F474141

General Info

Members Datasets Scaffolds Average Seq Length
671 362 1342 107

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10375177|Ga0070681_103751772
Length 108
Sequence MVITIFRSRLRPENQEQYSQWAQQMHDLAVKMPGFISIKTFNAEDGERVSIVEFESEEAVRHWREQAEHRQAQELGRKLFYSEYRIQVCQPIRDYSFPKKTGAPATSV

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
113 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
114 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
115 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
116 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
117 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
118 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
119 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
120 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
121 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
199 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
214 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
220 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
221 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
222 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
233 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
252 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
255 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
256 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
356 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
357 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0
Rhizoplane 3.58
Rhizosphere 93.59
Stem 0
Stem Tuber 0
Unclassified 7.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10375177 3300005458 Bacteria 1333
2 SwRhRL2b_contig_3134885 2162886007 Bacteria 1096
3 ARcpr5oldR_c000007 3300000041 Bacteria 41749
4 ARSoilYngRDRAFT_c00111 3300000042 Bacteria 13938
5 ARcpr5yngRDRAFT_c000090 3300000043 Bacteria 14724
6 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
7 ARCol0oldRDRAFT_c00252 3300000045 Bacteria 5061
8 ARCol0yngRDRAFT_1000074 3300000652 Bacteria 18636
9 JGI24739J22299_10120407 3300001989 Bacteria 784
10 JGI24737J22298_10040242 3300001990 Bacteria 1435
11 JGI24751J29686_10035409 3300002459 Bacteria 1035
12 JGI25405J52794_10019710 3300003911 Bacteria 1354
13 Ga0065704_10140814 3300005289 Bacteria 1518
14 Ga0065712_10074224 3300005290 Bacteria 4151
15 Ga0065715_10001507 3300005293 Bacteria 6080
16 Ga0070676_10178581 3300005328 Bacteria 1378
17 Ga0070676_10723112 3300005328 Bacteria 729
18 Ga0070683_101225567 3300005329 Unclassified 721
19 Ga0070690_100016276 3300005330 Bacteria 4450
20 Ga0070690_100266051 3300005330 Bacteria 1218
21 Ga0068869_100481001 3300005334 Bacteria 1034
22 Ga0070680_100363287 3300005336 Unclassified 1231
23 Ga0070680_100498496 3300005336 Bacteria 1042
24 Ga0070680_101489396 3300005336 Unclassified 586
25 Ga0070682_100062566 3300005337 Bacteria 2358
26 Ga0070682_100378969 3300005337 Bacteria 1063
27 Ga0070682_101036272 3300005337 Bacteria 683
28 Ga0068868_100131943 3300005338 Bacteria 2045
29 Ga0070660_100023926 3300005339 Bacteria 4530
30 Ga0070660_100130906 3300005339 Bacteria 2008
31 Ga0070660_100212826 3300005339 Bacteria 1570
32 Ga0070660_100240451 3300005339 Bacteria 1475
33 Ga0070660_100544293 3300005339 Bacteria 968
34 Ga0070660_100612262 3300005339 Bacteria 911
35 Ga0070689_100132230 3300005340 Bacteria 2001
36 Ga0070691_10015669 3300005341 Bacteria 3482
37 Ga0070687_100058634 3300005343 Bacteria 2023
38 Ga0070661_100228093 3300005344 Bacteria 1431
39 Ga0070661_100859956 3300005344 Bacteria 747
40 Ga0070668_100063032 3300005347 Bacteria 2873
41 Ga0070671_100061508 3300005355 Bacteria 3127
42 Ga0070674_100243238 3300005356 Bacteria 1410
43 Ga0070688_100007418 3300005365 Bacteria 5911
44 Ga0070659_100033098 3300005366 Bacteria 4013
45 Ga0070709_10855111 3300005434 Bacteria 717
46 Ga0070714_100202442 3300005435 Bacteria 1817
47 Ga0070714_101009288 3300005435 Bacteria 810
48 Ga0070710_10292538 3300005437 Bacteria 1060
49 Ga0070701_10086165 3300005438 Bacteria 1711
50 Ga0070701_10194971 3300005438 Bacteria 1194
51 Ga0070701_10376353 3300005438 Bacteria 894
52 Ga0070711_100015569 3300005439 Bacteria 4814
53 Ga0070711_100210514 3300005439 Bacteria 1505
54 Ga0070711_100249465 3300005439 Bacteria 1391
55 Ga0070705_100024922 3300005440 Bacteria 3236
56 Ga0070705_100245552 3300005440 Bacteria 1253
57 Ga0070700_100006176 3300005441 Bacteria 6383
58 Ga0070694_100022606 3300005444 Bacteria 4031
59 Ga0070694_100255402 3300005444 Bacteria 1328
60 Ga0070708_100010550 3300005445 Bacteria 7492
61 Ga0070663_100060440 3300005455 Bacteria 2726
62 Ga0070663_100397782 3300005455 Bacteria 1125
63 Ga0070663_100527909 3300005455 Bacteria 984
64 Ga0070678_100061654 3300005456 Bacteria 2765
65 Ga0070678_100161142 3300005456 Bacteria 1817
66 Ga0070662_100020477 3300005457 Bacteria 4504
67 Ga0070662_100060479 3300005457 Bacteria 2762
68 Ga0070662_100467770 3300005457 Bacteria 1048
69 Ga0070662_100520410 3300005457 Bacteria 994
70 Ga0070681_10012985 3300005458 Bacteria 8271
71 Ga0070681_10035954 3300005458 Bacteria 4975
72 Ga0070681_10206806 3300005458 Bacteria 1880
73 Ga0070681_10224839 3300005458 Bacteria 1792
74 Ga0068867_100037428 3300005459 Bacteria 3526
75 Ga0068867_101011014 3300005459 Bacteria 754
76 Ga0070706_100475797 3300005467 Bacteria 1162
77 Ga0070706_100867938 3300005467 Bacteria 834
78 Ga0070707_100410356 3300005468 Bacteria 1315
79 Ga0070698_100194771 3300005471 Bacteria 1964
80 Ga0074259_10551873 3300005507 Unclassified 555
81 Ga0070699_100276198 3300005518 Bacteria 1504
82 Ga0070679_100174499 3300005530 Bacteria 2122
83 Ga0070679_100178466 3300005530 Bacteria 2096
84 Ga0070679_100376970 3300005530 Bacteria 1365
85 Ga0070679_100414523 3300005530 Bacteria 1292
86 Ga0070679_100720363 3300005530 Unclassified 940
87 Ga0070679_100961102 3300005530 Bacteria 798
88 Ga0070679_101788471 3300005530 Unclassified 563
89 Ga0070684_100013001 3300005535 Bacteria 6697
90 Ga0070684_100446112 3300005535 Bacteria 1196
91 Ga0068853_100265245 3300005539 Bacteria 1580
92 Ga0070672_100520224 3300005543 Bacteria 1031
93 Ga0070686_100375741 3300005544 Bacteria 1074
94 Ga0070695_100487841 3300005545 Bacteria 951
95 Ga0070695_101137079 3300005545 Bacteria 640
96 Ga0070693_100185933 3300005547 Bacteria 1341
97 Ga0070665_101152896 3300005548 Bacteria 786
98 Ga0070704_101243516 3300005549 Bacteria 680
