 Ga0068863_100000403
801 Ga0068863_100000936
802 Ga0068858_100000104
803 Ga0068858_100002215
804 Ga0068860_100001426
805 Ga0068860_100006530
806 Ga0068860_100015898
807 Ga0068860_100036308
808 Ga0068862_100000128
809 Ga0068862_100002200
810 Ga0068862_100030459
811 Ga0081539_10032076
812 Ga0075365_10002107
813 Ga0075365_10011285
814 Ga0075365_10399349
815 Ga0075368_10000046
816 Ga0075368_10000089
817 Ga0075368_10082395
818 Ga0075363_100000664
819 Ga0075364_10000007
820 Ga0070712_100475232
821 Ga0075362_10001665
822 Ga0075367_10000037
823 Ga0075367_10000962
824 Ga0075369_10000954
825 Ga0075369_10089962
826 Ga0075366_10018330
827 Ga0075370_10000371
828 Ga0075370_10019290
829 Ga0068865_100000006
830 Ga0097620_100001206
831 Ga0097620_100001920
832 Ga0097620_100003753
833 Ga0097620_100046142
834 Ga0097620_100375664
835 Ga0105251_10000132
836 Ga0105250_10006219
837 Ga0105240_10007247
838 Ga0105240_10014342
839 Ga0105240_10030377
840 Ga0105240_10091495
841 Ga0105243_10001647
842 Ga0105241_10130703
843 Ga0105248_10000561
844 Ga0105248_10001759
845 Ga0105248_10271489
846 Ga0105237_10000378
847 Ga0105237_10006024
848 Ga0105237_10022170
849 Ga0105237_10184277
850 Ga0105237_10310984
851 Ga0105238_10000647
852 Ga0105238_10000912
853 Ga0105238_10001356
854 Ga0105238_10009276
855 Ga0105238_10020241
856 Ga0105238_10038255
857 Ga0105238_10048636
858 Ga0105249_10144289
859 Ga0105148_100638
860 Ga0105239_10000232
861 Ga0105239_10005393
862 Ga0105239_10009359
863 Ga0105239_10010609
864 Ga0157326_1000258
865 Ga0157373_10002657
866 Ga0157373_10157933
867 Ga0157371_10001141
868 Ga0157371_10003271
869 Ga0157371_10032675
870 Ga0157370_10000782
871 Ga0157370_10001089
872 Ga0157370_10006168
873 Ga0157370_10006494
874 Ga0157370_10044866
875 Ga0157370_10057225
876 Ga0157369_10000220
877 Ga0157369_10000632
878 Ga0157369_10003995
879 Ga0157369_10007094
880 Ga0157369_10009285
881 Ga0157369_10017891
882 Ga0157369_10027809
883 Ga0157369_10094798
884 Ga0157369_10156086
885 Ga0157369_10234178
886 Ga0157374_10009422
887 Ga0157378_10000050
888 Ga0157378_10607330
889 Ga0163162_10000261
890 Ga0163162_10001322
891 Ga0163162_10005897
892 Ga0157372_10001385
893 Ga0157372_10003423
894 Ga0157372_10004488
895 Ga0157372_10333581
896 Ga0157380_10000029
897 Ga0157377_10207376
898 Ga0157379_10003369
899 Ga0163161_10045261
900 Ga0163161_10072291
901 Ga0163161_10093937
902 Ga0214544_1009140
903 Ga0209147_100482
904 Ga0209563_100047
905 Ga0209437_114980
906 Ga0209148_1000011
907 Ga0209233_1000044
908 Ga0209233_1000167
909 Ga0209233_1007274
910 Ga0209233_1035826
911 Ga0209455_1000006
912 Ga0209676_1000077
913 Ga0209758_1000017
914 Ga0209050_1000026
915 Ga0209050_1005513
916 Ga0209257_1000009
917 Ga0209257_1006476
918 Ga0207697_10000315
919 Ga0207697_10013988
920 Ga0207656_10000058
921 Ga0207696_1002176
