F474100

General Info

Members Datasets Scaffolds Average Seq Length
670 329 643 136

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100875419|Ga0307409_1008754192
Length 133
Sequence MILGLGSDTIDIRRIEKTIDRYGERFLNRLFTDIERGKSDRRRDRAASYAKRFAAKEACSKALGTGMHGVAWRDMGVVNLPSGKPTMQLTGKAAERLAAMTPAGHRPQIDISLTDDFPLAQAIVIISAVPDAG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
5 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
8 2643221568 Rhizobium sp. Root564 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
12 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
13 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
14 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
15 2849560528 Caulobacter zeae 410 Isolate Unclassified
16 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
17 2851153111 Caulobacter radicis 736 Isolate Unclassified
18 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
19 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
20 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
21 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
22 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
23 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
24 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
25 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
185 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
310 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
311 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
316 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
326 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
327 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
328 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
329 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 0
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 2.24
Nodule 0.75
Rhizoplane 6.42
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7412730 2162886012 Bacteria 1385
2 ARcpr5yngRDRAFT_c004757 3300000043 Bacteria 1271
3 Ga0065715_10268011 3300005293 Bacteria 1119
4 Ga0070683_100130330 3300005329 Bacteria 2380
5 Ga0070683_102056422 3300005329 Bacteria 549
6 Ga0070690_101176865 3300005330 Bacteria 611
7 Ga0070666_10061030 3300005335 Bacteria 2552
8 Ga0070666_10182350 3300005335 Bacteria 1473
9 Ga0070680_100003662 3300005336 Bacteria 11484
10 Ga0070680_100059149 3300005336 Bacteria 3134
11 Ga0068868_100902311 3300005338 Bacteria 803
12 Ga0068868_101848624 3300005338 Bacteria 571
13 Ga0070660_100448761 3300005339 Bacteria 1070
14 Ga0070689_100197493 3300005340 Bacteria 1641
15 Ga0070689_100295999 3300005340 Bacteria 1346
16 Ga0070691_10013483 3300005341 Bacteria 3744
17 Ga0070691_10960660 3300005341 Bacteria 531
18 Ga0070687_100751074 3300005343 Bacteria 686
19 Ga0070661_100885912 3300005344 Bacteria 736
20 Ga0070692_10210158 3300005345 Bacteria 1145
21 Ga0070668_100021251 3300005347 Bacteria 4906
22 Ga0070668_100027626 3300005347 Bacteria 4308
23 Ga0070668_100917510 3300005347 Bacteria 784
24 Ga0070669_100218271 3300005353 Bacteria 1507
25 Ga0070674_100006467 3300005356 Bacteria 6838
26 Ga0070673_100256128 3300005364 Bacteria 1527
27 Ga0070659_100543691 3300005366 Bacteria 994
28 Ga0070667_100017619 3300005367 Bacteria 5917
29 Ga0070667_100337057 3300005367 Bacteria 1363
30 Ga0070667_100684794 3300005367 Bacteria 948
31 Ga0070703_10051303 3300005406 Bacteria 1320
32 Ga0070714_102441231 3300005435 Bacteria 508
33 Ga0070701_10014155 3300005438 Bacteria 3650
34 Ga0070711_100247284 3300005439 Bacteria 1397
35 Ga0070705_100000171 3300005440 Bacteria 37880
36 Ga0070705_100279459 3300005440 Bacteria 1186
37 Ga0070705_100630295 3300005440 Bacteria 833
38 Ga0070700_100000482 3300005441 Bacteria 19974
39 Ga0070700_100095903 3300005441 Bacteria 1945
40 Ga0070700_100531114 3300005441 Bacteria 910
41 Ga0070694_100000555 3300005444 Bacteria 20563
42 Ga0070694_100096916 3300005444 Bacteria 2080
43 Ga0070708_100013464 3300005445 Bacteria 6700
44 Ga0070708_100664097 3300005445 Bacteria 982
45 Ga0070663_100002218 3300005455 Bacteria 10873
46 Ga0070663_100175047 3300005455 Bacteria 1661
47 Ga0070662_100029376 3300005457 Bacteria 3836
48 Ga0070662_100034999 3300005457 Bacteria 3544
49 Ga0070662_100052162 3300005457 Bacteria 2956
50 Ga0070662_100081080 3300005457 Bacteria 2417
51 Ga0070681_10004750 3300005458 Bacteria 13015
52 Ga0070681_11155119 3300005458 Bacteria 696
53 Ga0068867_101238439 3300005459 Bacteria 687
54 Ga0070707_100267680 3300005468 Bacteria 1662
55 Ga0070707_100285734 3300005468 Bacteria 1603
56 Ga0070707_102105393 3300005468 Bacteria 532
57 Ga0070698_100228289 3300005471 Bacteria 1795
58 Ga0070698_100492073 3300005471 Bacteria 1164
59 Ga0070699_100000167 3300005518 Bacteria 63239
60 Ga0068853_101322548 3300005539 Bacteria 697
61 Ga0070672_100928853 3300005543 Bacteria 769
62 Ga0070686_100258268 3300005544 Bacteria 1276
63 Ga0070695_100192066 3300005545 Bacteria 1454
64 Ga0070696_100000097 3300005546 Bacteria 44009
65 Ga0070696_100292825 3300005546 Bacteria 1244
66 Ga0070696_100795984 3300005546 Bacteria 778
67 Ga0070693_100057111 3300005547 Bacteria 2255
68 Ga0070693_100235970 3300005547 Bacteria 1205
69 Ga0070665_100004744 3300005548 Bacteria 14149
70 Ga0070665_100248732 3300005548 Bacteria 1778
71 Ga0070665_101282120 3300005548 Bacteria 743
72 Ga0070704_100000566 3300005549 Bacteria 17827
73 Ga0070704_100134290 3300005549 Bacteria 1923
74 Ga0070704_100650864 3300005549 Bacteria 930
75 Ga0068855_100089464 3300005563 Bacteria 3554
76 Ga0068857_100009356 3300005577 Bacteria 8508
77 Ga0068854_100521173 3300005578 Bacteria 1004
78 Ga0068856_101400144 3300005614 Bacteria 714
79 Ga0070702_100027411 3300005615 Bacteria 3074
80 Ga0070702_100149780 3300005615 Bacteria 1496
81 Ga0068852_100152582 3300005616 Bacteria 2150
82 Ga0068859_100001658 3300005617 Bacteria 22662
83 Ga0068859_100018700 3300005617 Bacteria 6962
84 Ga0068859_100138423 3300005617 Bacteria 2508
85 Ga0068864_100230011 3300005618 Bacteria 1714
86 Ga0068864_100322093 3300005618 Bacteria 1452
87 Ga0068864_100654863 3300005618 Bacteria 1023
88 Ga0068864_100927009 3300005618 Bacteria 861
89 Ga0068861_100055890 3300005719 Bacteria 3011
90 Ga0068861_100076482 3300005719 Bacteria 2609
91 Ga0068861_100078434 3300005719 Bacteria 2579
92 Ga0068851_10285585 3300005834 Bacteria 945
93 Ga0068863_100027165 3300005841 Bacteria 5459
94 Ga0068863_101289689 3300005841 Bacteria 737
95 Ga0068858_100066089 3300005842 Bacteria 3347
96 Ga0068858_100247091 3300005842 Bacteria 1694
97 Ga0068858_100287720 3300005842 Bacteria 1566
98 Ga0068858_100377541 3300005842 Bacteria 1360
99 Ga0068858_101216245 3300005842 Bacteria 741
100 Ga0068860_100001592 3300005843 Bacteria 24376
101 Ga0068860_100044929 3300005843 Bacteria 4210
102 Ga0068860_100069279 3300005843 Bacteria 3353
103 Ga0068860_100900984 3300005843 Bacteria 900
104 Ga0068862_100001428 3300005844 Bacteria 22066
105 Ga0068862_100033211 3300005844 Bacteria 4360
106 Ga0068862_100403506 3300005844 Bacteria 1279
107 Ga0070712_100495967 3300006175 Bacteria 1023
108 Ga0097621_100464354 3300006237 Bacteria 1142
109 Ga0097621_100784503 3300006237 Bacteria 882
110 Ga0068871_101154379 3300006358 Bacteria 725
111 Ga0075428_101035473 3300006844 Bacteria 868
112 Ga0075430_100545958 3300006846 Bacteria 956
113 Ga0075431_100000652 3300006847 Bacteria 29451
114 Ga0075431_100414498 3300006847 Bacteria 1347
115 Ga0075433_10024314 3300006852 Bacteria 5111
116 Ga0075433_10480909 3300006852 Bacteria 1094
117 Ga0075434_100228066 3300006871 Bacteria 1882
118 Ga0068865_100248755 3300006881 Bacteria 1402
119 Ga0068865_100620588 3300006881 Bacteria 916
120 Ga0097620_100001658 3300006931 Bacteria 22662
121 Ga0097620_100018700 3300006931 Bacteria 6962
122 Ga0097620_100138424 3300006931 Bacteria 2508
123 Ga0075435_100577628 3300007076 Bacteria 974
124 Ga0075435_100746974 3300007076 Bacteria 851
125 Ga0075435_100902436 3300007076 Bacteria 771
126 Ga0105240_10135001 3300009093 Bacteria 2955
127 Ga0105240_10195588 3300009093 Bacteria 2375
128 Ga0105240_10301352 3300009093 Bacteria 1833
129 Ga0105240_10360470 3300009093 Bacteria 1647
130 Ga0111539_10018884 3300009094 Bacteria 8529
131 Ga0105245_10151876 3300009098 Bacteria 2191
132 Ga0105245_10306002 3300009098 Bacteria 1561
133 Ga0105245_10451541 3300009098 Bacteria 1294
134 Ga0105245_10587001 3300009098 Bacteria 1139
135 Ga0114129_10189058 3300009147 Bacteria 2797
136 Ga0114129_10353743 3300009147 Bacteria 1945
137 Ga0114129_10436153 3300009147 Bacteria 1720
138 Ga0114129_10751688 3300009147 Bacteria 1248
139 Ga0105243_10090794 3300009148 Bacteria 2514
140 Ga0105243_10240159 3300009148 Bacteria 1612
141 Ga0105243_10400778 3300009148 Bacteria 1274
142 Ga0105243_10441408 3300009148 Bacteria 1219
143 Ga0105242_10157289 3300009176 Bacteria 1986
144 Ga0105248_10161255 3300009177 Bacteria 2529
145 Ga0105248_10360308 3300009177 Bacteria 1637
146 Ga0105248_12072374 3300009177 Bacteria 647
147 Ga0105238_10001483 3300009551 Bacteria 23558
148 Ga0105238_10335262 3300009551 Bacteria 1500
149 Ga0105249_10037438 3300009553 Bacteria 4403
150 Ga0105249_10043257 3300009553 Bacteria 4097
151 Ga0105249_10554876 3300009553 Bacteria 1200
152 Ga0105249_10903075 3300009553 Bacteria 950
153 Ga0105239_10168691 3300010375 Bacteria 2447
154 Ga0105239_10234600 3300010375 Bacteria 2059