99 Ga0068855_100047838 3300005563 Bacteria 5051
100 Ga0068855_100613714 3300005563 Bacteria 1172
101 Ga0070664_100235074 3300005564 Bacteria 1644
102 Ga0070664_101240334 3300005564 Bacteria 704
103 Ga0068854_100412823 3300005578 Bacteria 1120
104 Ga0068854_100684475 3300005578 Bacteria 884
105 Ga0068856_101156346 3300005614 Bacteria 791
106 Ga0068856_101446061 3300005614 Bacteria 702
107 Ga0068856_102137680 3300005614 Unclassified 569
108 Ga0068852_100189709 3300005616 Bacteria 1938
109 Ga0068852_100494026 3300005616 Bacteria 1218
110 Ga0068852_100498989 3300005616 Bacteria 1212
111 Ga0068859_100029252 3300005617 Bacteria 5528
112 Ga0068859_101302103 3300005617 Bacteria 801
113 Ga0068864_102373942 3300005618 Unclassified 537
114 Ga0068866_10274370 3300005718 Bacteria 1042
115 Ga0068861_100348775 3300005719 Bacteria 1298
116 Ga0068870_10519446 3300005840 Bacteria 797
117 Ga0068858_100057288 3300005842 Bacteria 3601
118 Ga0068858_101163939 3300005842 Bacteria 758
119 Ga0068860_100020537 3300005843 Bacteria 6397
120 Ga0068862_100070792 3300005844 Bacteria 3011
121 Ga0068862_100581494 3300005844 Unclassified 1073
122 Ga0081455_10000002 3300005937 Bacteria 460472
123 Ga0081455_10027656 3300005937 Bacteria 5196
124 Ga0081455_10050997 3300005937 Bacteria 3552
125 Ga0081540_1026148 3300005983 Bacteria 3339
126 Ga0070717_10517872 3300006028 Bacteria 1079
127 Ga0075368_10019706 3300006042 Bacteria 2548
128 Ga0075363_100047592 3300006048 Bacteria 2278
129 Ga0075364_10037083 3300006051 Bacteria 3154
130 Ga0075432_10006215 3300006058 Bacteria 4061
131 Ga0075432_10132621 3300006058 Bacteria 945
132 Ga0070715_10957021 3300006163 Bacteria 531
133 Ga0070716_101388129 3300006173 Unclassified 571
134 Ga0070712_100222014 3300006175 Bacteria 1496
135 Ga0075362_10032958 3300006177 Bacteria 2251
136 Ga0075367_10053650 3300006178 Bacteria 2389
137 Ga0075369_10027920 3300006186 Bacteria 2362
138 Ga0075366_10678908 3300006195 Bacteria 639
139 Ga0075370_10081079 3300006353 Bacteria 1865
140 Ga0075428_100002408 3300006844 Bacteria 20309
141 Ga0075430_100000032 3300006846 Bacteria 72679
142 Ga0075431_100009024 3300006847 Bacteria 9998
143 Ga0075431_102131501 3300006847 Unclassified 515
144 Ga0075433_10000976 3300006852 Bacteria 20309
145 Ga0075433_10044742 3300006852 Bacteria 3847
146 Ga0075433_10086034 3300006852 Bacteria 2776
147 Ga0075433_10319165 3300006852 Bacteria 1374
148 Ga0075433_11051906 3300006852 Bacteria 708
149 Ga0075433_11727494 3300006852 Unclassified 539
150 Ga0075434_100000341 3300006871 Bacteria 33666
151 Ga0075434_100027835 3300006871 Bacteria 5550
152 Ga0075434_100059042 3300006871 Bacteria 3813
153 Ga0075434_100072274 3300006871 Bacteria 3442
154 Ga0075434_100431350 3300006871 Bacteria 1339
155 Ga0075429_100000631 3300006880 Bacteria 27160
156 Ga0075429_101042700 3300006880 Bacteria 715
157 Ga0068865_100938981 3300006881 Bacteria 754
158 Ga0075436_100116041 3300006914 Bacteria 1871
159 Ga0075436_100756477 3300006914 Bacteria 722
160 Ga0097620_100029251 3300006931 Bacteria 5528
161 Ga0097620_101302282 3300006931 Bacteria 801
162 Ga0075435_100022993 3300007076 Bacteria 4814
163 Ga0075435_100049803 3300007076 Bacteria 3370
164 Ga0075435_100060236 3300007076 Bacteria 3078
165 Ga0075435_100863239 3300007076 Bacteria 789
166 Ga0075435_101072839 3300007076 Unclassified 704
167 Ga0105240_10028987 3300009093 Bacteria 7220
168 Ga0105240_10055992 3300009093 Unclassified 4936
169 Ga0105240_10111765 3300009093 Bacteria 3304
170 Ga0111539_10000915 3300009094 Bacteria 38573
171 Ga0111539_10001270 3300009094 Bacteria 33682
172 Ga0111539_10077351 3300009094 Bacteria 3916
173 Ga0111539_10197339 3300009094 Bacteria 2347
174 Ga0111539_12459714 3300009094 Bacteria 604
175 Ga0105245_10039789 3300009098 Bacteria 4185
176 Ga0105247_10158180 3300009101 Bacteria 1498
177 Ga0114129_10001035 3300009147 Bacteria 36374
178 Ga0114129_10001551 3300009147 Bacteria 31169
179 Ga0114129_10654038 3300009147 Bacteria 1356
180 Ga0114129_11110381 3300009147 Bacteria 989
181 Ga0105243_10106669 3300009148 Bacteria 2336
182 Ga0105243_10110965 3300009148 Bacteria 2295
183 Ga0105241_10096790 3300009174 Bacteria 2339
184 Ga0105241_10385179 3300009174 Bacteria 1226
185 Ga0105242_10066315 3300009176 Bacteria 2980
186 Ga0105242_10106058 3300009176 Bacteria 2387
187 Ga0105242_10301072 3300009176 Bacteria 1464
188 Ga0105248_10332388 3300009177 Bacteria 1711
189 Ga0105237_10084828 3300009545 Bacteria 3157
190 Ga0105237_10160503 3300009545 Bacteria 2246
191 Ga0105237_10683485 3300009545 Bacteria 1033
192 Ga0105238_11459457 3300009551 Bacteria 712
193 Ga0105238_11771762 3300009551 Unclassified 649
194 Ga0105249_10061774 3300009553 Bacteria 3438
195 Ga0105239_11050476 3300010375 Bacteria 937
196 Ga0105239_12670758 3300010375 Bacteria 583
197 Ga0105239_12826958 3300010375 Bacteria 566
198 Ga0105239_13359783 3300010375 Bacteria 521
199 Ga0105246_10141649 3300011119 Bacteria 1809
200 Ga0105246_10172008 3300011119 Bacteria 1660
201 Ga0157346_1005788 3300012480 Bacteria 776
202 Ga0157323_1002789 3300012495 Bacteria 1002
203 Ga0157319_1043390 3300012497 Unclassified 534
204 Ga0157345_1002502 3300012498 Bacteria 1300
205 Ga0157347_1006398 3300012502 Bacteria 1151
206 Ga0157339_1006073 3300012505 Bacteria 974
207 Ga0157342_1047034 3300012507 Bacteria 596
208 Ga0157315_1022617 3300012508 Bacteria 678
209 Ga0157327_1006620 3300012512 Bacteria 981
210 Ga0157326_1002939 3300012513 Bacteria 1800
211 Ga0157373_10032188 3300013100 Bacteria 3775
212 Ga0157373_10088443 3300013100 Bacteria 2182
213 Ga0157373_10776649 3300013100 Bacteria 705
214 Ga0157373_11303407 3300013100 Unclassified 550
215 Ga0157371_10124619 3300013102 Bacteria 1832
216 Ga0157371_10288824 3300013102 Bacteria 1186
217 Ga0157371_10500097 3300013102 Bacteria 898
218 Ga0157370_10151577 3300013104 Bacteria 2157
219 Ga0157369_10355943 3300013105 Bacteria 1520
220 Ga0157369_10421221 3300013105 Bacteria 1384
221 Ga0157369_10575740 3300013105 Bacteria 1163
222 Ga0157369_11240425 3300013105 Bacteria 760
223 Ga0157374_10045943 3300013296 Bacteria 4042
224 Ga0157378_10049474 3300013297 Bacteria 3740
225 Ga0163162_10030120 3300013306 Bacteria 5376
226 Ga0163162_10047201 3300013306 Bacteria 4316
227 Ga0163162_10955272 3300013306 Bacteria 968
228 Ga0157372_10099175 3300013307 Bacteria 3323
229 Ga0157372_10182904 3300013307 Bacteria 2427
230 Ga0157375_10434633 3300013308 Bacteria 1478