922 Ga0207713_1000224
923 Ga0207713_1025534
924 Ga0207647_10006429
925 Ga0207647_10038705
926 Ga0207705_10000071
927 Ga0207705_10000138
928 Ga0207705_10000266
929 Ga0207705_10005208
930 Ga0207705_10084091
931 Ga0207705_10340541
932 Ga0207705_10436713
933 Ga0207654_10143323
934 Ga0207707_10300551
935 Ga0207695_10000525
936 Ga0207695_10001920
937 Ga0207695_10012067
938 Ga0207695_10030763
939 Ga0207695_10039507
940 Ga0207695_10077854
941 Ga0207695_10111809
942 Ga0207671_10000222
943 Ga0207671_10015756
944 Ga0207671_10018414
945 Ga0207660_10017144
946 Ga0207660_10078180
947 Ga0207657_10000020
948 Ga0207657_10001528
949 Ga0207657_10003535
950 Ga0207657_10005598
951 Ga0207657_10007994
952 Ga0207657_10008495
953 Ga0207657_10020437
954 Ga0207657_10307044
955 Ga0207649_10000034
956 Ga0207649_10008333
957 Ga0207649_10338543
958 Ga0207652_10044778
959 Ga0207652_10242056
960 Ga0207681_10000037
961 Ga0207681_10000050
962 Ga0207694_10000611
963 Ga0207694_10001992
964 Ga0207694_10002066
965 Ga0207694_10002827
966 Ga0207694_10002967
967 Ga0207694_10020108
968 Ga0207694_10031448
969 Ga0207694_10081805
970 Ga0207650_10000039
971 Ga0207650_10305267
972 Ga0207644_10000045
973 Ga0207644_10075999
974 Ga0207706_10014734
975 Ga0207706_10031349
976 Ga0207709_10001104
977 Ga0207669_10000011
978 Ga0207704_10000022
979 Ga0207691_10033497
980 Ga0207711_10000676
981 Ga0207711_10028349
982 Ga0207711_10069242
983 Ga0207711_10497729
984 Ga0207689_10005004
985 Ga0207661_10002993
986 Ga0207679_10006486
987 Ga0207667_10000001
988 Ga0207667_10005828
989 Ga0207667_10024820
990 Ga0207667_10025344
991 Ga0207667_10039581
992 Ga0207667_10462769
993 Ga0207667_10522872
994 Ga0207667_10535213
995 Ga0207651_10178717
996 Ga0207651_10664857
997 Ga0207712_10125847
998 Ga0207668_10000055
999 Ga0207668_10005353
1000 Ga0207668_10005413
1001 Ga0207668_10013328
1002 Ga0207668_10051936
1003 Ga0207668_10111769
1004 Ga0207640_10000041
1005 Ga0207640_10004501
1006 Ga0207640_10012720
1007 Ga0207640_10040536
1008 Ga0207640_10081189
1009 Ga0207640_10188531
1010 Ga0207658_10001363
1011 Ga0207658_10004471
1012 Ga0207677_10000164
1013 Ga0207703_10000136
1014 Ga0207703_10002249
1015 Ga0207703_10007960
1016 Ga0207639_10000081
1017 Ga0207639_10000779
1018 Ga0207639_10005959
1019 Ga0207639_10130019
1020 Ga0207639_10147518
1021 Ga0207639_10262181
1022 Ga0207678_10043529
1023 Ga0207678_10150495
1024 Ga0207702_10000211
1025 Ga0207702_10001302
1026 Ga0207702_10030790
1027 Ga0207641_10000165
1028 Ga0207641_10000241
1029 Ga0207641_10000504
1030 Ga0207676_10000035
1031 Ga0207674_10005761
1032 Ga0207674_10008818
1033 Ga0207674_10021570
1034 Ga0207674_10037386
1035 Ga0207674_10040705
1036 Ga0207674_10055105
1037 Ga0207674_10066239
1038 Ga0207674_10108367
1039 Ga0207674_10157292
1040 Ga0207674_10227228