155 Ga0105239_10276437 3300010375 Bacteria 1890
156 Ga0105239_10628665 3300010375 Bacteria 1225
157 Ga0105239_11645035 3300010375 Bacteria 743
158 Ga0105246_10004309 3300011119 Bacteria 8653
159 Ga0105246_10011521 3300011119 Bacteria 5489
160 Ga0105246_10244580 3300011119 Bacteria 1420
161 Ga0105246_11375049 3300011119 Bacteria 658
162 Ga0157338_1006018 3300012515 Bacteria 1110
163 Ga0157373_10282672 3300013100 Bacteria 1176
164 Ga0157371_11235545 3300013102 Bacteria 577
165 Ga0157369_10396633 3300013105 Bacteria 1432
166 Ga0157369_11484844 3300013105 Bacteria 690
167 Ga0157378_10084611 3300013297 Bacteria 2872
168 Ga0157378_10200142 3300013297 Bacteria 1889
169 Ga0157378_10421139 3300013297 Bacteria 1320
170 Ga0163162_10126833 3300013306 Bacteria 2659
171 Ga0163162_10205282 3300013306 Bacteria 2100
172 Ga0163162_10822745 3300013306 Bacteria 1045
173 Ga0163162_10893931 3300013306 Bacteria 1002
174 Ga0157372_10258767 3300013307 Bacteria 2021
175 Ga0157372_10297153 3300013307 Bacteria 1878
176 Ga0157372_10515495 3300013307 Bacteria 1394
177 Ga0157375_10072994 3300013308 Bacteria 3450
178 Ga0157375_10126363 3300013308 Bacteria 2672
179 Ga0157375_10324228 3300013308 Bacteria 1705
180 Ga0163163_10202242 3300014325 Bacteria 2035
181 Ga0163163_10229598 3300014325 Bacteria 1905
182 Ga0163163_10428995 3300014325 Bacteria 1381
183 Ga0163163_10840053 3300014325 Bacteria 982
184 Ga0163163_12596501 3300014325 Bacteria 564
185 Ga0157380_10266891 3300014326 Bacteria 1558
186 Ga0157379_10016306 3300014968 Bacteria 6536
187 Ga0157379_11214016 3300014968 Bacteria 726
188 Ga0163161_10025400 3300017792 Bacteria 4192
189 Ga0163161_10425344 3300017792 Bacteria 1069
190 Ga0163161_10473732 3300017792 Bacteria 1015
191 Ga0163161_10997841 3300017792 Bacteria 715
192 Ga0213872_10102986 3300021361 Bacteria 1271
193 Ga0213874_10132935 3300021377 Bacteria 856
194 Ga0207653_10002541 3300025885 Bacteria 5795
195 Ga0207680_10031608 3300025903 Bacteria 3000
196 Ga0207647_10145415 3300025904 Bacteria 1388
197 Ga0207645_10417234 3300025907 Bacteria 904
198 Ga0207654_10428162 3300025911 Bacteria 925
199 Ga0207707_10451114 3300025912 Bacteria 1100
200 Ga0207695_10061810 3300025913 Bacteria 3870
201 Ga0207695_10182630 3300025913 Bacteria 2018
202 Ga0207695_10403838 3300025913 Bacteria 1251
203 Ga0207671_10231775 3300025914 Bacteria 1449
204 Ga0207671_10824738 3300025914 Bacteria 735
205 Ga0207693_10077348 3300025915 Bacteria 2605
206 Ga0207660_10005384 3300025917 Bacteria 8309
207 Ga0207660_10472934 3300025917 Bacteria 1015
208 Ga0207660_10689114 3300025917 Bacteria 833
209 Ga0207662_10624943 3300025918 Bacteria 751
210 Ga0207657_10187880 3300025919 Bacteria 1668
211 Ga0207657_10312121 3300025919 Bacteria 1244
212 Ga0207646_10229402 3300025922 Bacteria 1678
213 Ga0207646_10325578 3300025922 Bacteria 1389
214 Ga0207646_11102143 3300025922 Bacteria 699
215 Ga0207681_10725594 3300025923 Bacteria 827
216 Ga0207694_10001304 3300025924 Bacteria 21470
217 Ga0207694_10139461 3300025924 Bacteria 1949
218 Ga0207687_10093656 3300025927 Bacteria 2197
219 Ga0207664_10845821 3300025929 Bacteria 822
220 Ga0207644_10962154 3300025931 Bacteria 716
221 Ga0207690_10847107 3300025932 Bacteria 757
222 Ga0207706_10110067 3300025933 Bacteria 2424
223 Ga0207706_10129735 3300025933 Bacteria 2217
224 Ga0207706_10340257 3300025933 Bacteria 1305
225 Ga0207686_10283761 3300025934 Bacteria 1223
226 Ga0207686_10552103 3300025934 Bacteria 901
227 Ga0207709_10041366 3300025935 Bacteria 2765
228 Ga0207709_10102890 3300025935 Bacteria 1892
229 Ga0207709_10105095 3300025935 Bacteria 1875
230 Ga0207670_10071600 3300025936 Bacteria 2398
231 Ga0207670_10271815 3300025936 Bacteria 1318
232 Ga0207669_10254159 3300025937 Bacteria 1310
233 Ga0207704_10575280 3300025938 Bacteria 919
234 Ga0207704_11259257 3300025938 Bacteria 632
235 Ga0207691_10883181 3300025940 Bacteria 749
236 Ga0207711_10219152 3300025941 Bacteria 1740
237 Ga0207711_10369988 3300025941 Bacteria 1329
238 Ga0207711_11151744 3300025941 Bacteria 717
239 Ga0207689_10046017 3300025942 Bacteria 3608
240 Ga0207661_10096634 3300025944 Bacteria 2472
241 Ga0207667_10390040 3300025949 Bacteria 1418
242 Ga0207667_10553330 3300025949 Bacteria 1163
243 Ga0207651_11468162 3300025960 Bacteria 614
244 Ga0207712_10024078 3300025961 Bacteria 4027
245 Ga0207712_10340422 3300025961 Bacteria 1244
246 Ga0207712_10489577 3300025961 Bacteria 1049
247 Ga0207712_10859900 3300025961 Bacteria 800
248 Ga0207668_10003322 3300025972 Bacteria 9419
249 Ga0207668_10038442 3300025972 Bacteria 3212
250 Ga0207668_10399489 3300025972 Bacteria 1162
251 Ga0207640_10130889 3300025981 Bacteria 1813
252 Ga0207640_10995842 3300025981 Bacteria 737
253 Ga0207658_10553779 3300025986 Bacteria 1029
254 Ga0207658_10653662 3300025986 Bacteria 948
255 Ga0207658_10693462 3300025986 Bacteria 920
256 Ga0207677_10313038 3300026023 Bacteria 1302
257 Ga0207703_10050402 3300026035 Bacteria 3369
258 Ga0207703_10201848 3300026035 Bacteria 1767
259 Ga0207703_10259977 3300026035 Bacteria 1569
260 Ga0207703_10962798 3300026035 Bacteria 818
261 Ga0207703_11831716 3300026035 Bacteria 583
262 Ga0207639_11218992 3300026041 Bacteria 706
263 Ga0207678_10005726 3300026067 Bacteria 11092
264 Ga0207678_10142618 3300026067 Bacteria 2045
265 Ga0207678_10800125 3300026067 Bacteria 832
266 Ga0207708_10000296 3300026075 Bacteria 39206
267 Ga0207708_10071218 3300026075 Bacteria 2663
268 Ga0207708_10553389 3300026075 Bacteria 970
269 Ga0207708_10683620 3300026075 Bacteria 876
270 Ga0207702_11591522 3300026078 Bacteria 647
271 Ga0207641_10022099 3300026088 Bacteria 5234
272 Ga0207641_11271775 3300026088 Bacteria 736
273 Ga0207648_10294933 3300026089 Bacteria 1453
274 Ga0207676_10067986 3300026095 Bacteria 2848
275 Ga0207676_10070220 3300026095 Bacteria 2808
276 Ga0207676_10556027 3300026095 Bacteria 1097
277 Ga0207676_10885382 3300026095 Bacteria 875
278 Ga0207674_10004822 3300026116 Bacteria 16164
279 Ga0207674_10185022 3300026116 Bacteria 2034
280 Ga0207674_11431300 3300026116 Bacteria 660
281 Ga0207675_100012855 3300026118 Bacteria 7819
282 Ga0207675_100043436 3300026118 Bacteria 4197
283 Ga0207675_100086733 3300026118 Bacteria 2939
284 Ga0207675_100302590 3300026118 Bacteria 1558
285 Ga0207675_100621088 3300026118 Bacteria 1085
286 Ga0207675_100741210 3300026118 Bacteria 993
287 Ga0207683_10023066 3300026121 Bacteria 5348
288 Ga0268266_10003259 3300028379 Bacteria 16360
289 Ga0268266_10076843 3300028379 Bacteria 2902
290 Ga0268266_10106531 3300028379 Bacteria 2478
291 Ga0268265_10000508 3300028380 Bacteria 40027
292 Ga0268265_10232233 3300028380 Bacteria 1622
293 Ga0268265_10331466 3300028380 Bacteria 1382
294 Ga0268265_10432025 3300028380 Bacteria 1225
295 Ga0268264_10003796 3300028381 Bacteria 12956
296 Ga0268264_10036495 3300028381 Bacteria 4050
297 Ga0268264_10751625 3300028381 Bacteria 971
298 Ga0268264_11073943 3300028381 Bacteria 813
299 Ga0268264_11091014 3300028381 Bacteria 806
300 Ga0265330_10380382 3300031235 Bacteria 597
301 Ga0265325_10066791 3300031241 Bacteria 1813
302 Ga0265340_10383306 3300031247 Bacteria 620
303 Ga0265331_10000129 3300031250 Bacteria 99170
304 Ga0265327_10000292 3300031251 Bacteria 97787
305 Ga0307513_10014267 3300031456 Bacteria 9714
306 Ga0307408_100048660 3300031548 Bacteria 3042
307 Ga0265313_10232980 3300031595 Bacteria 756
308 Ga0316579_10058415 3300031691 Bacteria 1812
309 Ga0265314_10021087 3300031711 Bacteria 5019
310 Ga0316576_10139416 3300031727 Bacteria 1825
311 Ga0307405_10148725 3300031731 Bacteria 1644
312 Ga0307413_10238592 3300031824 Bacteria 1341
313 Ga0307410_11045101 3300031852 Bacteria 706
314 Ga0307406_10527221 3300031901 Bacteria 962
315 Ga0307412_11780681 3300031911 Unclassified 566
316 Ga0307409_100875419 3300031995 Bacteria 910
317 Ga0316583_10015512 3300032133 Bacteria 2741
318 Ga0316580_10054191 3300032139 Bacteria 1234
319 Ga0373939_0274975 3300035114 Bacteria 663
320 Ga0373945_0069025 3300035116 Bacteria 1334
321 Ga0373946_0077239 3300035171 Bacteria 1451
322 Ga0373961_0210164 3300035241 Bacteria 690
323 Ga0373962_0097976 3300035242 Bacteria 911
324 Ga0373931_0024643 3300035691 Bacteria 3050
325 Ga0373935_0089753 3300035692 Bacteria 2010
326 Ga0373927_0766353 3300035695 Bacteria 637
327 Ga0316582_0706051 3300036647 Bacteria 692
328 Ga0316584_0210669 3300036712 Bacteria 1430
329 Ga0395899_0019749 3300037312 Bacteria 5116
330 Ga0436364_0530473 3300037853 Bacteria 1071
331 Ga0436364_0747645 3300037853 Bacteria 2045
332 Ga0436360_0247471 3300039438 Bacteria 826
333 Ga0436360_1199555 3300039438 Bacteria 588
334 Ga0436361_0045550 3300039447 Bacteria 6059
335 Ga0436363_1456083 3300039450 Bacteria 1652
336 Ga0439453_0024997 3300041408 Bacteria 1100
337 Ga0451802_0507537 3300041460 Bacteria 590
338 Ga0451841_1012353 3300041498 Bacteria 773
339 Ga0439435_0002941 3300042436 Bacteria 3464
340 Ga0439459_0233306 3300042438 Bacteria 514
341 Ga0466966_0024751 3300044684 Bacteria 3927
342 Ga0466961_0375228 3300044693 Bacteria 864
343 Ga0466971_0047201 3300044719 Bacteria 1936
344 Ga0466957_0701650 3300044842 Bacteria 714
345 Ga0466959_0204156 3300045049 Bacteria 1375
346 Ga0451576_1161003 3300045051 Bacteria 807
347 Ga0451576_2343035 3300045051 Bacteria 547
348 Ga0466958_0152517 3300045836 Bacteria 1458
349 Ga0495617_241172 3300046452 Bacteria 558
350 Ga0495603_0000627 3300046455 Bacteria 19818