231 Ga0157375_12628648 3300013308 Unclassified 602
232 Ga0163163_12102474 3300014325 Bacteria 624
233 Ga0157380_10032786 3300014326 Bacteria 3997
234 Ga0157380_10151915 3300014326 Unclassified 2003
235 Ga0157380_11007189 3300014326 Bacteria 867
236 Ga0157379_10952289 3300014968 Bacteria 816
237 Ga0157376_10454158 3300014969 Bacteria 1250
238 Ga0157376_11425947 3300014969 Bacteria 724
239 Ga0163161_10220614 3300017792 Bacteria 1468
240 Ga0206354_10070906 3300020081 Unclassified 573
241 Ga0207653_10052169 3300025885 Bacteria 1363
242 Ga0207688_10059983 3300025901 Bacteria 2142
243 Ga0207680_10105667 3300025903 Bacteria 1817
244 Ga0207647_10059863 3300025904 Bacteria 2329
245 Ga0207685_10664139 3300025905 Bacteria 565
246 Ga0207645_10293008 3300025907 Bacteria 1082
247 Ga0207705_10204831 3300025909 Bacteria 1495
248 Ga0207684_10497909 3300025910 Bacteria 1045
249 Ga0207654_10081144 3300025911 Bacteria 1952
250 Ga0207707_10026505 3300025912 Bacteria 5066
251 Ga0207707_10167329 3300025912 Bacteria 1921
252 Ga0207707_10257706 3300025912 Bacteria 1514
253 Ga0207707_10297165 3300025912 Bacteria 1397
254 Ga0207707_10312794 3300025912 Bacteria 1357
255 Ga0207707_10318361 3300025912 Bacteria 1343
256 Ga0207695_10167542 3300025913 Unclassified 2124
257 Ga0207695_10526180 3300025913 Bacteria 1064
258 Ga0207695_10848468 3300025913 Bacteria 793
259 Ga0207671_10496670 3300025914 Bacteria 973
260 Ga0207693_10016657 3300025915 Bacteria 5872
261 Ga0207663_10064670 3300025916 Bacteria 2335
262 Ga0207660_10063690 3300025917 Bacteria 2659
263 Ga0207660_10150073 3300025917 Bacteria 1790
264 Ga0207660_10199241 3300025917 Bacteria 1563
265 Ga0207660_10385177 3300025917 Bacteria 1127
266 Ga0207660_10621581 3300025917 Bacteria 880
267 Ga0207660_11383092 3300025917 Bacteria 570
268 Ga0207662_10277031 3300025918 Bacteria 1109
269 Ga0207657_10019263 3300025919 Bacteria 6485
270 Ga0207657_10070172 3300025919 Bacteria 2970
271 Ga0207657_10192513 3300025919 Bacteria 1644
272 Ga0207649_10939050 3300025920 Bacteria 679
273 Ga0207652_10181847 3300025921 Bacteria 1890
274 Ga0207652_10206046 3300025921 Bacteria 1770
275 Ga0207652_10214732 3300025921 Bacteria 1733
276 Ga0207652_10376959 3300025921 Bacteria 1280
277 Ga0207652_10666498 3300025921 Bacteria 930
278 Ga0207652_11568289 3300025921 Unclassified 563
279 Ga0207646_11054632 3300025922 Bacteria 717
280 Ga0207681_10032490 3300025923 Bacteria 3417
281 Ga0207694_11737218 3300025924 Bacteria 525
282 Ga0207659_10380189 3300025926 Unclassified 1177
283 Ga0207659_10691460 3300025926 Bacteria 873
284 Ga0207687_10122144 3300025927 Bacteria 1949
285 Ga0207687_10581368 3300025927 Bacteria 942
286 Ga0207700_10046780 3300025928 Bacteria 3202
287 Ga0207664_10266135 3300025929 Bacteria 1500
288 Ga0207664_11292732 3300025929 Bacteria 649
289 Ga0207690_10105670 3300025932 Bacteria 2019
290 Ga0207690_10330310 3300025932 Unclassified 1201
291 Ga0207706_10034222 3300025933 Bacteria 4520
292 Ga0207706_10079135 3300025933 Bacteria 2891
293 Ga0207706_10128113 3300025933 Bacteria 2232
294 Ga0207706_10545189 3300025933 Bacteria 999
295 Ga0207709_10063259 3300025935 Bacteria 2319
296 Ga0207709_10692588 3300025935 Bacteria 815
297 Ga0207670_10015675 3300025936 Bacteria 4534
298 Ga0207669_10797829 3300025937 Bacteria 783
299 Ga0207669_11734897 3300025937 Unclassified 533
300 Ga0207665_10388782 3300025939 Bacteria 1060
301 Ga0207711_10179951 3300025941 Bacteria 1922
302 Ga0207711_10298219 3300025941 Bacteria 1486
303 Ga0207689_10817001 3300025942 Unclassified 787
304 Ga0207679_10098964 3300025945 Bacteria 2276
305 Ga0207667_10154285 3300025949 Bacteria 2363
306 Ga0207667_10395726 3300025949 Bacteria 1407
307 Ga0207667_11613522 3300025949 Unclassified 617
308 Ga0207640_10889405 3300025981 Unclassified 777
309 Ga0207640_11652805 3300025981 Bacteria 578
310 Ga0207658_10216638 3300025986 Bacteria 1608
311 Ga0207677_10831027 3300026023 Bacteria 829
312 Ga0207639_10163344 3300026041 Bacteria 1879
313 Ga0207678_10132449 3300026067 Bacteria 2127
314 Ga0207708_10640002 3300026075 Bacteria 904
315 Ga0207702_12183638 3300026078 Unclassified 542
316 Ga0207648_10058329 3300026089 Bacteria 3367
317 Ga0207648_10191923 3300026089 Bacteria 1810
318 Ga0207648_10917847 3300026089 Bacteria 818
319 Ga0207676_11414042 3300026095 Bacteria 692
320 Ga0207674_10392848 3300026116 Bacteria 1341
321 Ga0207683_10029889 3300026121 Bacteria 4718
322 Ga0207683_10211280 3300026121 Bacteria 1766
323 Ga0207698_10509200 3300026142 Bacteria 1173
324 Ga0207698_11007605 3300026142 Bacteria 844
325 Ga0207698_11565583 3300026142 Unclassified 674
326 Ga0209969_1008696 3300027360 Bacteria 1443
327 Ga0210000_1005697 3300027462 Bacteria 1810
328 Ga0209995_1040909 3300027471 Bacteria 782
329 Ga0209968_1021237 3300027526 Bacteria 1053
330 Ga0209982_1004183 3300027552 Bacteria 2064
331 Ga0210002_1029513 3300027617 Bacteria 908
332 Ga0209966_1001176 3300027695 Bacteria 4673
333 Ga0209998_10009463 3300027717 Bacteria 2022
334 Ga0209813_10001100 3300027866 Bacteria 6040
335 Ga0207428_10000082 3300027907 Bacteria 133684
336 Ga0207428_10001078 3300027907 Bacteria 29769
337 Ga0207428_10111248 3300027907 Bacteria 2107
338 Ga0207428_11039314 3300027907 Bacteria 574
339 Ga0207428_11299269 3300027907 Bacteria 504
340 Ga0265357_1014201 3300028023 Bacteria 834
341 Ga0268265_10043339 3300028380 Bacteria 3344
342 Ga0268265_10459476 3300028380 Unclassified 1191
343 Ga0268264_10171746 3300028381 Bacteria 1961
344 Ga0265319_1161900 3300028563 Unclassified 691
345 Ga0265318_10241875 3300028577 Unclassified 658
346 Ga0265338_10001437 3300028800 Bacteria 38679
347 Ga0265338_10046571 3300028800 Bacteria 3973
348 Ga0265338_10134835 3300028800 Bacteria 1943
349 Ga0265338_10432325 3300028800 Bacteria 934
350 Ga0265338_11213533 3300028800 Unclassified 506
351 Ga0265328_10349672 3300031239 Unclassified 575
352 Ga0265320_10049948 3300031240 Bacteria 2035
353 Ga0265320_10195689 3300031240 Bacteria 903
354 Ga0265325_10000141 3300031241 Bacteria 50291
355 Ga0265325_10017307 3300031241 Bacteria 4008
356 Ga0265325_10090524 3300031241 Bacteria 1509
357 Ga0265325_10103557 3300031241 Bacteria 1390
358 Ga0265340_10020501 3300031247 Bacteria 3397
359 Ga0265340_10023384 3300031247 Bacteria 3152
360 Ga0265339_10524528 3300031249 Unclassified 546
361 Ga0265316_10150044 3300031344 Bacteria 1746
362 Ga0265316_10756025 3300031344 Unclassified 683