1041 Ga0207675_100000018
1042 Ga0207675_100000458
1043 Ga0207675_100000462
1044 Ga0207675_100232019
1045 Ga0207698_10000054
1046 Ga0207698_10001032
1047 Ga0207698_10001871
1048 Ga0207698_10012887
1049 Ga0207698_10024017
1050 Ga0207698_10151949
1051 Ga0209813_10000050
1052 Ga0209813_10000073
1053 Ga0268266_10032876
1054 Ga0268266_10566017
1055 Ga0268265_10000102
1056 Ga0268265_10002307
1057 Ga0268265_10069645
1058 Ga0268265_10115322
1059 Ga0268264_10000154
1060 Ga0268264_10001686
1061 Ga0268264_10011539
1062 Ga0268264_10024547
1063 Ga0307517_10003177
1064 Ga0307517_10045513
1065 Ga0265338_10159120
1066 Ga0307513_10479462
1067 Ga0307408_100001033
1068 Ga0307408_100001589
1069 Ga0307408_100001936
1070 Ga0307408_100039288
1071 Ga0307405_10000583
1072 Ga0307413_10001271
1073 Ga0307406_10000490
1074 Ga0307406_10007007
1075 Ga0307412_10000525
1076 Ga0307412_10028911
1077 Ga0307412_10065507
1078 Ga0307416_100040623
1079 Ga0307414_10000135
1080 Ga0307414_10073332
1081 Ga0307411_10000688
1082 Ga0307510_10005547
1083 Ga0315911_1000002
1084 Ga0373947_0202285
1085 Ga0395899_0000366
1086 Ga0395899_0000387
1087 Ga0395899_0071151
1088 Ga0395899_0124956
1089 Ga0395900_0000130
1090 Ga0395900_0000756
1091 Ga0395900_0009767
1092 Ga0395900_0039938
1093 Ga0395900_0152989
1094 Ga0395900_0189393
1095 Ga0395900_0210964
1096 Ga0395900_0218966
1097 Ga0395900_0289144
1098 Ga0395900_0310244
1099 Ga0395900_0313680
1100 Ga0395898_0000274
1101 Ga0395898_0042237
1102 Ga0395898_0070335
1103 Ga0395898_0213805
1104 Ga0395898_0448438
1105 Ga0395905_0000287
1106 Ga0395905_0002377
1107 Ga0395905_0015566
1108 Ga0395905_0061887
1109 Ga0395905_0096184
1110 Ga0395905_0124111
1111 Ga0395905_0177307
1112 Ga0395905_0296171
1113 Ga0395905_0442758
1114 Ga0395901_0000108
1115 Ga0395901_0096916
1116 Ga0395901_0145472
1117 Ga0395901_0183378
1118 Ga0395901_0253338
1119 Ga0395901_0282625
1120 Ga0395901_0491217
1121 Ga0395901_0680481
1122 Ga0237819_00451
1123 Ga0237819_06546
1124 Ga0450912_000046
1125 Ga0450894_006902
1126 Ga0450898_001596
1127 Ga0439459_0003296
1128 Ga0450893_0001915
1129 Ga0466969_0111377
1130 Ga0466957_0058378
1131 Ga0495627_000409
1132 Ga0495627_000883
1133 Ga0495627_001643
1134 Ga0495627_001780
1135 Ga0495627_011562
1136 Ga0495650_0001552
1137 Ga0495650_0001944
1138 Ga0495585_0144684
1139 Ga0495583_0000120
1140 Ga0495583_0050151
1141 Ga0495606_0061141
1142 Ga0495610_0000094
1143 Ga0495610_0011765
1144 Ga0495610_0028312
1145 Ga0495616_0000009
1146 Ga0495632_0001232
1147 Ga0495637_0010985
1148 Ga0495643_0000054
1149 Ga0495643_0009112
1150 Ga0495648_0011032
1151 Ga0495648_0036330
1152 Ga0495654_0017583
1153 Ga0495633_0000054
1154 Ga0495633_0000145
1155 Ga0495633_0111085
1156 Ga0495661_0139020
1157 Ga0495687_000200
1158 Ga0495677_0002742
1159 Ga0495673_0000025
1160 Ga0495681_0007128