351 Ga0495629_0007106 3300046459 Bacteria 8248
352 Ga0495641_0007313 3300046461 Bacteria 6916
353 Ga0495580_0000299 3300046472 Bacteria 40203
354 Ga0495639_0002035 3300046475 Bacteria 8950
355 Ga0495584_0026383 3300046491 Bacteria 2943
356 Ga0495584_0400180 3300046491 Bacteria 698
357 Ga0495585_0109548 3300046492 Bacteria 1470
358 Ga0495594_0000131 3300046499 Bacteria 35452
359 Ga0495607_0387675 3300046501 Bacteria 638
360 Ga0495608_0473015 3300046511 Bacteria 761
361 Ga0495616_0133079 3300046513 Bacteria 1138
362 Ga0495616_0278684 3300046513 Bacteria 711
363 Ga0495637_0101299 3300046520 Bacteria 1125
364 Ga0495665_0002454 3300046531 Bacteria 10015
365 Ga0495587_0066743 3300046536 Bacteria 2098
366 Ga0495609_0349414 3300046538 Bacteria 597
367 Ga0495622_0004321 3300046557 Bacteria 6615
368 Ga0495656_0017177 3300046615 Bacteria 2758
369 Ga0495668_0474763 3300046616 Bacteria 689
370 Ga0495634_0017557 3300046642 Bacteria 5103
371 Ga0495625_0221462 3300046660 Bacteria 1240
372 Ga0495661_0253567 3300046665 Bacteria 897
373 Ga0495588_0000613 3300046674 Bacteria 16801
374 Ga0495658_0002461 3300046683 Bacteria 9324
375 Ga0495669_0506806 3300046684 Bacteria 587
376 Ga0495624_0177926 3300046690 Bacteria 1297
377 Ga0495670_0807314 3300046691 Bacteria 512
378 Ga0495581_0000843 3300047315 Bacteria 16344
379 Ga0495581_0598538 3300047315 Bacteria 639
380 Ga0495672_0099357 3300047320 Bacteria 1582
381 Ga0495675_0513036 3300047444 Bacteria 687
382 Ga0495677_0048043 3300047445 Bacteria 1568
383 Ga0495684_0485136 3300047471 Bacteria 853
384 Ga0495602_0266929 3300048088 Bacteria 1267
385 Ga0495614_0000595 3300048089 Bacteria 15125
386 Ga0496100_0088386 3300048903 Bacteria 2109
387 Ga0496100_0230180 3300048903 Bacteria 1363
388 Ga0496101_0275972 3300048904 Bacteria 1313
389 Ga0496101_1155395 3300048904 Bacteria 607
390 Ga0496101_1186577 3300048904 Bacteria 598
391 Ga0496102_0003290 3300048905 Bacteria 13702
392 Ga0496102_0009775 3300048905 Bacteria 8250
393 Ga0496102_0114053 3300048905 Bacteria 2521
394 Ga0496102_0450756 3300048905 Bacteria 1207
395 Ga0496103_0003743 3300048906 Bacteria 9250
396 Ga0496103_0008489 3300048906 Bacteria 6104
397 Ga0496104_0023377 3300048907 Bacteria 5683
398 Ga0496104_0306877 3300048907 Bacteria 1499
399 Ga0496104_0735116 3300048907 Bacteria 894
400 Ga0496104_0837724 3300048907 Bacteria 825
401 Ga0496105_0315015 3300048908 Bacteria 1255
402 Ga0496105_0728021 3300048908 Bacteria 759
403 Ga0496106_0013938 3300048909 Bacteria 5944
404 Ga0496106_0023578 3300048909 Bacteria 4570
405 Ga0496106_0070147 3300048909 Bacteria 2676
406 Ga0496106_0264884 3300048909 Bacteria 1375
407 Ga0496107_0001227 3300048910 Bacteria 15652
408 Ga0496107_0024412 3300048910 Bacteria 4276
409 Ga0496107_0058795 3300048910 Bacteria 2780
410 Ga0496108_0117227 3300048911 Bacteria 2282
411 Ga0496108_0189284 3300048911 Bacteria 1783
412 Ga0496108_1011418 3300048911 Bacteria 709
413 Ga0496109_0011144 3300048912 Bacteria 7711
414 Ga0496109_0023962 3300048912 Bacteria 5421
415 Ga0496109_0063870 3300048912 Bacteria 3368
416 Ga0496110_0093793 3300048913 Bacteria 2687
417 Ga0496110_0484000 3300048913 Bacteria 1127
418 Ga0496111_0359525 3300048914 Bacteria 1077
419 Ga0496112_0012419 3300048915 Bacteria 7831
420 Ga0496112_0229806 3300048915 Bacteria 1810
421 Ga0496112_0904927 3300048915 Bacteria 804
422 Ga0496112_1084745 3300048915 Bacteria 719
423 Ga0496112_1127120 3300048915 Bacteria 702
424 Ga0496113_0065408 3300048916 Bacteria 2752
425 Ga0496113_0211701 3300048916 Bacteria 1543
426 Ga0496114_0006475 3300048917 Bacteria 9229
427 Ga0496115_0065176 3300048918 Bacteria 2942
428 Ga0496121_0686703 3300048924 Bacteria 618
429 Ga0496126_0301478 3300048929 Bacteria 1322
430 Ga0496126_1022797 3300048929 Bacteria 619
431 Ga0501031_0038071 3300049568 Bacteria 3139
432 Ga0501031_0496849 3300049568 Bacteria 787
433 Ga0501031_0961442 3300049568 Bacteria 546
434 Ga0501032_0025300 3300049569 Bacteria 4093
435 Ga0501032_0193534 3300049569 Bacteria 1329
436 Ga0501032_0406552 3300049569 Bacteria 874
437 Ga0501033_0111113 3300049570 Bacteria 1994
438 Ga0501033_0603605 3300049570 Bacteria 752
439 Ga0501033_0687574 3300049570 Bacteria 697
440 Ga0501034_0004261 3300049571 Bacteria 15956
441 Ga0501034_0005961 3300049571 Bacteria 13193
442 Ga0501034_0018906 3300049571 Bacteria 7058
443 Ga0501034_0231328 3300049571 Bacteria 1797
444 Ga0501036_0070372 3300049572 Bacteria 2958
445 Ga0501036_0094129 3300049572 Bacteria 2532
446 Ga0501036_0171298 3300049572 Bacteria 1829
447 Ga0501036_0179190 3300049572 Bacteria 1784
448 Ga0501036_0380133 3300049572 Bacteria 1179
449 Ga0501037_0352891 3300049573 Bacteria 1014
450 Ga0501037_0477216 3300049573 Bacteria 848
451 Ga0501037_0822883 3300049573 Bacteria 612
452 Ga0501038_0011728 3300049574 Bacteria 7995
453 Ga0501038_0062640 3300049574 Bacteria 3178
454 Ga0501038_0110360 3300049574 Bacteria 2279
455 Ga0501038_0339780 3300049574 Bacteria 1171
456 Ga0501038_0398767 3300049574 Bacteria 1065
457 Ga0501039_0042416 3300049575 Bacteria 3515
458 Ga0501039_0061840 3300049575 Bacteria 2900
459 Ga0501039_0089351 3300049575 Bacteria 2401
460 Ga0501039_0178067 3300049575 Bacteria 1672
461 Ga0501039_0183921 3300049575 Bacteria 1643
462 Ga0501039_0733426 3300049575 Bacteria 772
463 Ga0501039_1398429 3300049575 Bacteria 539
464 Ga0501040_0027155 3300049576 Bacteria 3852
465 Ga0501040_0085580 3300049576 Bacteria 2188
466 Ga0501040_0090293 3300049576 Bacteria 2129
467 Ga0501040_0249267 3300049576 Bacteria 1266
468 Ga0501040_0290747 3300049576 Bacteria 1168
469 Ga0501040_0652483 3300049576 Bacteria 760
470 Ga0501041_0017902 3300049577 Bacteria 4216
471 Ga0501041_0320879 3300049577 Bacteria 977
472 Ga0501042_0087966 3300049578 Bacteria 2229
473 Ga0501042_0093570 3300049578 Bacteria 2158
474 Ga0501042_0109144 3300049578 Bacteria 1992
475 Ga0501043_0037738 3300049579 Bacteria 3800
476 Ga0501043_0079525 3300049579 Bacteria 2576
477 Ga0501043_0127109 3300049579 Bacteria 1999
478 Ga0501043_0176369 3300049579 Bacteria 1666
479 Ga0501043_0179370 3300049579 Bacteria 1650
480 Ga0501043_0491061 3300049579 Bacteria 918
481 Ga0501046_0005370 3300049580 Bacteria 11456
482 Ga0501046_0043143 3300049580 Bacteria 3592
483 Ga0501046_0065978 3300049580 Bacteria 2822
484 Ga0501046_0112238 3300049580 Bacteria 2081
485 Ga0501046_0210691 3300049580 Bacteria 1443
486 Ga0501046_0494448 3300049580 Bacteria 876
487 Ga0501047_0102782 3300049581 Bacteria 2737
488 Ga0501047_0129543 3300049581 Bacteria 2403
489 Ga0501047_0154272 3300049581 Bacteria 2171
490 Ga0501047_0179097 3300049581 Bacteria 1986
491 Ga0501047_0310190 3300049581 Bacteria 1418
492 Ga0501047_0329015 3300049581 Bacteria 1367
493 Ga0501047_0406822 3300049581 Bacteria 1193
494 Ga0501048_0012118 3300049582 Bacteria 6425
495 Ga0501048_0019338 3300049582 Bacteria 4998
496 Ga0501048_0094546 3300049582 Bacteria 2108
497 Ga0501048_0210649 3300049582 Bacteria 1378
498 Ga0501048_0263931 3300049582 Bacteria 1223
499 Ga0501048_0673930 3300049582 Bacteria 743
500 Ga0501048_0716363 3300049582 Bacteria 719
501 Ga0501067_0001416 3300049583 Bacteria 13004
502 Ga0501067_0046177 3300049583 Bacteria 2418
503 Ga0501068_0056384 3300049584 Bacteria 2382
504 Ga0501068_0149739 3300049584 Bacteria 1466
505 Ga0501069_0431211 3300049585 Bacteria 782
506 Ga0501070_0211820 3300049586 Bacteria 1590
507 Ga0501071_0189680 3300049587 Bacteria 1541
508 Ga0501071_0281108 3300049587 Bacteria 1259
509 Ga0501071_0350578 3300049587 Bacteria 1123
510 Ga0501071_0390866 3300049587 Bacteria 1061
511 Ga0501071_0842714 3300049587 Bacteria 707
512 Ga0501072_0014249 3300049588 Bacteria 6091
513 Ga0501072_0108051 3300049588 Bacteria 2213
514 Ga0501072_0547296 3300049588 Bacteria 914
515 Ga0501072_0821301 3300049588 Bacteria 727
516 Ga0501072_1039086 3300049588 Bacteria 638
517 Ga0501072_1116412 3300049588 Bacteria 613
518 Ga0501073_0014072 3300049589 Bacteria 5812
519 Ga0501073_0146493 3300049589 Bacteria 1636
520 Ga0501073_0194547 3300049589 Bacteria 1403
521 Ga0501073_0295487 3300049589 Bacteria 1118
522 Ga0501073_0400517 3300049589 Bacteria 948
523 Ga0501073_0530605 3300049589 Bacteria 813
524 Ga0501074_0035756 3300049590 Bacteria 3599
525 Ga0501074_0056825 3300049590 Bacteria 2820
526 Ga0501074_0168670 3300049590 Bacteria 1563
527 Ga0501074_0367731 3300049590 Bacteria 1020
528 Ga0501074_0699541 3300049590 Bacteria 715
529 Ga0501075_0171395 3300049591 Bacteria 1656
530 Ga0501075_0453870 3300049591 Bacteria 977
531 Ga0501075_0765425 3300049591 Bacteria 735
532 Ga0501075_1548174 3300049591 Bacteria 502
533 Ga0501076_0029662 3300049592 Bacteria 4255
534 Ga0501076_0040748 3300049592 Bacteria 3650
535 Ga0501076_0098084 3300049592 Bacteria 2361
536 Ga0501076_0177808 3300049592 Bacteria 1734
537 Ga0501076_0211185 3300049592 Bacteria 1586
538 Ga0501076_0412659 3300049592 Bacteria 1111
539 Ga0501076_0556244 3300049592 Bacteria 946
540 Ga0501076_1138538 3300049592 Bacteria 642
541 Ga0501076_1492929 3300049592 Bacteria 555
542 Ga0501077_0012381 3300049593 Bacteria 5343
543 Ga0501077_0068503 3300049593 Bacteria 2249
544 Ga0501077_0103895 3300049593 Bacteria 1800
545 Ga0501077_0166759 3300049593 Bacteria 1399
546 Ga0501077_0185905 3300049593 Bacteria 1320
547 Ga0501077_0195592 3300049593 Bacteria 1284
548 Ga0501077_0703827 3300049593 Bacteria 649
549 Ga0501079_0014826 3300049741 Bacteria 5941