363 Ga0265316_10789014 3300031344 Bacteria 666
364 Ga0265313_10001334 3300031595 Bacteria 23230
365 Ga0265313_10006684 3300031595 Bacteria 8083
366 Ga0265313_10146316 3300031595 Bacteria 1013
367 Ga0265314_10020005 3300031711 Bacteria 5175
368 Ga0265342_10000841 3300031712 Bacteria 30728
369 Ga0373930_0000071 3300034816 Bacteria 9894
370 Ga0373948_0050210 3300034817 Bacteria 894
371 Ga0373958_0000121 3300034819 Bacteria 8561
372 Ga0373958_0035341 3300034819 Bacteria 1000
373 Ga0373959_0001747 3300034820 Bacteria 3470
374 Ga0373938_0000045 3300034957 Bacteria 16308
375 Ga0373926_0195144 3300035083 Bacteria 778
376 Ga0373928_0002038 3300035084 Bacteria 3935
377 Ga0373934_0013386 3300035086 Bacteria 3103
378 Ga0373934_0063393 3300035086 Bacteria 1474
379 Ga0373940_0001266 3300035088 Bacteria 4492
380 Ga0373940_0245464 3300035088 Bacteria 602
381 Ga0373944_0012601 3300035089 Bacteria 2333
382 Ga0373949_0002879 3300035090 Bacteria 4250
383 Ga0373951_0003036 3300035091 Bacteria 4156
384 Ga0373952_0000221 3300035092 Bacteria 9091
385 Ga0373923_0018198 3300035111 Bacteria 2700
386 Ga0373923_0049783 3300035111 Bacteria 1753
387 Ga0373923_0207939 3300035111 Bacteria 906
388 Ga0373932_0001518 3300035112 Bacteria 6450
389 Ga0373932_0014657 3300035112 Bacteria 1975
390 Ga0373936_0353974 3300035113 Bacteria 669
391 Ga0373939_0000875 3300035114 Bacteria 7460
392 Ga0373939_0152634 3300035114 Bacteria 842
393 Ga0373941_0013562 3300035115 Bacteria 2157
394 Ga0373945_0020170 3300035116 Bacteria 2279
395 Ga0373945_0197457 3300035116 Bacteria 834
396 Ga0373945_0358777 3300035116 Bacteria 633
397 Ga0373953_0004191 3300035117 Bacteria 4576
398 Ga0373953_0073934 3300035117 Bacteria 1409
399 Ga0373953_0410792 3300035117 Bacteria 596
400 Ga0373954_0010833 3300035118 Bacteria 4031
401 Ga0373954_0015085 3300035118 Bacteria 3452
402 Ga0373954_0025923 3300035118 Bacteria 2684
403 Ga0373954_0617224 3300035118 Bacteria 537
404 Ga0373956_0004403 3300035119 Bacteria 5639
405 Ga0373957_0003558 3300035120 Bacteria 4625
406 Ga0373957_0044793 3300035120 Bacteria 1675
407 Ga0373957_0044859 3300035120 Bacteria 1674
408 Ga0373960_0000083 3300035121 Bacteria 14021
409 Ga0373943_0269864 3300035170 Bacteria 959
410 Ga0373946_0011149 3300035171 Bacteria 3346
411 Ga0373946_0047447 3300035171 Bacteria 1784
412 Ga0373955_0000946 3300035172 Bacteria 12419
413 Ga0373955_0003642 3300035172 Bacteria 6781
414 Ga0373955_0233632 3300035172 Bacteria 1100
415 Ga0373955_0713886 3300035172 Bacteria 615
416 Ga0373942_0000535 3300035207 Bacteria 10652
417 Ga0373961_0001186 3300035241 Bacteria 8073
418 Ga0373962_0002152 3300035242 Bacteria 4701
419 Ga0373962_0165427 3300035242 Unclassified 732
420 Ga0373924_0015278 3300035410 Bacteria 2917
421 Ga0373924_0041803 3300035410 Bacteria 1879
422 Ga0373924_0043968 3300035410 Bacteria 1835
423 Ga0373931_0007820 3300035691 Bacteria 5052
424 Ga0373931_0120639 3300035691 Bacteria 1498
425 Ga0373935_0026703 3300035692 Bacteria 3566
426 Ga0373935_1360989 3300035692 Unclassified 530
427 Ga0373927_0024375 3300035695 Bacteria 3958
428 Ga0373933_0002265 3300035724 Bacteria 10966
429 Ga0373933_0037972 3300035724 Bacteria 2828
430 Ga0373933_0047863 3300035724 Bacteria 2544
431 Ga0373933_0063519 3300035724 Bacteria 2232
432 Ga0373933_0620621 3300035724 Bacteria 710
433 Ga0373947_0018586 3300035725 Bacteria 4003
434 Ga0373947_0705139 3300035725 Bacteria 689
435 Ga0373937_0000879 3300036401 Bacteria 25733
436 Ga0373937_0003184 3300036401 Bacteria 13739
437 Ga0373937_0004474 3300036401 Bacteria 11870
438 Ga0373937_0114369 3300036401 Bacteria 2512
439 Ga0373937_0194500 3300036401 Bacteria 1906
440 Ga0373937_0284914 3300036401 Unclassified 1561
441 Ga0373937_0402609 3300036401 Bacteria 1299
442 Ga0373925_0028815 3300037068 Bacteria 4071
443 Ga0373925_0725138 3300037068 Bacteria 819
444 Ga0395900_0614785 3300037418 Bacteria 1026
445 Ga0395901_0255746 3300038443 Bacteria 1824
446 Ga0395901_1907938 3300038443 Bacteria 541
447 Ga0436365_1381709 3300039437 Bacteria 630
448 Ga0439450_146676 3300042008 Bacteria 617
449 Ga0439455_0074871 3300042012 Bacteria 914
450 Ga0439434_0096394 3300042435 Bacteria 950
451 Ga0439464_0020384 3300042439 Bacteria 1816
452 Ga0439460_0038275 3300042461 Bacteria 1398
453 Ga0450893_0108521 3300042532 Bacteria 571
454 Ga0451577_0166584 3300042876 Bacteria 1985
455 Ga0439440_0139293 3300042993 Bacteria 688
456 Ga0453683_1216594 3300044673 Bacteria 505
457 Ga0466963_0903170 3300044694 Bacteria 622
458 Ga0453684_1704701 3300044712 Unclassified 644
459 Ga0453684_2383803 3300044712 Unclassified 524
460 Ga0466971_0286728 3300044719 Bacteria 789
461 Ga0466959_0249028 3300045049 Bacteria 1226
462 Ga0451576_0004698 3300045051 Bacteria 17570
463 Ga0495592_0050743 3300046454 Bacteria 3082
464 Ga0495592_0102143 3300046454 Bacteria 2042
465 Ga0495592_0200286 3300046454 Bacteria 1348
466 Ga0495603_0059610 3300046455 Bacteria 2256
467 Ga0495629_0414830 3300046459 Bacteria 914
468 Ga0495651_0000895 3300046462 Bacteria 23161
469 Ga0495651_0021886 3300046462 Bacteria 4971
470 Ga0495651_0076768 3300046462 Bacteria 2530
471 Ga0495653_0004420 3300046463 Bacteria 11365
472 Ga0495653_0089450 3300046463 Bacteria 2256
473 Ga0495653_0244568 3300046463 Bacteria 1194
474 Ga0495653_0444551 3300046463 Bacteria 816
475 Ga0495580_0670585 3300046472 Bacteria 681
476 Ga0495582_0395005 3300046473 Bacteria 797
477 Ga0495639_0135258 3300046475 Bacteria 1182
478 Ga0495664_0006433 3300046477 Bacteria 6488
479 Ga0495664_0045094 3300046477 Bacteria 2614
480 Ga0495664_0757598 3300046477 Bacteria 572
481 Ga0495594_0744423 3300046499 Unclassified 553
482 Ga0495608_0000129 3300046511 Bacteria 53862
483 Ga0495608_0073810 3300046511 Bacteria 2224
484 Ga0495608_0227804 3300046511 Bacteria 1168
485 Ga0495608_0376970 3300046511 Bacteria 870
486 Ga0495618_0003211 3300046514 Bacteria 10242
487 Ga0495618_0040562 3300046514 Bacteria 2930
488 Ga0495618_0074607 3300046514 Bacteria 2160
489 Ga0495618_0477057 3300046514 Bacteria 754
490 Ga0495628_0004609 3300046516 Bacteria 12184
491 Ga0495628_0636356 3300046516 Bacteria 758
492 Ga0495630_0331755 3300046517 Bacteria 1163
493 Ga0495630_1032043 3300046517 Bacteria 624
494 Ga0495666_0177263 3300046526 Bacteria 985
495 Ga0495652_0035109 3300046529 Bacteria 4365
496 Ga0495652_0135100 3300046529 Bacteria 1947
497 Ga0495652_0178454 3300046529 Bacteria 1632