1161 Ga0495681_0053740
1162 Ga0495686_0150308
1163 Ga0495626_0005504
1164 Ga0496100_0006587
1165 Ga0496101_0038514
1166 Ga0496104_0016538
1167 Ga0496105_0002439
1168 Ga0496105_0023910
1169 Ga0496106_0440360
1170 Ga0496110_0225406
1171 Ga0496111_0016199
1172 Ga0496111_0086353
1173 Ga0496113_0075468
1174 Ga0496115_0040957
1175 Ga0496116_0003877
1176 Ga0496116_0003989
1177 Ga0496116_0068909
1178 Ga0496117_0011550
1179 Ga0496117_0170022
1180 Ga0496118_0005823
1181 Ga0496118_0109123
1182 Ga0496118_0164981
1183 Ga0496120_0033259
1184 Ga0496120_0036230
1185 Ga0496121_0000472
1186 Ga0496121_0001255
1187 Ga0496121_0001383
1188 Ga0496121_0002146
1189 Ga0496121_0140930
1190 Ga0496121_0157741
1191 Ga0496122_0001258
1192 Ga0496122_0001624
1193 Ga0496122_0001950
1194 Ga0496122_0001993
1195 Ga0496122_0043737
1196 Ga0496123_0001440
1197 Ga0496123_0001459
1198 Ga0496123_0001523
1199 Ga0496123_0002778
1200 Ga0496123_0055943
1201 Ga0496124_0000011
1202 Ga0496124_0000188
1203 Ga0496124_0001591
1204 Ga0496124_0001870
1205 Ga0496124_0004286
1206 Ga0496124_0008338
1207 Ga0496124_0009721
1208 Ga0496124_0013548
1209 Ga0496124_0043826
1210 Ga0496124_0107628
1211 Ga0496125_0001456
1212 Ga0496125_0001686
1213 Ga0496125_0033035
1214 Ga0496125_0039537
1215 Ga0496125_0084294
1216 Ga0496125_0136047
1217 Ga0496125_0218162
1218 Ga0496126_0000041
1219 Ga0496126_0000202
1220 Ga0496126_0006033
1221 Ga0496126_0023544
1222 Ga0496126_0058871
1223 Ga0496126_0067751
1224 Ga0496126_0500496
1225 Ga0495678_017497
1226 Ga0501031_0179842
1227 Ga0501034_0213687
1228 Ga0501037_0195299
1229 Ga0501038_0034087
1230 Ga0501047_0065479
1231 Ga0501047_0491454
1232 Ga0501233_000039
1233 Ga0501249_000069
1234 Ga0501249_000114
1235 Ga0501225_0014815
1236 Ga0501035_0079249
1237 Ga0501044_0011071
1238 Ga0501044_0097444
1239 Ga0501204_000619
1240 Ga0501204_001691
1241 Ga0501220_00697
1242 nmdc:mga03683_161_c1
1243 nmdc:mga03n38_287_c1
1244 nmdc:mga00v17_29_c1
1245 nmdc:mga0yw44_1026_c1
1246 nmdc:mga0k408_17368_c1
1247 nmdc:mga06z11_165_c1
1248 nmdc:mga06z11_54_c1
1249 nmdc:mga04h51_15_c1
1250 nmdc:mga04h51_32_c1
1251 nmdc:mga04h51_58946_c1
1252 nmdc:mga07m45_128508_c1
1253 nmdc:mga07m45_188505_c1
1254 nmdc:mga07m45_5_c2
1255 nmdc:mga07m45_71301_c1
1256 nmdc:mga0sz30_1471_c1
1257 Ga0500643_000090
1258 Ga0500643_002703
1259 Ga0500643_060487
1260 Ga0500644_0004961
1261 Ga0500651_0068605
1262 Ga0500651_0118336
1263 Ga0500566_0005930
1264 Ga0500555_000043
1265 Ga0500555_065950
1266 Ga0500556_0000340
1267 Ga0500556_0003117
1268 Ga0500556_0009190
1269 Ga0500556_0010063
1270 Ga0500597_002992
1271 Ga0500607_006304
1272 Ga0500608_000212
1273 Ga0500608_044878
1274 Ga0500614_006597
1275 Ga0500642_0010358
1276 Ga0500652_142551
1277 Ga0500658_0012952
1278 Ga0500559_0008092
1279 Ga0500559_0014883
1280 Ga0500559_0079482