550 Ga0501079_0088493 3300049741 Bacteria 2398
551 Ga0501079_0210132 3300049741 Bacteria 1520
552 Ga0501079_0211701 3300049741 Bacteria 1514
553 Ga0501079_0263041 3300049741 Bacteria 1348
554 Ga0501080_0492198 3300049742 Bacteria 1096
555 Ga0501080_0627889 3300049742 Bacteria 952
556 Ga0501080_0831263 3300049742 Bacteria 808
557 Ga0501080_1001771 3300049742 Bacteria 725
558 Ga0501080_1297626 3300049742 Bacteria 623
559 Ga0501081_0003077 3300049743 Bacteria 10592
560 Ga0501081_0012801 3300049743 Bacteria 5515
561 Ga0501081_0043930 3300049743 Bacteria 3066
562 Ga0501081_0110113 3300049743 Bacteria 1954
563 Ga0501081_0117405 3300049743 Bacteria 1892
564 Ga0501081_1351364 3300049743 Bacteria 541
565 Ga0501083_0003409 3300049744 Bacteria 11117
566 Ga0501083_0014402 3300049744 Bacteria 5529
567 Ga0501083_0045435 3300049744 Bacteria 2971
568 Ga0501083_0099967 3300049744 Bacteria 1913
569 Ga0501083_0129767 3300049744 Bacteria 1652
570 Ga0501083_0249577 3300049744 Bacteria 1155
571 Ga0501083_0327259 3300049744 Bacteria 996
572 Ga0501083_0366336 3300049744 Bacteria 937
573 Ga0501280_003723 3300049776 Bacteria 2310
574 Ga0501035_0034629 3300049822 Bacteria 4587
575 Ga0501035_0094712 3300049822 Bacteria 2625
576 Ga0501035_0211090 3300049822 Bacteria 1661
577 Ga0501035_0328378 3300049822 Bacteria 1284
578 Ga0501044_0028936 3300049823 Bacteria 5844
579 Ga0501044_0056089 3300049823 Bacteria 4045
580 Ga0501044_0212229 3300049823 Bacteria 1889
581 Ga0501044_0289188 3300049823 Bacteria 1571
582 Ga0501044_0335099 3300049823 Bacteria 1435
583 Ga0501044_0444007 3300049823 Bacteria 1205
584 Ga0501044_1044403 3300049823 Bacteria 688
585 Ga0501045_0022567 3300049824 Bacteria 4507
586 Ga0501045_0049850 3300049824 Bacteria 3054
587 Ga0501045_0168582 3300049824 Bacteria 1631
588 Ga0501045_0545046 3300049824 Bacteria 860
589 nmdc:mga05p37_1445357_c1 3300050507 Bacteria 689
590 nmdc:mga05p37_354393_c1 3300050507 Bacteria 1727
591 nmdc:mga05p37_562706_c1 3300050507 Bacteria 1295
592 nmdc:mga0qj67_555104_c1 3300050509 Bacteria 921
593 nmdc:mga0qj67_8450_c1 3300050509 Bacteria 7639
594 nmdc:mga06r32_1315_c1 3300050510 Bacteria 22385
595 nmdc:mga06r32_404575_c1 3300050510 Bacteria 1347
596 nmdc:mga08y16_114430_c1 3300050511 Bacteria 2808
597 nmdc:mga08y16_328932_c1 3300050511 Bacteria 1572
598 nmdc:mga0n895_348068_c1 3300050512 Bacteria 1501
599 nmdc:mga0rr50_1141444_c1 3300050513 Bacteria 662
600 nmdc:mga0a205_489308_c1 3300050515 Bacteria 1088
601 nmdc:mga0a205_75071_c1 3300050515 Bacteria 3266
602 Ga0495612_0146744 3300053078 Bacteria 1025
603 Ga0495612_0211089 3300053078 Bacteria 858
604 Ga0495655_0083809 3300053083 Bacteria 916
605 Ga0495619_0004904 3300053085 Bacteria 8497
606 Ga0495619_0046494 3300053085 Bacteria 2854
607 Ga0500583_0124548 3300053092 Bacteria 1276
608 Ga0500651_0296726 3300053093 Bacteria 928
609 Ga0500566_0062953 3300053094 Bacteria 2096
610 Ga0500641_0079550 3300053096 Bacteria 1390
611 Ga0500554_081610 3300053102 Bacteria 1066
612 Ga0500555_116509 3300053103 Bacteria 669
613 Ga0500556_0000903 3300053104 Bacteria 16509
614 Ga0500562_019830 3300053108 Bacteria 1743
615 Ga0500595_030648 3300053119 Bacteria 1810
616 Ga0500642_0058722 3300053130 Bacteria 1721
617 Ga0500573_0000050 3300053140 Bacteria 95598
618 Ga0500588_0135843 3300053146 Bacteria 880
619 Ga0500616_0000139 3300053153 Bacteria 123841
620 Ga0500616_0013071 3300053153 Bacteria 4834
621 Ga0500627_0134264 3300053158 Bacteria 1118
622 Ga0501084_0009497 3300054114 Bacteria 8049
623 Ga0501084_0048742 3300054114 Bacteria 3545
624 Ga0501084_0080943 3300054114 Bacteria 2723
625 Ga0501084_0211690 3300054114 Bacteria 1635
626 Ga0501084_0335243 3300054114 Bacteria 1277
627 Ga0501084_0490384 3300054114 Bacteria 1038
628 Ga0501084_1611793 3300054114 Bacteria 543
629 Ga0501082_0007775 3300060353 Bacteria 9250
630 Ga0501082_0020366 3300060353 Bacteria 5718
631 Ga0501082_0078325 3300060353 Bacteria 2851
632 Ga0501082_0192855 3300060353 Bacteria 1772
633 Ga0501082_0405337 3300060353 Bacteria 1190
634 Ga0501082_0515768 3300060353 Bacteria 1045
635 Ga0501082_0540745 3300060353 Bacteria 1019
636 Ga0501082_0668604 3300060353 Bacteria 909
637 Ga0501082_1122709 3300060353 Bacteria 687
638 Ga0501082_1133969 3300060353 Bacteria 683
639 Ga0501082_1562402 3300060353 Bacteria 576
640 Ga0501082_1612446 3300060353 Bacteria 566
641 Ga0530510_0020365 3300061734 Bacteria 4716
642 Ga0530510_0035380 3300061734 Bacteria 3599
643 Ga0530510_0713812 3300061734 Bacteria 764

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0444007 Ga0501044_0444007_307_732 124
2 3300025914 Ga0207671_10824738 Ga0207671_108247382 126
3 3300049579 Ga0501043_0491061 Ga0501043_0491061_10_405 126
4 3300025929 Ga0207664_10845821 Ga0207664_108458212 128
5 3300049572 Ga0501036_0094129 Ga0501036_0094129_286_699 128
6 3300049573 Ga0501037_0822883 Ga0501037_0822883_168_581 128
7 3300049575 Ga0501039_0089351 Ga0501039_0089351_1253_1666 128
8 3300049576 Ga0501040_0085580 Ga0501040_0085580_1276_1689 128
9 3300049577 Ga0501041_0320879 Ga0501041_0320879_212_625 128
10 3300049578 Ga0501042_0109144 Ga0501042_0109144_681_1094 128
11 3300049582 Ga0501048_0210649 Ga0501048_0210649_385_798 128
12 3300049587 Ga0501071_0842714 Ga0501071_0842714_37_450 128
13 3300049588 Ga0501072_1116412 Ga0501072_1116412_126_539 128
14 3300049590 Ga0501074_0367731 Ga0501074_0367731_176_589 128
15 3300049592 Ga0501076_0211185 Ga0501076_0211185_583_996 128
16 3300049593 Ga0501077_0103895 Ga0501077_0103895_1347_1760 128
17 3300049741 Ga0501079_0088493 Ga0501079_0088493_1815_2228 128
18 3300049824 Ga0501045_0049850 Ga0501045_0049850_305_718 128
19 3300060353 Ga0501082_1122709 Ga0501082_1122709_254_667 128
20 3300005336 Ga0070680_100003662 Ga0070680_10000366215 129
21 3300005340 Ga0070689_100295999 Ga0070689_1002959992 129
22 3300005341 Ga0070691_10013483 Ga0070691_100134833 129
23 3300005343 Ga0070687_100751074 Ga0070687_1007510741 129
24 3300005345 Ga0070692_10210158 Ga0070692_102101582 129
25 3300005353 Ga0070669_100218271 Ga0070669_1002182711 129
26 3300005406 Ga0070703_10051303 Ga0070703_100513032 129
27 3300005438 Ga0070701_10014155 Ga0070701_100141553 129
28 3300005440 Ga0070705_100000171 Ga0070705_1000001719 129
29 3300005441 Ga0070700_100000482 Ga0070700_1000004825 129
30 3300005444 Ga0070694_100000555 Ga0070694_10000055510 129
31 3300005445 Ga0070708_100013464 Ga0070708_1000134644 129
32 3300005455 Ga0070663_100002218 Ga0070663_1000022184 129
33 3300005457 Ga0070662_100052162 Ga0070662_1000521624 129
34 3300005458 Ga0070681_10004750 Ga0070681_100047503 129
35 3300005468 Ga0070707_100285734 Ga0070707_1002857342 129
36 3300005471 Ga0070698_100492073 Ga0070698_1004920732 129
37 3300005518 Ga0070699_100000167 Ga0070699_10000016729 129
38 3300005544 Ga0070686_100258268 Ga0070686_1002582682 129
39 3300005546 Ga0070696_100000097 Ga0070696_1000000976 129
40 3300005547 Ga0070693_100057111 Ga0070693_1000571112 129
41 3300005549 Ga0070704_100000566 Ga0070704_10000056618 129
42 3300005577 Ga0068857_100009356 Ga0068857_1000093563 129
43 3300005615 Ga0070702_100149780 Ga0070702_1001497802 129
44 3300005617 Ga0068859_100001658 Ga0068859_10000165821 129
45 3300005719 Ga0068861_100055890 Ga0068861_1000558902 129
46 3300005842 Ga0068858_100247091 Ga0068858_1002470912 129
47 3300005843 Ga0068860_100001592 Ga0068860_10000159218 129
48 3300005844 Ga0068862_100001428 Ga0068862_10000142819 129
49 3300006847 Ga0075431_100000652 Ga0075431_10000065221 129
50 3300006931 Ga0097620_100001658 Ga0097620_10000165821 129
51 3300009147 Ga0114129_10353743 Ga0114129_103537432 129
52 3300009148 Ga0105243_10400778 Ga0105243_104007782 129
53 3300009553 Ga0105249_10037438 Ga0105249_100374384 129
54 3300011119 Ga0105246_10004309 Ga0105246_100043093 129
55 3300025885 Ga0207653_10002541 Ga0207653_100025413 129
56 3300025904 Ga0207647_10145415 Ga0207647_101454152 129
57 3300025917 Ga0207660_10005384 Ga0207660_100053848 129
58 3300025918 Ga0207662_10624943 Ga0207662_106249432 129
59 3300025922 Ga0207646_10325578 Ga0207646_103255782 129
60 3300025923 Ga0207681_10725594 Ga0207681_107255942 129
61 3300025933 Ga0207706_10340257 Ga0207706_103402572 129
62 3300025935 Ga0207709_10105095 Ga0207709_101050952 129
63 3300025936 Ga0207670_10071600 Ga0207670_100716003 129
64 3300025942 Ga0207689_10046017 Ga0207689_100460172 129
65 3300025961 Ga0207712_10024078 Ga0207712_100240783 129
66 3300026067 Ga0207678_10005726 Ga0207678_100057264 129
67 3300026075 Ga0207708_10000296 Ga0207708_1000029624 129
68 3300026095 Ga0207676_10067986 Ga0207676_100679864 129
69 3300026116 Ga0207674_10004822 Ga0207674_1000482219 129
70 3300026118 Ga0207675_100043436 Ga0207675_1000434361 129
71 3300028380 Ga0268265_10000508 Ga0268265_1000050817 129
72 3300028381 Ga0268264_10003796 Ga0268264_100037968 129
73 3300048903 Ga0496100_0230180 Ga0496100_0230180_821_1240 129
74 3300048904 Ga0496101_0275972 Ga0496101_0275972_563_982 129
75 3300048905 Ga0496102_0003290 Ga0496102_0003290_11167_11586 129
76 3300048906 Ga0496103_0003743 Ga0496103_0003743_4082_4501 129
77 3300048907 Ga0496104_0837724 Ga0496104_0837724_127_546 129
78 3300048909 Ga0496106_0013938 Ga0496106_0013938_971_1390 129
79 3300048910 Ga0496107_0001227 Ga0496107_0001227_4906_5325 129
80 3300048911 Ga0496108_1011418 Ga0496108_1011418_28_447 129