498 Ga0495652_0590805 3300046529 Bacteria 758
499 Ga0495665_0214700 3300046531 Bacteria 995
500 Ga0495640_0007245 3300046533 Bacteria 8736
501 Ga0495586_0115804 3300046535 Bacteria 1494
502 Ga0495587_0001060 3300046536 Bacteria 18094
503 Ga0495587_0002945 3300046536 Bacteria 11379
504 Ga0495587_0096875 3300046536 Bacteria 1701
505 Ga0495645_0000974 3300046543 Bacteria 19495
506 Ga0495645_0008141 3300046543 Bacteria 7311
507 Ga0495622_0153753 3300046557 Bacteria 1040
508 Ga0495667_0006860 3300046559 Bacteria 7731
509 Ga0495667_0007026 3300046559 Bacteria 7639
510 Ga0495667_0016191 3300046559 Bacteria 5037
511 Ga0495667_0534087 3300046559 Bacteria 733
512 Ga0495667_0663597 3300046559 Bacteria 647
513 Ga0495656_0074087 3300046615 Bacteria 1520
514 Ga0495634_0017126 3300046642 Bacteria 5175
515 Ga0495634_0272628 3300046642 Bacteria 1029
516 Ga0495635_0033965 3300046663 Bacteria 3538
517 Ga0495635_0100594 3300046663 Bacteria 1976
518 Ga0495635_0124575 3300046663 Bacteria 1757
519 Ga0495657_0001374 3300046675 Bacteria 21110
520 Ga0495657_0047782 3300046675 Bacteria 2891
521 Ga0495657_0077155 3300046675 Bacteria 2162
522 Ga0495657_0309315 3300046675 Bacteria 941
523 Ga0495599_0000294 3300046678 Bacteria 30376
524 Ga0495599_0002371 3300046678 Bacteria 10951
525 Ga0495599_0409494 3300046678 Bacteria 807
526 Ga0495623_0001158 3300046679 Bacteria 17853
527 Ga0495646_0037980 3300046680 Bacteria 2975
528 Ga0495646_0071382 3300046680 Bacteria 2043
529 Ga0495647_0299561 3300046681 Bacteria 724
530 Ga0495624_0111631 3300046690 Bacteria 1680
531 Ga0495600_0000977 3300046809 Bacteria 15417
532 Ga0495600_0008473 3300046809 Bacteria 6318
533 Ga0495600_0030521 3300046809 Bacteria 3492
534 Ga0495600_0105691 3300046809 Bacteria 1834
535 Ga0495581_0421366 3300047315 Bacteria 778
536 Ga0495604_0001139 3300047317 Bacteria 22028
537 Ga0495604_0008733 3300047317 Bacteria 8009
538 Ga0495604_0016220 3300047317 Bacteria 5952
539 Ga0495604_0162429 3300047317 Bacteria 1577
540 Ga0495636_0206031 3300047318 Unclassified 899
541 Ga0495674_0010157 3300047319 Bacteria 8918
542 Ga0495674_0062334 3300047319 Bacteria 3247
543 Ga0495676_0150290 3300047321 Bacteria 1658
544 Ga0495680_0003174 3300047322 Bacteria 16366
545 Ga0495680_0003711 3300047322 Bacteria 14906
546 Ga0495680_0065679 3300047322 Bacteria 2778
547 Ga0495680_0388539 3300047322 Bacteria 965
548 Ga0495680_0789980 3300047322 Bacteria 621
549 Ga0495675_0000190 3300047444 Bacteria 44968
550 Ga0495684_0082590 3300047471 Bacteria 2437
551 Ga0495593_0019723 3300047673 Bacteria 3779
552 Ga0495593_0455347 3300047673 Bacteria 640
553 Ga0495602_0013848 3300048088 Bacteria 8223
554 Ga0495602_0018144 3300048088 Bacteria 7038
555 Ga0495602_0082549 3300048088 Bacteria 2697
556 Ga0495614_0089099 3300048089 Bacteria 1341
557 Ga0496101_0422672 3300048904 Bacteria 1050
558 Ga0496102_0045426 3300048905 Bacteria 3988
559 Ga0496102_0071286 3300048905 Bacteria 3190
560 Ga0496102_0083438 3300048905 Unclassified 2949
561 Ga0496102_0102034 3300048905 Bacteria 2666
562 Ga0496104_0035483 3300048907 Bacteria 4655
563 Ga0496104_0268074 3300048907 Bacteria 1620
564 Ga0496105_0888766 3300048908 Unclassified 672
565 Ga0496106_0024535 3300048909 Bacteria 4483
566 Ga0496106_0148887 3300048909 Bacteria 1845
567 Ga0496106_0182027 3300048909 Bacteria 1668
568 Ga0496107_0053534 3300048910 Bacteria 2911
569 Ga0496107_0190043 3300048910 Bacteria 1525
570 Ga0496107_1066766 3300048910 Bacteria 584
571 Ga0496108_0006074 3300048911 Bacteria 9765
572 Ga0496108_0131099 3300048911 Bacteria 2155
573 Ga0496109_0520694 3300048912 Bacteria 1122
574 Ga0496109_0605302 3300048912 Bacteria 1032
575 Ga0496112_0251754 3300048915 Bacteria 1717
576 Ga0496114_0097585 3300048917 Bacteria 2503
577 Ga0496115_0053154 3300048918 Bacteria 3250
578 Ga0496115_0073203 3300048918 Bacteria 2780
579 Ga0496115_0891135 3300048918 Bacteria 686
580 Ga0496115_1167739 3300048918 Bacteria 580
581 Ga0501033_0027386 3300049570 Bacteria 4285
582 Ga0501034_0825168 3300049571 Bacteria 819
583 Ga0501042_0771290 3300049578 Bacteria 700
584 Ga0501043_0281876 3300049579 Bacteria 1274
585 Ga0501046_0667829 3300049580 Bacteria 734
586 Ga0501047_0836096 3300049581 Bacteria 735
587 Ga0501047_0843243 3300049581 Bacteria 730
588 Ga0501067_0078070 3300049583 Bacteria 1835
589 Ga0501069_0218477 3300049585 Bacteria 1107
590 Ga0501070_0643167 3300049586 Bacteria 843
591 Ga0501071_0831095 3300049587 Unclassified 712
592 Ga0501072_0303289 3300049588 Bacteria 1270
593 Ga0501072_0642037 3300049588 Bacteria 836
594 Ga0501072_1010998 3300049588 Bacteria 648
595 Ga0501074_0542558 3300049590 Bacteria 823
596 Ga0501074_0630285 3300049590 Bacteria 758
597 Ga0501075_0256278 3300049591 Bacteria 1333
598 Ga0501075_0300855 3300049591 Bacteria 1222
599 Ga0501075_0457257 3300049591 Bacteria 974
600 Ga0501076_0067231 3300049592 Bacteria 2862
601 Ga0501076_0075333 3300049592 Bacteria 2705
602 Ga0501077_0032711 3300049593 Bacteria 3311
603 Ga0501077_0371641 3300049593 Bacteria 913
604 Ga0501080_1762953 3300049742 Bacteria 521
605 Ga0501081_0338446 3300049743 Bacteria 1108
606 Ga0501081_0957722 3300049743 Unclassified 646
607 Ga0501035_0320173 3300049822 Bacteria 1303
608 Ga0501044_0125510 3300049823 Bacteria 2564
609 Ga0501044_1361288 3300049823 Bacteria 576
610 nmdc:mga03683_5582_c1 3300050489 Bacteria 4256
611 nmdc:mga0k408_63606_c1 3300050493 Bacteria 2147
612 nmdc:mga0k408_900996_c1 3300050493 Bacteria 513
613 nmdc:mga06z11_719979_c1 3300050494 Unclassified 608
614 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
615 nmdc:mga05p37_50650_c1 3300050507 Bacteria 5108
616 nmdc:mga05p37_998628_c1 3300050507 Bacteria 889
617 nmdc:mga09592_39279_c1 3300050508 Bacteria 3975
618 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
619 nmdc:mga06r32_1799963_c1 3300050510 Unclassified 548
620 nmdc:mga06r32_2023_c1 3300050510 Bacteria 18128
621 nmdc:mga08y16_103927_c1 3300050511 Bacteria 2957
622 nmdc:mga08y16_202415_c1 3300050511 Bacteria 2057
623 nmdc:mga08y16_2548_c1 3300050511 Bacteria 18740
624 nmdc:mga08y16_79772_c1 3300050511 Bacteria 3412
625 nmdc:mga0n895_1651_c1 3300050512 Bacteria 16871
626 nmdc:mga0n895_394_c1 3300050512 Bacteria 29311
627 nmdc:mga0n895_45970_c1 3300050512 Bacteria 4263
628 nmdc:mga0rr50_154751_c1 3300050513 Bacteria 1856
629 nmdc:mga0rr50_18314_c1 3300050513 Bacteria 4701
630 nmdc:mga0rr50_785_c1 3300050513 Bacteria 17098