1281 Ga0500559_0102753
1282 Ga0500577_0016437
1283 Ga0500590_000019
1284 Ga0500590_005685
1285 Ga0500622_0003674
1286 Ga0500624_000002
1287 Ga0500624_000437
1288 Ga0500627_0000024
1289 Ga0500627_0000971
1290 Ga0500627_0020249
1291 Ga0500639_022852
1292 Ga0500639_130109
1293 Ga0500637_0000186
1294 Ga0500570_029627
1295 Ga0500645_007445
1296 Ga0500596_001450
1297 Ga0500596_017818
1298 2509151412
1299 2511124861
1300 2513677669
1301 2513696812
1302 2513863597
1303 2514012738
1304 2524441926
1305 2528848827
1306 2585154386
1307 2585197951
1308 2585261034
1309 2600202142
1310 2600204224
1311 2600227307
1312 2617375308
1313 2671118251
1314 2753767651
1315 2778125234
1316 2778125862
1317 2809063761
1318 2809065658
1319 2809079621
1320 2809081669
1321 2809083986
1322 2809086048
1323 2819553630
1324 2874605685
1325 2879108486
1326 2880519309
1327 2880520903
1328 2885379929
1329 2885416846
1330 2903775665
1331 2906617049
1332 2919712246
1333 2922428859
1334 2928104251
1335 2928104444
1336 2928529236
1337 2935813648
1338 2936042821
1339 3005597987
1340 8054305518
1341 8056677056
1342 8057105185

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04335

VirB8

VirB8 protein

22

223

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q6w-assembly2.cif.gz_C x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius 0.8669 159 199
4mei-assembly1.cif.gz_A-2 crystal structure of a virb8 type iv secretion system machinery soluble domain from bartonella tribocorum 0.8524 98 231
2bhm-assembly2.cif.gz_D crystal structure of virb8 from brucella suis 0.8495 105 230
4kz1-assembly1.cif.gz_A-2 crystal structure of the soluble domain of virb8 from bartonella grahamii 0.8479 98 230
7q1v-assembly1.cif.gz_D arches protomer (trimer of trwg/virb8peri) structure from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.8474 103 231
ID Description Score Start End Superfamily
af_O01913_702_992_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.9542 157 195 3.90.190.10
4akzD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.8522 105 230 3.10.450.230
4kz1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.8479 98 230 3.10.450.230
4kz1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.8305 98 230 3.10.450.230
2cc3B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.8133 96 232 3.10.450.230
ID Description Score Start End GO Terms
AF-A0A2E4QS16-F1-model_v4 Conjugal transfer protein TrbF 0.992 100 232 GO:0016020
AF-A0A259JT73-F1-model_v4 Conjugal transfer protein TrbF 0.9917 162 232 GO:0012505
GO:0016020
AF-A0A511XP97-F1-model_v4 Bacterial virulence protein VirB8 domain-containing protein 0.9792 167 232 GO:0016020
AF-A0A2E4QS16-F1-model_v4 Conjugal transfer protein TrbF 0.9774 100 232 GO:0016020
AF-A0A3D9X8D8-F1-model_v4 VirB8 protein 0.9715 115 197 GO:0016020

Map