81 3300049570 Ga0501033_0687574 Ga0501033_0687574_248_667 129
82 3300049574 Ga0501038_0339780 Ga0501038_0339780_638_1057 129
83 3300049576 Ga0501040_0249267 Ga0501040_0249267_262_681 129
84 3300049578 Ga0501042_0087966 Ga0501042_0087966_1764_2183 129
85 3300049579 Ga0501043_0176369 Ga0501043_0176369_266_685 129
86 3300049580 Ga0501046_0043143 Ga0501046_0043143_611_1030 129
87 3300049582 Ga0501048_0673930 Ga0501048_0673930_250_672 129
88 3300049587 Ga0501071_0390866 Ga0501071_0390866_598_1017 129
89 3300049590 Ga0501074_0056825 Ga0501074_0056825_71_490 129
90 3300049590 Ga0501074_0699541 Ga0501074_0699541_249_671 129
91 3300049591 Ga0501075_0171395 Ga0501075_0171395_350_769 129
92 3300049591 Ga0501075_0765425 Ga0501075_0765425_77_499 129
93 3300049592 Ga0501076_0556244 Ga0501076_0556244_26_448 129
94 3300049592 Ga0501076_1138538 Ga0501076_1138538_68_487 129
95 3300049743 Ga0501081_0003077 Ga0501081_0003077_1558_1977 129
96 3300049743 Ga0501081_0110113 Ga0501081_0110113_687_1106 129
97 3300049824 Ga0501045_0168582 Ga0501045_0168582_462_881 129
98 3300050507 nmdc:mga05p37_354393_c1 nmdc:mga05p37_354393_c1_142_561 129
99 3300050509 nmdc:mga0qj67_8450_c1 nmdc:mga0qj67_8450_c1_3430_3849 129
100 3300050510 nmdc:mga06r32_1315_c1 nmdc:mga06r32_1315_c1_7626_8045 129
101 3300053103 Ga0500555_116509 Ga0500555_116509_81_500 129
102 3300054114 Ga0501084_0080943 Ga0501084_0080943_318_737 129
103 3300060353 Ga0501082_0078325 Ga0501082_0078325_2027_2446 129
104 3300060353 Ga0501082_0668604 Ga0501082_0668604_233_637 129
105 3300061734 Ga0530510_0020365 Ga0530510_0020365_1374_1793 129
106 iso_pu_bacteria 2510917026 2511171774 129
107 iso_pu_bacteria 2582581293 2585199256 129
108 iso_pu_bacteria 2585427633 2585995045 129
109 iso_pu_bacteria 2585427634 2585999589 129
110 iso_pu_bacteria 2791355048 2792459614 129
111 iso_pu_bacteria 2843744320 2843747269 129
112 iso_pu_bacteria 2849560528 2849560808 129
113 iso_pu_bacteria 2849573788 2849574326 129
114 iso_pu_bacteria 2851153111 2851158048 129
115 iso_pu_bacteria 2884960567 2884963926 129
116 iso_pu_bacteria 2898329390 2898333438 129
117 iso_pu_bacteria 2919171160 2919171497 129
118 iso_pu_bacteria 2585428106 2587919690 130
119 iso_pu_bacteria 2615840624 2616298206 130
120 iso_pu_bacteria 2643221568 2643855923 130
121 iso_pu_bacteria 2643221640 2644226376 130
122 iso_pu_bacteria 2643221642 2644235864 130
123 iso_pu_bacteria 2818991461 2819684196 130
124 iso_pu_bacteria 2883354860 2883357569 130
125 iso_pu_bacteria 2919166419 2919167311 130
126 iso_pu_bacteria 2978969890 2978973744 130
127 iso_pu_bacteria 2984587000 2984592015 130
128 iso_pu_bacteria 8018127388 8018131281 130
129 iso_pu_bacteria 8054460903 8054461845 130
130 iso_pu_bacteria 8054563764 8054568500 130
131 3300005336 Ga0070680_100059149 Ga0070680_1000591492 132
132 3300005439 Ga0070711_100247284 Ga0070711_1002472842 132
133 3300005563 Ga0068855_100089464 Ga0068855_1000894643 132
134 3300005616 Ga0068852_100152582 Ga0068852_1001525823 132
135 3300009093 Ga0105240_10301352 Ga0105240_103013523 132
136 3300009098 Ga0105245_10451541 Ga0105245_104515412 132
137 3300013105 Ga0157369_11484844 Ga0157369_114848441 132
138 3300013307 Ga0157372_10297153 Ga0157372_102971533 132
139 3300025912 Ga0207707_10451114 Ga0207707_104511142 132
140 3300049571 Ga0501034_0231328 Ga0501034_0231328_934_1338 132
141 3300049572 Ga0501036_0380133 Ga0501036_0380133_563_967 132
142 3300049579 Ga0501043_0127109 Ga0501043_0127109_1430_1834 132
143 3300049580 Ga0501046_0210691 Ga0501046_0210691_405_809 132
144 3300049581 Ga0501047_0310190 Ga0501047_0310190_711_1115 132
145 3300049581 Ga0501047_0406822 Ga0501047_0406822_70_474 132
146 3300049588 Ga0501072_0547296 Ga0501072_0547296_86_490 132
147 3300049742 Ga0501080_0492198 Ga0501080_0492198_518_922 132
148 3300049742 Ga0501080_1297626 Ga0501080_1297626_44_448 132
149 3300049744 Ga0501083_0014402 Ga0501083_0014402_4411_4815 132
150 3300049822 Ga0501035_0328378 Ga0501035_0328378_292_696 132
151 3300049823 Ga0501044_0056089 Ga0501044_0056089_154_558 132
152 3300053102 Ga0500554_081610 Ga0500554_081610_416_823 132
153 3300054114 Ga0501084_0211690 Ga0501084_0211690_290_694 132
154 3300060353 Ga0501082_1133969 Ga0501082_1133969_121_525 132
155 3300060353 Ga0501082_1612446 Ga0501082_1612446_121_525 132
156 iso_pu_bacteria 2842333319 2842334773 132
157 3300005335 Ga0070666_10182350 Ga0070666_101823502 133
158 3300005338 Ga0068868_101848624 Ga0068868_1018486241 133
159 3300005344 Ga0070661_100885912 Ga0070661_1008859121 133
160 3300005347 Ga0070668_100021251 Ga0070668_1000212512 133
161 3300005367 Ga0070667_100017619 Ga0070667_1000176195 133
162 3300005617 Ga0068859_100018700 Ga0068859_1000187002 133
163 3300005842 Ga0068858_100287720 Ga0068858_1002877203 133
164 3300005842 Ga0068858_100377541 Ga0068858_1003775413 133
165 3300005843 Ga0068860_100044929 Ga0068860_1000449292 133
166 3300005844 Ga0068862_100033211 Ga0068862_1000332115 133
167 3300005844 Ga0068862_100403506 Ga0068862_1004035062 133
168 3300006237 Ga0097621_100784503 Ga0097621_1007845032 133
169 3300006931 Ga0097620_100018700 Ga0097620_1000187002 133
170 3300009553 Ga0105249_10554876 Ga0105249_105548762 133
171 3300013102 Ga0157371_11235545 Ga0157371_112355451 133
172 3300014325 Ga0163163_10202242 Ga0163163_102022423 133
173 3300014325 Ga0163163_10840053 Ga0163163_108400531 133
174 3300021361 Ga0213872_10102986 Ga0213872_101029862 133
175 3300021377 Ga0213874_10132935 Ga0213874_101329352 133
176 3300025915 Ga0207693_10077348 Ga0207693_100773484 133
177 3300025934 Ga0207686_10552103 Ga0207686_105521032 133
178 3300025938 Ga0207704_10575280 Ga0207704_105752802 133
179 3300025961 Ga0207712_10489577 Ga0207712_104895772 133
180 3300025972 Ga0207668_10003322 Ga0207668_100033228 133
181 3300026035 Ga0207703_10259977 Ga0207703_102599771 133
182 3300026035 Ga0207703_11831716 Ga0207703_118317161 133
183 3300026075 Ga0207708_10553389 Ga0207708_105533892 133
184 3300026095 Ga0207676_10070220 Ga0207676_100702204 133
185 3300026118 Ga0207675_100621088 Ga0207675_1006210882 133
186 3300028380 Ga0268265_10232233 Ga0268265_102322332 133
187 3300028380 Ga0268265_10331466 Ga0268265_103314662 133
188 3300028381 Ga0268264_10036495 Ga0268264_100364952 133
189 3300031251 Ga0265327_10000292 Ga0265327_1000029232 133
190 3300031852 Ga0307410_11045101 Ga0307410_110451012 133
191 3300031911 Ga0307412_11780681 Ga0307412_117806812 133
192 3300031995 Ga0307409_100875419 Ga0307409_1008754192 133
193 3300035695 Ga0373927_0766353 Ga0373927_0766353_159_596 133
194 3300037853 Ga0436364_0747645 Ga0436364_0747645_1066_1473 133
195 3300039438 Ga0436360_1199555 Ga0436360_1199555_124_528 133
196 3300039447 Ga0436361_0045550 Ga0436361_0045550_1190_1603 133
197 3300039450 Ga0436363_1456083 Ga0436363_1456083_81_482 133
198 3300044684 Ga0466966_0024751 Ga0466966_0024751_1046_1453 133
199 3300044693 Ga0466961_0375228 Ga0466961_0375228_437_844 133
200 3300044719 Ga0466971_0047201 Ga0466971_0047201_1139_1546 133
201 3300044842 Ga0466957_0701650 Ga0466957_0701650_158_565 133
202 3300045049 Ga0466959_0204156 Ga0466959_0204156_769_1176 133
203 3300045836 Ga0466958_0152517 Ga0466958_0152517_974_1381 133
204 3300046491 Ga0495584_0400180 Ga0495584_0400180_191_628 133
205 3300046511 Ga0495608_0473015 Ga0495608_0473015_288_698 133
206 3300047320 Ga0495672_0099357 Ga0495672_0099357_300_701 133
207 3300049568 Ga0501031_0496849 Ga0501031_0496849_356_769 133
208 3300049569 Ga0501032_0025300 Ga0501032_0025300_1616_2029 133
209 3300049570 Ga0501033_0111113 Ga0501033_0111113_552_965 133
210 3300049571 Ga0501034_0004261 Ga0501034_0004261_6439_6840 133
211 3300049571 Ga0501034_0018906 Ga0501034_0018906_1351_1764 133
212 3300049572 Ga0501036_0070372 Ga0501036_0070372_2078_2491 133
213 3300049573 Ga0501037_0352891 Ga0501037_0352891_382_795 133
214 3300049574 Ga0501038_0011728 Ga0501038_0011728_717_1130 133
215 3300049575 Ga0501039_0178067 Ga0501039_0178067_685_1098 133
216 3300049579 Ga0501043_0179370 Ga0501043_0179370_635_1048 133
217 3300049580 Ga0501046_0494448 Ga0501046_0494448_220_633 133
218 3300049581 Ga0501047_0129543 Ga0501047_0129543_1713_2126 133
219 3300049581 Ga0501047_0329015 Ga0501047_0329015_184_585 133
220 3300049582 Ga0501048_0263931 Ga0501048_0263931_527_940 133
221 3300049586 Ga0501070_0211820 Ga0501070_0211820_573_986 133
222 3300049589 Ga0501073_0530605 Ga0501073_0530605_385_798 133
223 3300049744 Ga0501083_0129767 Ga0501083_0129767_893_1306 133
224 3300049822 Ga0501035_0034629 Ga0501035_0034629_3279_3692 133
225 3300049823 Ga0501044_0212229 Ga0501044_0212229_945_1358 133
226 3300049824 Ga0501045_0545046 Ga0501045_0545046_69_482 133
227 3300053153 Ga0500616_0000139 Ga0500616_0000139_41170_41583 133
228 iso_pu_bacteria 8005246636 8005251382 133
229 3300005329 Ga0070683_100130330 Ga0070683_1001303304 134
230 3300005329 Ga0070683_102056422 Ga0070683_1020564221 134
231 3300005335 Ga0070666_10061030 Ga0070666_100610303 134
232 3300005339 Ga0070660_100448761 Ga0070660_1004487612 134
233 3300005347 Ga0070668_100917510 Ga0070668_1009175102 134
234 3300005445 Ga0070708_100664097 Ga0070708_1006640972 134
235 3300005457 Ga0070662_100034999 Ga0070662_1000349994 134
236 3300005458 Ga0070681_11155119 Ga0070681_111551191 134
237 3300005468 Ga0070707_100267680 Ga0070707_1002676802 134
238 3300005471 Ga0070698_100228289 Ga0070698_1002282891 134