631 nmdc:mga0rr50_826474_c1 3300050513 Bacteria 790
632 nmdc:mga0rr50_999589_c1 3300050513 Bacteria 713
633 nmdc:mga08x19_620079_c1 3300050514 Bacteria 767
634 nmdc:mga08x19_78302_c1 3300050514 Bacteria 2166
635 nmdc:mga0a205_10038_c1 3300050515 Bacteria 8688
636 nmdc:mga0a205_1167_c2 3300050515 Bacteria 15903
637 nmdc:mga0a205_161153_c1 3300050515 Bacteria 2140
638 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
639 nmdc:mga0a205_906623_c1 3300050515 Bacteria 728
640 nmdc:mga0a205_934122_c1 3300050515 Unclassified 714
641 Ga0495601_0000711 3300053077 Bacteria 17861
642 Ga0495601_0001346 3300053077 Bacteria 13508
643 Ga0495601_0002495 3300053077 Bacteria 10465
644 Ga0495601_0006979 3300053077 Bacteria 6614
645 Ga0495601_0051130 3300053077 Bacteria 2608
646 Ga0495601_0525352 3300053077 Bacteria 762
647 Ga0495612_0000089 3300053078 Bacteria 40250
648 Ga0495612_0001553 3300053078 Bacteria 9464
649 Ga0495612_0017287 3300053078 Bacteria 2889
650 Ga0495612_0057435 3300053078 Bacteria 1607
651 Ga0495595_0000305 3300053084 Bacteria 19108
652 Ga0495595_0000952 3300053084 Bacteria 11135
653 Ga0495595_0005742 3300053084 Bacteria 5027
654 Ga0495595_0022830 3300053084 Bacteria 2749
655 Ga0495595_0422407 3300053084 Bacteria 676
656 Ga0495619_0000052 3300053085 Bacteria 98882
657 Ga0495619_0001206 3300053085 Bacteria 16974
658 Ga0495619_0035410 3300053085 Bacteria 3246
659 Ga0495619_0257819 3300053085 Bacteria 1208
660 Ga0495619_0282046 3300053085 Bacteria 1151
661 Ga0500566_0244864 3300053094 Bacteria 876
662 Ga0500608_276236 3300053122 Bacteria 639
663 Ga0500568_0052530 3300053139 Bacteria 1600
664 Ga0500616_0123737 3300053153 Bacteria 1231
665 Ga0500636_0385303 3300053177 Bacteria 656
666 Ga0501084_0076099 3300054114 Bacteria 2813
667 Ga0501084_0232878 3300054114 Bacteria 1555
668 Ga0501084_0711915 3300054114 Bacteria 847
669 Ga0501082_0170506 3300060353 Bacteria 1892
670 Ga0501082_0351037 3300060353 Bacteria 1286
671 Ga0530510_0545615 3300061734 Bacteria 880
672 Ga0070681_10375177
673 SwRhRL2b_contig_3134885
674 ARcpr5oldR_c000007
675 ARSoilYngRDRAFT_c00111
676 ARcpr5yngRDRAFT_c000090
677 ARSoilOldRDRAFT_c000004
678 ARCol0oldRDRAFT_c00252
679 ARCol0yngRDRAFT_1000074
680 JGI24739J22299_10120407
681 JGI24737J22298_10040242
682 JGI24751J29686_10035409
683 JGI25405J52794_10019710
684 Ga0065704_10140814
685 Ga0065712_10074224
686 Ga0065715_10001507
687 Ga0070676_10178581
688 Ga0070676_10723112
689 Ga0070683_101225567
690 Ga0070690_100016276
691 Ga0070690_100266051
692 Ga0068869_100481001
693 Ga0070680_100363287
694 Ga0070680_100498496
695 Ga0070680_101489396
696 Ga0070682_100062566
697 Ga0070682_100378969
698 Ga0070682_101036272
699 Ga0068868_100131943
700 Ga0070660_100023926
701 Ga0070660_100130906
702 Ga0070660_100212826
703 Ga0070660_100240451
704 Ga0070660_100544293
705 Ga0070660_100612262
706 Ga0070689_100132230
707 Ga0070691_10015669
708 Ga0070687_100058634
709 Ga0070661_100228093
710 Ga0070661_100859956
711 Ga0070668_100063032
712 Ga0070671_100061508
713 Ga0070674_100243238
714 Ga0070688_100007418
715 Ga0070659_100033098
716 Ga0070709_10855111
717 Ga0070714_100202442
718 Ga0070714_101009288
719 Ga0070710_10292538
720 Ga0070701_10086165
721 Ga0070701_10194971
722 Ga0070701_10376353
723 Ga0070711_100015569
724 Ga0070711_100210514
725 Ga0070711_100249465
726 Ga0070705_100024922
727 Ga0070705_100245552
728 Ga0070700_100006176
729 Ga0070694_100022606
730 Ga0070694_100255402
731 Ga0070708_100010550
732 Ga0070663_100060440
733 Ga0070663_100397782
734 Ga0070663_100527909
735 Ga0070678_100061654
736 Ga0070678_100161142
737 Ga0070662_100020477
738 Ga0070662_100060479
739 Ga0070662_100467770
740 Ga0070662_100520410
741 Ga0070681_10012985
742 Ga0070681_10035954
743 Ga0070681_10206806
744 Ga0070681_10224839
745 Ga0068867_100037428
746 Ga0068867_101011014
747 Ga0070706_100475797
748 Ga0070706_100867938
749 Ga0070707_100410356
750 Ga0070698_100194771
751 Ga0074259_10551873
752 Ga0070699_100276198
753 Ga0070679_100174499
754 Ga0070679_100178466
755 Ga0070679_100376970
756 Ga0070679_100414523
757 Ga0070679_100720363
758 Ga0070679_100961102
759 Ga0070679_101788471
760 Ga0070684_100013001
761 Ga0070684_100446112
762 Ga0068853_100265245
763 Ga0070672_100520224
764 Ga0070686_100375741
765 Ga0070695_100487841
766 Ga0070695_101137079
767 Ga0070693_100185933
768 Ga0070665_101152896
769 Ga0070704_101243516
770 Ga0068855_100047838
771 Ga0068855_100613714
772 Ga0070664_100235074
773 Ga0070664_101240334
774 Ga0068854_100412823
775 Ga0068854_100684475
776 Ga0068856_101156346
777 Ga0068856_101446061
778 Ga0068856_102137680
779 Ga0068852_100189709
780 Ga0068852_100494026
781 Ga0068852_100498989
782 Ga0068859_100029252
783 Ga0068859_101302103
784 Ga0068864_102373942
785 Ga0068866_10274370
786 Ga0068861_100348775
787 Ga0068870_10519446
788 Ga0068858_100057288
789 Ga0068858_101163939
790 Ga0068860_100020537
791 Ga0068862_100070792
792 Ga0068862_100581494
793 Ga0081455_10000002
794 Ga0081455_10027656
795 Ga0081455_10050997
796 Ga0081540_1026148
797 Ga0070717_10517872
798 Ga0075368_10019706
799 Ga0075363_100047592
800 Ga0075364_10037083
801 Ga0075432_10006215
802 Ga0075432_10132621
803 Ga0070715_10957021
804 Ga0070716_101388129
805 Ga0070712_100222014
806 Ga0075362_10032958
807 Ga0075367_10053650
808 Ga0075369_10027920
809 Ga0075366_10678908
810 Ga0075370_10081079
811 Ga0075428_100002408
812 Ga0075430_100000032
813 Ga0075431_100009024
814 Ga0075431_102131501
815 Ga0075433_10000976
816 Ga0075433_10044742
817 Ga0075433_10086034
818 Ga0075433_10319165
819 Ga0075433_11051906
820 Ga0075433_11727494
821 Ga0075434_100000341
822 Ga0075434_100027835
823 Ga0075434_100059042
824 Ga0075434_100072274
825 Ga0075434_100431350
826 Ga0075429_100000631
827 Ga0075429_101042700
828 Ga0068865_100938981
829 Ga0075436_100116041
830 Ga0075436_100756477
831 Ga0097620_100029251
832 Ga0097620_101302282
833 Ga0075435_100022993
834 Ga0075435_100049803
835 Ga0075435_100060236
836 Ga0075435_100863239
837 Ga0075435_101072839
838 Ga0105240_10028987
839 Ga0105240_10055992
840 Ga0105240_10111765
841 Ga0111539_10000915
842 Ga0111539_10001270
843 Ga0111539_10077351
844 Ga0111539_10197339
845 Ga0111539_12459714
846 Ga0105245_10039789
847 Ga0105247_10158180
848 Ga0114129_10001035
849 Ga0114129_10001551
850 Ga0114129_10654038
851 Ga0114129_11110381
852 Ga0105243_10106669
853 Ga0105243_10110965
854 Ga0105241_10096790
855 Ga0105241_10385179
856 Ga0105242_10066315
857 Ga0105242_10106058
858 Ga0105242_10301072
859 Ga0105248_10332388
860 Ga0105237_10084828
861 Ga0105237_10160503
862 Ga0105237_10683485
863 Ga0105238_11459457
864 Ga0105238_11771762
865 Ga0105249_10061774
866 Ga0105239_11050476
867 Ga0105239_12670758
868 Ga0105239_12826958
869 Ga0105239_13359783
870 Ga0105246_10141649
871 Ga0105246_10172008
872 Ga0157346_1005788
873 Ga0157323_1002789
874 Ga0157319_1043390
875 Ga0157345_1002502
876 Ga0157347_1006398
877 Ga0157339_1006073
878 Ga0157342_1047034
879 Ga0157315_1022617
880 Ga0157327_1006620
881 Ga0157326_1002939
882 Ga0157373_10032188
883 Ga0157373_10088443
884 Ga0157373_10776649
885 Ga0157373_11303407
886 Ga0157371_10124619
887 Ga0157371_10288824
888 Ga0157371_10500097
889 Ga0157370_10151577
890 Ga0157369_10355943
891 Ga0157369_10421221
892 Ga0157369_10575740
893 Ga0157369_11240425
894 Ga0157374_10045943
895 Ga0157378_10049474
896 Ga0163162_10030120
897 Ga0163162_10047201
898 Ga0163162_10955272
899 Ga0157372_10099175
900 Ga0157372_10182904
901 Ga0157375_10434633
902 Ga0157375_12628648
903 Ga0163163_12102474
904 Ga0157380_10032786
905 Ga0157380_10151915
906 Ga0157380_11007189
907 Ga0157379_10952289
908 Ga0157376_10454158
909 Ga0157376_11425947
910 Ga0163161_10220614
911 Ga0206354_10070906
912 Ga0207653_10052169
913 Ga0207688_10059983
914 Ga0207680_10105667
915 Ga0207647_10059863
916 Ga0207685_10664139
917 Ga0207645_10293008
918 Ga0207705_10204831
919 Ga0207684_10497909
920 Ga0207654_10081144
921 Ga0207707_10026505
922 Ga0207707_10167329
923 Ga0207707_10257706
924 Ga0207707_10297165
925 Ga0207707_10312794
926 Ga0207707_10318361
927 Ga0207695_10167542
928 Ga0207695_10526180
929 Ga0207695_10848468
930 Ga0207671_10496670
931 Ga0207693_10016657
932 Ga0207663_10064670
933 Ga0207660_10063690
934 Ga0207660_10150073
935 Ga0207660_10199241
936 Ga0207660_10385177
937 Ga0207660_10621581
938 Ga0207660_11383092
939 Ga0207662_10277031
940 Ga0207657_10019263
941 Ga0207657_10070172
942 Ga0207657_10192513
943 Ga0207649_10939050
944 Ga0207652_10181847
945 Ga0207652_10206046
946 Ga0207652_10214732
947 Ga0207652_10376959
948 Ga0207652_10666498
949 Ga0207652_11568289
950 Ga0207646_11054632
951 Ga0207681_10032490
952 Ga0207694_11737218
953 Ga0207659_10380189
954 Ga0207659_10691460
955 Ga0207687_10122144
956 Ga0207687_10581368
957 Ga0207700_10046780
958 Ga0207664_10266135
959 Ga0207664_11292732
960 Ga0207690_10105670
961 Ga0207690_10330310
962 Ga0207706_10034222
963 Ga0207706_10079135
964 Ga0207706_10128113
965 Ga0207706_10545189
966 Ga0207709_10063259
967 Ga0207709_10692588
968 Ga0207670_10015675
969 Ga0207669_10797829
970 Ga0207669_11734897
971 Ga0207665_10388782
972 Ga0207711_10179951
973 Ga0207711_10298219
974 Ga0207689_10817001
975 Ga0207679_10098964
976 Ga0207667_10154285
977 Ga0207667_10395726
978 Ga0207667_11613522
979 Ga0207640_10889405
980 Ga0207640_11652805
981 Ga0207658_10216638
982 Ga0207677_10831027
983 Ga0207639_10163344
984 Ga0207678_10132449
985 Ga0207708_10640002
986 Ga0207702_12183638
987 Ga0207648_10058329
988 Ga0207648_10191923
989 Ga0207648_10917847
990 Ga0207676_11414042
991 Ga0207674_10392848
992 Ga0207683_10029889
993 Ga0207683_10211280
994 Ga0207698_10509200
995 Ga0207698_11007605
996 Ga0207698_11565583
997 Ga0209969_1008696
998 Ga0210000_1005697
999 Ga0209995_1040909
1000 Ga0209968_1021237
1001 Ga0209982_1004183
1002 Ga0210002_1029513
1003 Ga0209966_1001176
1004 Ga0209998_10009463
1005 Ga0209813_10001100
1006 Ga0207428_10000082
1007 Ga0207428_10001078
1008 Ga0207428_10111248
1009 Ga0207428_11039314
1010 Ga0207428_11299269
1011 Ga0265357_1014201
1012 Ga0268265_10043339
1013 Ga0268265_10459476
1014 Ga0268264_10171746
1015 Ga0265319_1161900
1016 Ga0265318_10241875
1017 Ga0265338_10001437
1018 Ga0265338_10046571
1019 Ga0265338_10134835
1020 Ga0265338_10432325
1021 Ga0265338_11213533
1022 Ga0265328_10349672
1023 Ga0265320_10049948
1024 Ga0265320_10195689
1025 Ga0265325_10000141
1026 Ga0265325_10017307
1027 Ga0265325_10090524
1028 Ga0265325_10103557
1029 Ga0265340_10020501
1030 Ga0265340_10023384
1031 Ga0265339_10524528
1032 Ga0265316_10150044
1033 Ga0265316_10756025
1034 Ga0265316_10789014
1035 Ga0265313_10001334
1036 Ga0265313_10006684
1037 Ga0265313_10146316
1038 Ga0265314_10020005
1039 Ga0265342_10000841
1040 Ga0373930_0000071
1041 Ga0373948_0050210
1042 Ga0373958_0000121
1043 Ga0373958_0035341
1044 Ga0373959_0001747
1045 Ga0373938_0000045
1046 Ga0373926_0195144
1047 Ga0373928_0002038
1048 Ga0373934_0013386
1049 Ga0373934_0063393
1050 Ga0373940_0001266
1051 Ga0373940_0245464
1052 Ga0373944_0012601
1053 Ga0373949_0002879
1054 Ga0373951_0003036
1055 Ga0373952_0000221
1056 Ga0373923_0018198
1057 Ga0373923_0049783
1058 Ga0373923_0207939
1059 Ga0373932_0001518
1060 Ga0373932_0014657
1061 Ga0373936_0353974
1062 Ga0373939_0000875
1063 Ga0373939_0152634
1064 Ga0373941_0013562
1065 Ga0373945_0020170
1066 Ga0373945_0197457
1067 Ga0373945_0358777
1068 Ga0373953_0004191
1069 Ga0373953_0073934
1070 Ga0373953_0410792
1071 Ga0373954_0010833
1072 Ga0373954_0015085
1073 Ga0373954_0025923
1074 Ga0373954_0617224
1075 Ga0373956_0004403
1076 Ga0373957_0003558
1077 Ga0373957_0044793
1078 Ga0373957_0044859
1079 Ga0373960_0000083
1080 Ga0373943_0269864
1081 Ga0373946_0011149
1082 Ga0373946_0047447
1083 Ga0373955_0000946
1084 Ga0373955_0003642
1085 Ga0373955_0233632
1086 Ga0373955_0713886
1087 Ga0373942_0000535
1088 Ga0373961_0001186
1089 Ga0373962_0002152
1090 Ga0373962_0165427
1091 Ga0373924_0015278
1092 Ga0373924_0041803
1093 Ga0373924_0043968
1094 Ga0373931_0007820
1095 Ga0373931_0120639
1096 Ga0373935_0026703
1097 Ga0373935_1360989
1098 Ga0373927_0024375
1099 Ga0373933_0002265
1100 Ga0373933_0037972
1101 Ga0373933_0047863
1102 Ga0373933_0063519
1103 Ga0373933_0620621
1104 Ga0373947_0018586
1105 Ga0373947_0705139
1106 Ga0373937_0000879
1107 Ga0373937_0003184
1108 Ga0373937_0004474
1109 Ga0373937_0114369
1110 Ga0373937_0194500
1111 Ga0373937_0284914
1112 Ga0373937_0402609
1113 Ga0373925_0028815
1114 Ga0373925_0725138
1115 Ga0395900_0614785
1116 Ga0395901_0255746
1117 Ga0395901_1907938
1118 Ga0436365_1381709
1119 Ga0439450_146676
1120 Ga0439455_0074871
1121 Ga0439434_0096394
1122 Ga0439464_0020384
1123 Ga0439460_0038275
1124 Ga0450893_0108521
1125 Ga0451577_0166584
1126 Ga0439440_0139293
1127 Ga0453683_1216594
1128 Ga0466963_0903170
1129 Ga0453684_1704701
1130 Ga0453684_2383803
1131 Ga0466971_0286728