239 3300005539 Ga0068853_101322548 Ga0068853_1013225482 134
240 3300005543 Ga0070672_100928853 Ga0070672_1009288532 134
241 3300005547 Ga0070693_100235970 Ga0070693_1002359702 134
242 3300005548 Ga0070665_100004744 Ga0070665_10000474415 134
243 3300005548 Ga0070665_100248732 Ga0070665_1002487322 134
244 3300005548 Ga0070665_101282120 Ga0070665_1012821202 134
245 3300005614 Ga0068856_101400144 Ga0068856_1014001442 134
246 3300005618 Ga0068864_100230011 Ga0068864_1002300112 134
247 3300005618 Ga0068864_100322093 Ga0068864_1003220931 134
248 3300005618 Ga0068864_100654863 Ga0068864_1006548632 134
249 3300005834 Ga0068851_10285585 Ga0068851_102855852 134
250 3300005841 Ga0068863_100027165 Ga0068863_1000271655 134
251 3300005842 Ga0068858_100066089 Ga0068858_1000660895 134
252 3300005843 Ga0068860_100900984 Ga0068860_1009009842 134
253 3300006358 Ga0068871_101154379 Ga0068871_1011543791 134
254 3300006844 Ga0075428_101035473 Ga0075428_1010354731 134
255 3300006881 Ga0068865_100620588 Ga0068865_1006205882 134
256 3300007076 Ga0075435_100746974 Ga0075435_1007469742 134
257 3300009093 Ga0105240_10135001 Ga0105240_101350012 134
258 3300009093 Ga0105240_10195588 Ga0105240_101955883 134
259 3300009093 Ga0105240_10360470 Ga0105240_103604702 134
260 3300009098 Ga0105245_10151876 Ga0105245_101518762 134
261 3300009148 Ga0105243_10240159 Ga0105243_102401593 134
262 3300009177 Ga0105248_10360308 Ga0105248_103603082 134
263 3300009551 Ga0105238_10001483 Ga0105238_100014837 134
264 3300009551 Ga0105238_10335262 Ga0105238_103352623 134
265 3300010375 Ga0105239_10168691 Ga0105239_101686913 134
266 3300010375 Ga0105239_10276437 Ga0105239_102764373 134
267 3300010375 Ga0105239_11645035 Ga0105239_116450352 134
268 3300011119 Ga0105246_11375049 Ga0105246_113750491 134
269 3300013105 Ga0157369_10396633 Ga0157369_103966332 134
270 3300013297 Ga0157378_10084611 Ga0157378_100846112 134
271 3300013297 Ga0157378_10421139 Ga0157378_104211392 134
272 3300013307 Ga0157372_10515495 Ga0157372_105154952 134
273 3300013308 Ga0157375_10324228 Ga0157375_103242283 134
274 3300014325 Ga0163163_10229598 Ga0163163_102295982 134
275 3300014325 Ga0163163_10428995 Ga0163163_104289952 134
276 3300014325 Ga0163163_12596501 Ga0163163_125965012 134
277 3300017792 Ga0163161_10997841 Ga0163161_109978412 134
278 3300025903 Ga0207680_10031608 Ga0207680_100316083 134
279 3300025911 Ga0207654_10428162 Ga0207654_104281622 134
280 3300025913 Ga0207695_10061810 Ga0207695_100618102 134
281 3300025913 Ga0207695_10182630 Ga0207695_101826303 134
282 3300025913 Ga0207695_10403838 Ga0207695_104038382 134
283 3300025914 Ga0207671_10231775 Ga0207671_102317752 134
284 3300025919 Ga0207657_10187880 Ga0207657_101878802 134
285 3300025922 Ga0207646_10229402 Ga0207646_102294022 134
286 3300025922 Ga0207646_11102143 Ga0207646_111021432 134
287 3300025924 Ga0207694_10001304 Ga0207694_1000130413 134
288 3300025924 Ga0207694_10139461 Ga0207694_101394611 134
289 3300025933 Ga0207706_10129735 Ga0207706_101297352 134
290 3300025938 Ga0207704_11259257 Ga0207704_112592571 134
291 3300025941 Ga0207711_10369988 Ga0207711_103699882 134
292 3300025941 Ga0207711_11151744 Ga0207711_111517442 134
293 3300025944 Ga0207661_10096634 Ga0207661_100966342 134
294 3300025949 Ga0207667_10390040 Ga0207667_103900402 134
295 3300025949 Ga0207667_10553330 Ga0207667_105533302 134
296 3300025960 Ga0207651_11468162 Ga0207651_114681621 134
297 3300025986 Ga0207658_10693462 Ga0207658_106934622 134
298 3300026035 Ga0207703_10050402 Ga0207703_100504023 134
299 3300026041 Ga0207639_11218992 Ga0207639_112189921 134
300 3300026067 Ga0207678_10800125 Ga0207678_108001252 134
301 3300026078 Ga0207702_11591522 Ga0207702_115915222 134
302 3300026088 Ga0207641_10022099 Ga0207641_100220994 134
303 3300026116 Ga0207674_10185022 Ga0207674_101850222 134
304 3300026118 Ga0207675_100741210 Ga0207675_1007412102 134
305 3300026121 Ga0207683_10023066 Ga0207683_100230664 134
306 3300028379 Ga0268266_10003259 Ga0268266_1000325916 134
307 3300028379 Ga0268266_10076843 Ga0268266_100768434 134
308 3300028379 Ga0268266_10106531 Ga0268266_101065314 134
309 3300028381 Ga0268264_10751625 Ga0268264_107516252 134
310 3300028381 Ga0268264_11091014 Ga0268264_110910142 134
311 3300031235 Ga0265330_10380382 Ga0265330_103803822 134
312 3300031241 Ga0265325_10066791 Ga0265325_100667912 134
313 3300031247 Ga0265340_10383306 Ga0265340_103833062 134
314 3300031250 Ga0265331_10000129 Ga0265331_1000012996 134
315 3300031456 Ga0307513_10014267 Ga0307513_1001426711 134
316 3300031548 Ga0307408_100048660 Ga0307408_1000486604 134
317 3300031595 Ga0265313_10232980 Ga0265313_102329802 134
318 3300031711 Ga0265314_10021087 Ga0265314_100210872 134
319 3300031727 Ga0316576_10139416 Ga0316576_101394162 134
320 3300031731 Ga0307405_10148725 Ga0307405_101487252 134
321 3300031824 Ga0307413_10238592 Ga0307413_102385922 134
322 3300031901 Ga0307406_10527221 Ga0307406_105272211 134
323 3300032133 Ga0316583_10015512 Ga0316583_100155122 134
324 3300032139 Ga0316580_10054191 Ga0316580_100541912 134
325 3300036647 Ga0316582_0706051 Ga0316582_0706051_32_436 134
326 3300036712 Ga0316584_0210669 Ga0316584_0210669_286_690 134
327 3300037312 Ga0395899_0019749 Ga0395899_0019749_1630_2043 134
328 3300037853 Ga0436364_0530473 Ga0436364_0530473_440_856 134
329 3300041408 Ga0439453_0024997 Ga0439453_0024997_384_800 134
330 3300041498 Ga0451841_1012353 Ga0451841_1012353_310_714 134
331 3300042436 Ga0439435_0002941 Ga0439435_0002941_474_890 134
332 3300042438 Ga0439459_0233306 Ga0439459_0233306_65_478 134
333 3300046660 Ga0495625_0221462 Ga0495625_0221462_173_592 134
334 3300046665 Ga0495661_0253567 Ga0495661_0253567_229_636 134
335 3300047315 Ga0495581_0598538 Ga0495581_0598538_158_562 134
336 3300047445 Ga0495677_0048043 Ga0495677_0048043_242_649 134
337 3300048088 Ga0495602_0266929 Ga0495602_0266929_168_587 134
338 3300048904 Ga0496101_1155395 Ga0496101_1155395_24_437 134
339 3300048915 Ga0496112_1084745 Ga0496112_1084745_241_648 134
340 3300048915 Ga0496112_1127120 Ga0496112_1127120_23_427 134
341 3300048924 Ga0496121_0686703 Ga0496121_0686703_16_435 134
342 3300048929 Ga0496126_0301478 Ga0496126_0301478_222_635 134
343 3300048929 Ga0496126_1022797 Ga0496126_1022797_185_592 134
344 3300049568 Ga0501031_0961442 Ga0501031_0961442_71_481 134
345 3300049571 Ga0501034_0005961 Ga0501034_0005961_9570_9986 134
346 3300049575 Ga0501039_0733426 Ga0501039_0733426_110_526 134
347 3300049575 Ga0501039_1398429 Ga0501039_1398429_79_492 134
348 3300049580 Ga0501046_0005370 Ga0501046_0005370_10614_11030 134
349 3300049581 Ga0501047_0102782 Ga0501047_0102782_1771_2187 134
350 3300049581 Ga0501047_0179097 Ga0501047_0179097_1300_1716 134
351 3300049582 Ga0501048_0716363 Ga0501048_0716363_78_482 134
352 3300049583 Ga0501067_0001416 Ga0501067_0001416_5506_5910 134
353 3300049589 Ga0501073_0014072 Ga0501073_0014072_5301_5708 134
354 3300049589 Ga0501073_0146493 Ga0501073_0146493_821_1225 134
355 3300049589 Ga0501073_0400517 Ga0501073_0400517_15_419 134
356 3300049592 Ga0501076_0412659 Ga0501076_0412659_350_754 134
357 3300049593 Ga0501077_0166759 Ga0501077_0166759_923_1327 134
358 3300049593 Ga0501077_0703827 Ga0501077_0703827_210_614 134
359 3300049744 Ga0501083_0003409 Ga0501083_0003409_9143_9547 134
360 3300049744 Ga0501083_0045435 Ga0501083_0045435_599_1003 134
361 3300049744 Ga0501083_0249577 Ga0501083_0249577_40_447 134
362 3300049744 Ga0501083_0327259 Ga0501083_0327259_64_468 134
363 3300049744 Ga0501083_0366336 Ga0501083_0366336_283_708 134
364 3300049776 Ga0501280_003723 Ga0501280_003723_826_1230 134
365 3300049823 Ga0501044_0028936 Ga0501044_0028936_4585_5001 134
366 3300049823 Ga0501044_0335099 Ga0501044_0335099_20_445 134
367 3300049823 Ga0501044_1044403 Ga0501044_1044403_254_667 134
368 3300050513 nmdc:mga0rr50_1141444_c1 nmdc:mga0rr50_1141444_c1_58_465 134
369 3300053078 Ga0495612_0211089 Ga0495612_0211089_50_469 134
370 3300053085 Ga0495619_0046494 Ga0495619_0046494_1752_2159 134
371 3300053092 Ga0500583_0124548 Ga0500583_0124548_843_1247 134
372 3300053093 Ga0500651_0296726 Ga0500651_0296726_439_843 134
373 3300053096 Ga0500641_0079550 Ga0500641_0079550_620_1024 134
374 3300053104 Ga0500556_0000903 Ga0500556_0000903_3772_4185 134
375 3300053108 Ga0500562_019830 Ga0500562_019830_462_875 134
376 3300053119 Ga0500595_030648 Ga0500595_030648_337_750 134
377 3300053130 Ga0500642_0058722 Ga0500642_0058722_115_519 134
378 3300053140 Ga0500573_0000050 Ga0500573_0000050_8015_8422 134
379 3300053146 Ga0500588_0135843 Ga0500588_0135843_178_582 134
380 3300053153 Ga0500616_0013071 Ga0500616_0013071_1885_2298 134
381 3300053158 Ga0500627_0134264 Ga0500627_0134264_384_788 134
382 3300054114 Ga0501084_0009497 Ga0501084_0009497_6380_6784 134
383 3300054114 Ga0501084_0490384 Ga0501084_0490384_202_606 134
384 3300060353 Ga0501082_0007775 Ga0501082_0007775_4707_5111 134
385 3300060353 Ga0501082_0192855 Ga0501082_0192855_800_1204 134
386 3300060353 Ga0501082_0515768 Ga0501082_0515768_14_445 134
387 3300060353 Ga0501082_1562402 Ga0501082_1562402_130_546 134
388 3300039438 Ga0436360_0247471 Ga0436360_0247471_254_667 135
389 3300049576 Ga0501040_0290747 Ga0501040_0290747_633_1040 135
390 3300049592 Ga0501076_1492929 Ga0501076_1492929_88_501 135
391 3300054114 Ga0501084_1611793 Ga0501084_1611793_31_438 135
392 2162886012 MBSR1b_contig_7412730 MBSR1b_0930.00003780 136
393 3300000043 ARcpr5yngRDRAFT_c004757 ARcpr5yngRDRAFT_0047571 136
394 3300005293 Ga0065715_10268011 Ga0065715_102680112 136
395 3300005330 Ga0070690_101176865 Ga0070690_1011768652 136
396 3300005338 Ga0068868_100902311 Ga0068868_1009023111 136
397 3300005340 Ga0070689_100197493 Ga0070689_1001974933 136
398 3300005341 Ga0070691_10960660 Ga0070691_109606601 136
399 3300005347 Ga0070668_100027626 Ga0070668_1000276265 136
400 3300005356 Ga0070674_100006467 Ga0070674_1000064677 136
401 3300005364 Ga0070673_100256128 Ga0070673_1002561282 136
402 3300005366 Ga0070659_100543691 Ga0070659_1005436912 136
403 3300005367 Ga0070667_100337057 Ga0070667_1003370572 136
404 3300005367 Ga0070667_100684794 Ga0070667_1006847941 136
405 3300005435 Ga0070714_102441231 Ga0070714_1024412311 136
406 3300005440 Ga0070705_100279459 Ga0070705_1002794591 136
407 3300005440 Ga0070705_100630295 Ga0070705_1006302951 136
408 3300005441 Ga0070700_100095903 Ga0070700_1000959033 136
409 3300005441 Ga0070700_100531114 Ga0070700_1005311142 136
410 3300005444 Ga0070694_100096916 Ga0070694_1000969163 136
411 3300005455 Ga0070663_100175047 Ga0070663_1001750472 136
412 3300005457 Ga0070662_100029376 Ga0070662_1000293763 136
413 3300005457 Ga0070662_100081080 Ga0070662_1000810803 136
414 3300005459 Ga0068867_101238439 Ga0068867_1012384392 136
415 3300005468 Ga0070707_102105393 Ga0070707_1021053931 136
416 3300005545 Ga0070695_100192066 Ga0070695_1001920662 136
417 3300005546 Ga0070696_100292825 Ga0070696_1002928251 136
418 3300005546 Ga0070696_100795984 Ga0070696_1007959842 136
419 3300005549 Ga0070704_100134290 Ga0070704_1001342902 136
420 3300005549 Ga0070704_100650864 Ga0070704_1006508642 136
421 3300005578 Ga0068854_100521173 Ga0068854_1005211732 136
422 3300005615 Ga0070702_100027411 Ga0070702_1000274113 136
423 3300005617 Ga0068859_100138423 Ga0068859_1001384233 136
424 3300005618 Ga0068864_100927009 Ga0068864_1009270092 136
425 3300005719 Ga0068861_100076482 Ga0068861_1000764822 136
426 3300005719 Ga0068861_100078434 Ga0068861_1000784343 136
427 3300005841 Ga0068863_101289689 Ga0068863_1012896892 136
428 3300005842 Ga0068858_101216245 Ga0068858_1012162452 136
429 3300005843 Ga0068860_100069279 Ga0068860_1000692792 136
430 3300006175 Ga0070712_100495967 Ga0070712_1004959672 136
431 3300006237 Ga0097621_100464354 Ga0097621_1004643542 136
432 3300006846 Ga0075430_100545958 Ga0075430_1005459582 136
433 3300006847 Ga0075431_100414498 Ga0075431_1004144982 136
434 3300006852 Ga0075433_10024314 Ga0075433_100243143 136
435 3300006852 Ga0075433_10480909 Ga0075433_104809092 136
436 3300006871 Ga0075434_100228066 Ga0075434_1002280662 136
437 3300006881 Ga0068865_100248755 Ga0068865_1002487552 136
438 3300006931 Ga0097620_100138424 Ga0097620_1001384243 136
439 3300007076 Ga0075435_100577628 Ga0075435_1005776281 136
440 3300007076 Ga0075435_100902436 Ga0075435_1009024362 136
441 3300009094 Ga0111539_10018884 Ga0111539_100188844 136
442 3300009098 Ga0105245_10306002 Ga0105245_103060022 136
443 3300009098 Ga0105245_10587001 Ga0105245_105870011 136
444 3300009147 Ga0114129_10189058 Ga0114129_101890582 136
445 3300009147 Ga0114129_10436153 Ga0114129_104361533 136
446 3300009147 Ga0114129_10751688 Ga0114129_107516882 136
447 3300009148 Ga0105243_10090794 Ga0105243_100907942 136
448 3300009148 Ga0105243_10441408 Ga0105243_104414082 136
449 3300009176 Ga0105242_10157289 Ga0105242_101572892 136
450 3300009177 Ga0105248_10161255 Ga0105248_101612553 136
451 3300009177 Ga0105248_12072374 Ga0105248_120723741 136
452 3300009553 Ga0105249_10043257 Ga0105249_100432573 136
453 3300009553 Ga0105249_10903075 Ga0105249_109030751 136
454 3300010375 Ga0105239_10234600 Ga0105239_102346003 136
455 3300010375 Ga0105239_10628665 Ga0105239_106286652 136
456 3300011119 Ga0105246_10011521 Ga0105246_100115214 136
457 3300011119 Ga0105246_10244580 Ga0105246_102445802 136
458 3300012515 Ga0157338_1006018 Ga0157338_10060181 136
459 3300013100 Ga0157373_10282672 Ga0157373_102826722 136
460 3300013297 Ga0157378_10200142 Ga0157378_102001422 136
461 3300013306 Ga0163162_10126833 Ga0163162_101268334 136
462 3300013306 Ga0163162_10205282 Ga0163162_102052822 136
463 3300013306 Ga0163162_10822745 Ga0163162_108227451 136
464 3300013306 Ga0163162_10893931 Ga0163162_108939311 136
465 3300013307 Ga0157372_10258767 Ga0157372_102587673 136
466 3300013308 Ga0157375_10072994 Ga0157375_100729942 136
467 3300013308 Ga0157375_10126363 Ga0157375_101263632 136
468 3300014326 Ga0157380_10266891 Ga0157380_102668912 136
469 3300014968 Ga0157379_10016306 Ga0157379_100163063 136
470 3300014968 Ga0157379_11214016 Ga0157379_112140162 136
471 3300017792 Ga0163161_10025400 Ga0163161_100254004 136
472 3300017792 Ga0163161_10425344 Ga0163161_104253441 136
473 3300017792 Ga0163161_10473732 Ga0163161_104737321 136
474 3300025907 Ga0207645_10417234 Ga0207645_104172342 136
475 3300025917 Ga0207660_10472934 Ga0207660_104729342 136
476 3300025917 Ga0207660_10689114 Ga0207660_106891142 136
477 3300025919 Ga0207657_10312121 Ga0207657_103121212 136
478 3300025927 Ga0207687_10093656 Ga0207687_100936562 136
479 3300025931 Ga0207644_10962154 Ga0207644_109621542 136
480 3300025932 Ga0207690_10847107 Ga0207690_108471072 136
481 3300025933 Ga0207706_10110067 Ga0207706_101100673 136
482 3300025934 Ga0207686_10283761 Ga0207686_102837612 136
483 3300025935 Ga0207709_10041366 Ga0207709_100413662 136
484 3300025935 Ga0207709_10102890 Ga0207709_101028902 136
485 3300025936 Ga0207670_10271815 Ga0207670_102718152 136
486 3300025937 Ga0207669_10254159 Ga0207669_102541592 136
487 3300025940 Ga0207691_10883181 Ga0207691_108831812 136
488 3300025941 Ga0207711_10219152 Ga0207711_102191523 136
489 3300025961 Ga0207712_10340422 Ga0207712_103404222 136
490 3300025961 Ga0207712_10859900 Ga0207712_108599001 136
491 3300025972 Ga0207668_10038442 Ga0207668_100384422 136
492 3300025972 Ga0207668_10399489 Ga0207668_103994891 136
493 3300025981 Ga0207640_10130889 Ga0207640_101308891 136
494 3300025981 Ga0207640_10995842 Ga0207640_109958422 136
495 3300025986 Ga0207658_10553779 Ga0207658_105537792 136
496 3300025986 Ga0207658_10653662 Ga0207658_106536622 136
497 3300026023 Ga0207677_10313038 Ga0207677_103130382 136
498 3300026035 Ga0207703_10201848 Ga0207703_102018482 136
499 3300026035 Ga0207703_10962798 Ga0207703_109627982 136
500 3300026067 Ga0207678_10142618 Ga0207678_101426183 136
501 3300026075 Ga0207708_10071218 Ga0207708_100712182 136
502 3300026075 Ga0207708_10683620 Ga0207708_106836202 136
503 3300026088 Ga0207641_11271775 Ga0207641_112717752 136
504 3300026089 Ga0207648_10294933 Ga0207648_102949332 136
505 3300026095 Ga0207676_10556027 Ga0207676_105560272 136
506 3300026095 Ga0207676_10885382 Ga0207676_108853822 136
507 3300026116 Ga0207674_11431300 Ga0207674_114313002 136
508 3300026118 Ga0207675_100012855 Ga0207675_1000128553 136
509 3300026118 Ga0207675_100086733 Ga0207675_1000867332 136
510 3300026118 Ga0207675_100302590 Ga0207675_1003025902 136
511 3300028380 Ga0268265_10432025 Ga0268265_104320252 136
512 3300028381 Ga0268264_11073943 Ga0268264_110739431 136
513 3300031691 Ga0316579_10058415 Ga0316579_100584152 136
514 3300035114 Ga0373939_0274975 Ga0373939_0274975_94_507 136
515 3300035116 Ga0373945_0069025 Ga0373945_0069025_581_991 136
516 3300035171 Ga0373946_0077239 Ga0373946_0077239_437_847 136
517 3300035241 Ga0373961_0210164 Ga0373961_0210164_116_526 136
518 3300035242 Ga0373962_0097976 Ga0373962_0097976_169_582 136
519 3300035691 Ga0373931_0024643 Ga0373931_0024643_314_727 136
520 3300035692 Ga0373935_0089753 Ga0373935_0089753_181_591 136
521 3300041460 Ga0451802_0507537 Ga0451802_0507537_28_447 136
522 3300045051 Ga0451576_1161003 Ga0451576_1161003_36_446 136
523 3300045051 Ga0451576_2343035 Ga0451576_2343035_75_488 136
524 3300046452 Ga0495617_241172 Ga0495617_241172_84_494 136
525 3300046455 Ga0495603_0000627 Ga0495603_0000627_528_938 136
526 3300046459 Ga0495629_0007106 Ga0495629_0007106_3367_3777 136
527 3300046461 Ga0495641_0007313 Ga0495641_0007313_2267_2677 136
528 3300046472 Ga0495580_0000299 Ga0495580_0000299_33603_34013 136
529 3300046475 Ga0495639_0002035 Ga0495639_0002035_8013_8423 136
530 3300046491 Ga0495584_0026383 Ga0495584_0026383_2449_2859 136
531 3300046492 Ga0495585_0109548 Ga0495585_0109548_184_594 136
532 3300046499 Ga0495594_0000131 Ga0495594_0000131_16024_16434 136
533 3300046501 Ga0495607_0387675 Ga0495607_0387675_142_552 136
534 3300046513 Ga0495616_0133079 Ga0495616_0133079_599_1009 136
535 3300046513 Ga0495616_0278684 Ga0495616_0278684_232_645 136
536 3300046520 Ga0495637_0101299 Ga0495637_0101299_244_657 136
537 3300046531 Ga0495665_0002454 Ga0495665_0002454_5110_5520 136
538 3300046536 Ga0495587_0066743 Ga0495587_0066743_883_1293 136
539 3300046538 Ga0495609_0349414 Ga0495609_0349414_108_518 136
540 3300046557 Ga0495622_0004321 Ga0495622_0004321_5472_5882 136
541 3300046615 Ga0495656_0017177 Ga0495656_0017177_1839_2249 136
542 3300046616 Ga0495668_0474763 Ga0495668_0474763_59_469 136
543 3300046642 Ga0495634_0017557 Ga0495634_0017557_115_525 136
544 3300046674 Ga0495588_0000613 Ga0495588_0000613_10545_10955 136
545 3300046683 Ga0495658_0002461 Ga0495658_0002461_361_771 136
546 3300046684 Ga0495669_0506806 Ga0495669_0506806_149_562 136
547 3300046690 Ga0495624_0177926 Ga0495624_0177926_652_1062 136