1132 Ga0466959_0249028
1133 Ga0451576_0004698
1134 Ga0495592_0050743
1135 Ga0495592_0102143
1136 Ga0495592_0200286
1137 Ga0495603_0059610
1138 Ga0495629_0414830
1139 Ga0495651_0000895
1140 Ga0495651_0021886
1141 Ga0495651_0076768
1142 Ga0495653_0004420
1143 Ga0495653_0089450
1144 Ga0495653_0244568
1145 Ga0495653_0444551
1146 Ga0495580_0670585
1147 Ga0495582_0395005
1148 Ga0495639_0135258
1149 Ga0495664_0006433
1150 Ga0495664_0045094
1151 Ga0495664_0757598
1152 Ga0495594_0744423
1153 Ga0495608_0000129
1154 Ga0495608_0073810
1155 Ga0495608_0227804
1156 Ga0495608_0376970
1157 Ga0495618_0003211
1158 Ga0495618_0040562
1159 Ga0495618_0074607
1160 Ga0495618_0477057
1161 Ga0495628_0004609
1162 Ga0495628_0636356
1163 Ga0495630_0331755
1164 Ga0495630_1032043
1165 Ga0495666_0177263
1166 Ga0495652_0035109
1167 Ga0495652_0135100
1168 Ga0495652_0178454
1169 Ga0495652_0590805
1170 Ga0495665_0214700
1171 Ga0495640_0007245
1172 Ga0495586_0115804
1173 Ga0495587_0001060
1174 Ga0495587_0002945
1175 Ga0495587_0096875
1176 Ga0495645_0000974
1177 Ga0495645_0008141
1178 Ga0495622_0153753
1179 Ga0495667_0006860
1180 Ga0495667_0007026
1181 Ga0495667_0016191
1182 Ga0495667_0534087
1183 Ga0495667_0663597
1184 Ga0495656_0074087
1185 Ga0495634_0017126
1186 Ga0495634_0272628
1187 Ga0495635_0033965
1188 Ga0495635_0100594
1189 Ga0495635_0124575
1190 Ga0495657_0001374
1191 Ga0495657_0047782
1192 Ga0495657_0077155
1193 Ga0495657_0309315
1194 Ga0495599_0000294
1195 Ga0495599_0002371
1196 Ga0495599_0409494
1197 Ga0495623_0001158
1198 Ga0495646_0037980
1199 Ga0495646_0071382
1200 Ga0495647_0299561
1201 Ga0495624_0111631
1202 Ga0495600_0000977
1203 Ga0495600_0008473
1204 Ga0495600_0030521
1205 Ga0495600_0105691
1206 Ga0495581_0421366
1207 Ga0495604_0001139
1208 Ga0495604_0008733
1209 Ga0495604_0016220
1210 Ga0495604_0162429
1211 Ga0495636_0206031
1212 Ga0495674_0010157
1213 Ga0495674_0062334
1214 Ga0495676_0150290
1215 Ga0495680_0003174
1216 Ga0495680_0003711
1217 Ga0495680_0065679
1218 Ga0495680_0388539
1219 Ga0495680_0789980
1220 Ga0495675_0000190
1221 Ga0495684_0082590
1222 Ga0495593_0019723
1223 Ga0495593_0455347
1224 Ga0495602_0013848
1225 Ga0495602_0018144
1226 Ga0495602_0082549
1227 Ga0495614_0089099
1228 Ga0496101_0422672
1229 Ga0496102_0045426
1230 Ga0496102_0071286
1231 Ga0496102_0083438
1232 Ga0496102_0102034
1233 Ga0496104_0035483
1234 Ga0496104_0268074
1235 Ga0496105_0888766
1236 Ga0496106_0024535
1237 Ga0496106_0148887
1238 Ga0496106_0182027
1239 Ga0496107_0053534
1240 Ga0496107_0190043
1241 Ga0496107_1066766
1242 Ga0496108_0006074
1243 Ga0496108_0131099
1244 Ga0496109_0520694
1245 Ga0496109_0605302
1246 Ga0496112_0251754
1247 Ga0496114_0097585
1248 Ga0496115_0053154
1249 Ga0496115_0073203
1250 Ga0496115_0891135
1251 Ga0496115_1167739
1252 Ga0501033_0027386
1253 Ga0501034_0825168
1254 Ga0501042_0771290
1255 Ga0501043_0281876
1256 Ga0501046_0667829
1257 Ga0501047_0836096
1258 Ga0501047_0843243
1259 Ga0501067_0078070
1260 Ga0501069_0218477
1261 Ga0501070_0643167
1262 Ga0501071_0831095
1263 Ga0501072_0303289
1264 Ga0501072_0642037
1265 Ga0501072_1010998
1266 Ga0501074_0542558
1267 Ga0501074_0630285
1268 Ga0501075_0256278
1269 Ga0501075_0300855
1270 Ga0501075_0457257
1271 Ga0501076_0067231
1272 Ga0501076_0075333
1273 Ga0501077_0032711
1274 Ga0501077_0371641
1275 Ga0501080_1762953
1276 Ga0501081_0338446
1277 Ga0501081_0957722
1278 Ga0501035_0320173
1279 Ga0501044_0125510
1280 Ga0501044_1361288
1281 nmdc:mga03683_5582_c1
1282 nmdc:mga0k408_63606_c1
1283 nmdc:mga0k408_900996_c1
1284 nmdc:mga06z11_719979_c1
1285 nmdc:mga05p37_19_c2
1286 nmdc:mga05p37_50650_c1
1287 nmdc:mga05p37_998628_c1
1288 nmdc:mga09592_39279_c1
1289 nmdc:mga0qj67_259_c1
1290 nmdc:mga06r32_1799963_c1
1291 nmdc:mga06r32_2023_c1
1292 nmdc:mga08y16_103927_c1
1293 nmdc:mga08y16_202415_c1
1294 nmdc:mga08y16_2548_c1
1295 nmdc:mga08y16_79772_c1
1296 nmdc:mga0n895_1651_c1
1297 nmdc:mga0n895_394_c1
1298 nmdc:mga0n895_45970_c1
1299 nmdc:mga0rr50_154751_c1
1300 nmdc:mga0rr50_18314_c1
1301 nmdc:mga0rr50_785_c1
1302 nmdc:mga0rr50_826474_c1
1303 nmdc:mga0rr50_999589_c1
1304 nmdc:mga08x19_620079_c1
1305 nmdc:mga08x19_78302_c1
1306 nmdc:mga0a205_10038_c1
1307 nmdc:mga0a205_1167_c2
1308 nmdc:mga0a205_161153_c1
1309 nmdc:mga0a205_249_c1
1310 nmdc:mga0a205_906623_c1
1311 nmdc:mga0a205_934122_c1
1312 Ga0495601_0000711
1313 Ga0495601_0001346
1314 Ga0495601_0002495
1315 Ga0495601_0006979
1316 Ga0495601_0051130
1317 Ga0495601_0525352
1318 Ga0495612_0000089
1319 Ga0495612_0001553
1320 Ga0495612_0017287
1321 Ga0495612_0057435
1322 Ga0495595_0000305
1323 Ga0495595_0000952
1324 Ga0495595_0005742
1325 Ga0495595_0022830
1326 Ga0495595_0422407
1327 Ga0495619_0000052
1328 Ga0495619_0001206
1329 Ga0495619_0035410
1330 Ga0495619_0257819
1331 Ga0495619_0282046
1332 Ga0500566_0244864
1333 Ga0500608_276236
1334 Ga0500568_0052530
1335 Ga0500616_0123737
1336 Ga0500636_0385303
1337 Ga0501084_0076099
1338 Ga0501084_0232878
1339 Ga0501084_0711915
1340 Ga0501082_0170506
1341 Ga0501082_0351037
1342 Ga0530510_0545615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

1

75

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.9144 2 89
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9056 2 89
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.8951 2 96
4zos-assembly1.cif.gz_C 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8894 2 94
3bm7-assembly1.cif.gz_A-2 crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution 0.8826 2 93
ID Description Score Start End Superfamily
af_Q54J03_9_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9339 2 91 3.30.70.100
af_A0A1D8PRM8_52_147_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9332 2 91 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9144 2 89 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8983 1 89 3.30.70.100
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8951 2 96 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Y5U8W9-F1-model_v4 CENP-V/GFA domain-containing protein 0.9716 2 97 GO:0016846
GO:0046872
AF-A0A2N9LVH3-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9702 2 99 GO:0004497
AF-A0A521TH10-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9693 1 99 GO:0004497
AF-A0A521ZBV9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.963 1 100 GO:0004497
AF-A0A5D0VCS5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9607 1 96 GO:0004497

Map