548 3300046691 Ga0495670_0807314 Ga0495670_0807314_38_448 136
549 3300047315 Ga0495581_0000843 Ga0495581_0000843_13629_14039 136
550 3300047444 Ga0495675_0513036 Ga0495675_0513036_100_510 136
551 3300047471 Ga0495684_0485136 Ga0495684_0485136_207_617 136
552 3300048089 Ga0495614_0000595 Ga0495614_0000595_1708_2118 136
553 3300048903 Ga0496100_0088386 Ga0496100_0088386_1395_1805 136
554 3300048904 Ga0496101_1186577 Ga0496101_1186577_176_586 136
555 3300048905 Ga0496102_0009775 Ga0496102_0009775_4313_4726 136
556 3300048905 Ga0496102_0114053 Ga0496102_0114053_476_886 136
557 3300048905 Ga0496102_0450756 Ga0496102_0450756_630_1040 136
558 3300048906 Ga0496103_0008489 Ga0496103_0008489_3904_4317 136
559 3300048907 Ga0496104_0023377 Ga0496104_0023377_3475_3885 136
560 3300048907 Ga0496104_0306877 Ga0496104_0306877_74_484 136
561 3300048907 Ga0496104_0735116 Ga0496104_0735116_241_654 136
562 3300048908 Ga0496105_0315015 Ga0496105_0315015_693_1103 136
563 3300048908 Ga0496105_0728021 Ga0496105_0728021_113_523 136
564 3300048909 Ga0496106_0023578 Ga0496106_0023578_3578_3988 136
565 3300048909 Ga0496106_0070147 Ga0496106_0070147_2173_2583 136
566 3300048909 Ga0496106_0264884 Ga0496106_0264884_779_1192 136
567 3300048910 Ga0496107_0024412 Ga0496107_0024412_1325_1735 136
568 3300048910 Ga0496107_0058795 Ga0496107_0058795_469_882 136
569 3300048911 Ga0496108_0117227 Ga0496108_0117227_1538_1948 136
570 3300048911 Ga0496108_0189284 Ga0496108_0189284_731_1141 136
571 3300048912 Ga0496109_0011144 Ga0496109_0011144_3748_4158 136
572 3300048912 Ga0496109_0023962 Ga0496109_0023962_1939_2349 136
573 3300048912 Ga0496109_0063870 Ga0496109_0063870_1834_2247 136
574 3300048913 Ga0496110_0093793 Ga0496110_0093793_1693_2106 136
575 3300048913 Ga0496110_0484000 Ga0496110_0484000_329_739 136
576 3300048914 Ga0496111_0359525 Ga0496111_0359525_545_955 136
577 3300048915 Ga0496112_0012419 Ga0496112_0012419_6939_7349 136
578 3300048915 Ga0496112_0229806 Ga0496112_0229806_463_873 136
579 3300048915 Ga0496112_0904927 Ga0496112_0904927_223_636 136
580 3300048916 Ga0496113_0065408 Ga0496113_0065408_1854_2264 136
581 3300048916 Ga0496113_0211701 Ga0496113_0211701_498_911 136
582 3300048917 Ga0496114_0006475 Ga0496114_0006475_4426_4836 136
583 3300048918 Ga0496115_0065176 Ga0496115_0065176_662_1072 136
584 3300049568 Ga0501031_0038071 Ga0501031_0038071_1969_2382 136
585 3300049569 Ga0501032_0193534 Ga0501032_0193534_52_465 136
586 3300049569 Ga0501032_0406552 Ga0501032_0406552_249_662 136
587 3300049570 Ga0501033_0603605 Ga0501033_0603605_208_621 136
588 3300049572 Ga0501036_0171298 Ga0501036_0171298_501_914 136
589 3300049572 Ga0501036_0179190 Ga0501036_0179190_502_912 136
590 3300049573 Ga0501037_0477216 Ga0501037_0477216_82_495 136
591 3300049574 Ga0501038_0062640 Ga0501038_0062640_580_993 136
592 3300049574 Ga0501038_0110360 Ga0501038_0110360_1754_2167 136
593 3300049574 Ga0501038_0398767 Ga0501038_0398767_26_439 136
594 3300049575 Ga0501039_0042416 Ga0501039_0042416_2362_2775 136
595 3300049575 Ga0501039_0061840 Ga0501039_0061840_1051_1464 136
596 3300049575 Ga0501039_0183921 Ga0501039_0183921_1197_1610 136
597 3300049576 Ga0501040_0027155 Ga0501040_0027155_298_711 136
598 3300049576 Ga0501040_0090293 Ga0501040_0090293_412_825 136
599 3300049576 Ga0501040_0652483 Ga0501040_0652483_24_437 136
600 3300049577 Ga0501041_0017902 Ga0501041_0017902_303_716 136
601 3300049578 Ga0501042_0093570 Ga0501042_0093570_1473_1886 136
602 3300049579 Ga0501043_0037738 Ga0501043_0037738_1413_1826 136
603 3300049579 Ga0501043_0079525 Ga0501043_0079525_2042_2455 136
604 3300049580 Ga0501046_0065978 Ga0501046_0065978_81_494 136
605 3300049580 Ga0501046_0112238 Ga0501046_0112238_1605_2018 136
606 3300049581 Ga0501047_0154272 Ga0501047_0154272_1107_1520 136
607 3300049582 Ga0501048_0012118 Ga0501048_0012118_4870_5283 136
608 3300049582 Ga0501048_0019338 Ga0501048_0019338_3468_3881 136
609 3300049582 Ga0501048_0094546 Ga0501048_0094546_529_942 136
610 3300049583 Ga0501067_0046177 Ga0501067_0046177_194_604 136
611 3300049584 Ga0501068_0056384 Ga0501068_0056384_911_1324 136
612 3300049584 Ga0501068_0149739 Ga0501068_0149739_125_538 136
613 3300049585 Ga0501069_0431211 Ga0501069_0431211_32_445 136
614 3300049587 Ga0501071_0189680 Ga0501071_0189680_787_1200 136
615 3300049587 Ga0501071_0281108 Ga0501071_0281108_92_502 136
616 3300049587 Ga0501071_0350578 Ga0501071_0350578_145_558 136
617 3300049588 Ga0501072_0014249 Ga0501072_0014249_4211_4624 136
618 3300049588 Ga0501072_0108051 Ga0501072_0108051_786_1199 136
619 3300049588 Ga0501072_0821301 Ga0501072_0821301_59_472 136
620 3300049588 Ga0501072_1039086 Ga0501072_1039086_118_531 136
621 3300049589 Ga0501073_0194547 Ga0501073_0194547_638_1048 136
622 3300049589 Ga0501073_0295487 Ga0501073_0295487_682_1095 136
623 3300049590 Ga0501074_0035756 Ga0501074_0035756_2116_2529 136
624 3300049590 Ga0501074_0168670 Ga0501074_0168670_1066_1479 136
625 3300049591 Ga0501075_0453870 Ga0501075_0453870_472_885 136
626 3300049591 Ga0501075_1548174 Ga0501075_1548174_70_480 136
627 3300049592 Ga0501076_0029662 Ga0501076_0029662_70_483 136
628 3300049592 Ga0501076_0040748 Ga0501076_0040748_184_597 136
629 3300049592 Ga0501076_0098084 Ga0501076_0098084_558_971 136
630 3300049592 Ga0501076_0177808 Ga0501076_0177808_729_1142 136
631 3300049593 Ga0501077_0012381 Ga0501077_0012381_4214_4627 136
632 3300049593 Ga0501077_0068503 Ga0501077_0068503_642_1055 136
633 3300049593 Ga0501077_0185905 Ga0501077_0185905_604_1014 136
634 3300049593 Ga0501077_0195592 Ga0501077_0195592_642_1055 136
635 3300049741 Ga0501079_0014826 Ga0501079_0014826_4567_4980 136
636 3300049741 Ga0501079_0210132 Ga0501079_0210132_1053_1463 136
637 3300049741 Ga0501079_0211701 Ga0501079_0211701_603_1013 136
638 3300049741 Ga0501079_0263041 Ga0501079_0263041_630_1043 136
639 3300049742 Ga0501080_0627889 Ga0501080_0627889_28_441 136
640 3300049742 Ga0501080_0831263 Ga0501080_0831263_148_561 136
641 3300049742 Ga0501080_1001771 Ga0501080_1001771_37_447 136
642 3300049743 Ga0501081_0012801 Ga0501081_0012801_4979_5392 136
643 3300049743 Ga0501081_0043930 Ga0501081_0043930_217_630 136
644 3300049743 Ga0501081_0117405 Ga0501081_0117405_94_507 136
645 3300049743 Ga0501081_1351364 Ga0501081_1351364_79_492 136
646 3300049744 Ga0501083_0099967 Ga0501083_0099967_1468_1881 136
647 3300049822 Ga0501035_0094712 Ga0501035_0094712_205_618 136
648 3300049822 Ga0501035_0211090 Ga0501035_0211090_657_1070 136
649 3300049823 Ga0501044_0289188 Ga0501044_0289188_741_1154 136
650 3300049824 Ga0501045_0022567 Ga0501045_0022567_3794_4207 136
651 3300050507 nmdc:mga05p37_1445357_c1 nmdc:mga05p37_1445357_c1_80_490 136
652 3300050507 nmdc:mga05p37_562706_c1 nmdc:mga05p37_562706_c1_772_1185 136
653 3300050509 nmdc:mga0qj67_555104_c1 nmdc:mga0qj67_555104_c1_432_845 136
654 3300050510 nmdc:mga06r32_404575_c1 nmdc:mga06r32_404575_c1_290_712 136
655 3300050511 nmdc:mga08y16_114430_c1 nmdc:mga08y16_114430_c1_2062_2472 136
656 3300050511 nmdc:mga08y16_328932_c1 nmdc:mga08y16_328932_c1_224_637 136
657 3300050512 nmdc:mga0n895_348068_c1 nmdc:mga0n895_348068_c1_116_526 136
658 3300050515 nmdc:mga0a205_489308_c1 nmdc:mga0a205_489308_c1_203_613 136
659 3300050515 nmdc:mga0a205_75071_c1 nmdc:mga0a205_75071_c1_1138_1548 136
660 3300053078 Ga0495612_0146744 Ga0495612_0146744_153_563 136
661 3300053083 Ga0495655_0083809 Ga0495655_0083809_300_713 136
662 3300053085 Ga0495619_0004904 Ga0495619_0004904_8044_8454 136
663 3300053094 Ga0500566_0062953 Ga0500566_0062953_387_797 136
664 3300054114 Ga0501084_0048742 Ga0501084_0048742_2716_3129 136
665 3300054114 Ga0501084_0335243 Ga0501084_0335243_812_1225 136
666 3300060353 Ga0501082_0020366 Ga0501082_0020366_396_809 136
667 3300060353 Ga0501082_0405337 Ga0501082_0405337_59_472 136
668 3300060353 Ga0501082_0540745 Ga0501082_0540745_85_498 136
669 3300061734 Ga0530510_0035380 Ga0530510_0035380_312_725 136
670 3300061734 Ga0530510_0713812 Ga0530510_0713812_278_691 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9391 1 128
5xuh-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.9265 1 128
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.921 4 128
5xu7-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9209 1 128
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9178 1 128
ID Description Score Start End Superfamily
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9092 1 128 3.90.470.20
5xukA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8987 5 128 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8948 1 128 3.90.470.20
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8893 4 128 3.90.470.20
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.886 2 127 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A1E4ATP7-F1-model_v4 deleted 0.9981 1 115
AF-A0A397KZG9-F1-model_v4 deleted 0.9941 1 132
AF-A0A525KPW6-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9932 1 132 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A257J4Q7-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9929 1 132 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7R7YEP3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9926 1 133 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Feature Viewer

pLDDT pTM Quality
94.54 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map