F474100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 329 | 643 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100875419|Ga0307409_1008754192 |
| Length | 133 |
| Sequence | MILGLGSDTIDIRRIEKTIDRYGERFLNRLFTDIERGKSDRRRDRAASYAKRFAAKEACSKALGTGMHGVAWRDMGVVNLPSGKPTMQLTGKAAERLAAMTPAGHRPQIDISLTDDFPLAQAIVIISAVPDAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 3 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 4 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 5 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 6 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 7 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 8 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 9 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 10 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 11 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 12 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 13 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 14 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 15 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 16 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 17 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 18 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 19 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 20 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 21 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 22 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 23 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 24 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 25 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 185 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 202 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 310 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 311 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 314 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 317 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 319 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 320 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 326 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 327 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 328 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 329 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.97 |
| Metatranscriptomes | 0 |
| Isolates | 4.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 2.24 |
| Nodule | 0.75 |
| Rhizoplane | 6.42 |
| Rhizosphere | 87.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_7412730 | 2162886012 | Bacteria | 1385 |
| 2 | ARcpr5yngRDRAFT_c004757 | 3300000043 | Bacteria | 1271 |
| 3 | Ga0065715_10268011 | 3300005293 | Bacteria | 1119 |
| 4 | Ga0070683_100130330 | 3300005329 | Bacteria | 2380 |
| 5 | Ga0070683_102056422 | 3300005329 | Bacteria | 549 |
| 6 | Ga0070690_101176865 | 3300005330 | Bacteria | 611 |
| 7 | Ga0070666_10061030 | 3300005335 | Bacteria | 2552 |
| 8 | Ga0070666_10182350 | 3300005335 | Bacteria | 1473 |
| 9 | Ga0070680_100003662 | 3300005336 | Bacteria | 11484 |
| 10 | Ga0070680_100059149 | 3300005336 | Bacteria | 3134 |
| 11 | Ga0068868_100902311 | 3300005338 | Bacteria | 803 |
| 12 | Ga0068868_101848624 | 3300005338 | Bacteria | 571 |
| 13 | Ga0070660_100448761 | 3300005339 | Bacteria | 1070 |
| 14 | Ga0070689_100197493 | 3300005340 | Bacteria | 1641 |
| 15 | Ga0070689_100295999 | 3300005340 | Bacteria | 1346 |
| 16 | Ga0070691_10013483 | 3300005341 | Bacteria | 3744 |
| 17 | Ga0070691_10960660 | 3300005341 | Bacteria | 531 |
| 18 | Ga0070687_100751074 | 3300005343 | Bacteria | 686 |
| 19 | Ga0070661_100885912 | 3300005344 | Bacteria | 736 |
| 20 | Ga0070692_10210158 | 3300005345 | Bacteria | 1145 |
| 21 | Ga0070668_100021251 | 3300005347 | Bacteria | 4906 |
| 22 | Ga0070668_100027626 | 3300005347 | Bacteria | 4308 |
| 23 | Ga0070668_100917510 | 3300005347 | Bacteria | 784 |
| 24 | Ga0070669_100218271 | 3300005353 | Bacteria | 1507 |
| 25 | Ga0070674_100006467 | 3300005356 | Bacteria | 6838 |
| 26 | Ga0070673_100256128 | 3300005364 | Bacteria | 1527 |
| 27 | Ga0070659_100543691 | 3300005366 | Bacteria | 994 |
| 28 | Ga0070667_100017619 | 3300005367 | Bacteria | 5917 |
| 29 | Ga0070667_100337057 | 3300005367 | Bacteria | 1363 |
| 30 | Ga0070667_100684794 | 3300005367 | Bacteria | 948 |
| 31 | Ga0070703_10051303 | 3300005406 | Bacteria | 1320 |
| 32 | Ga0070714_102441231 | 3300005435 | Bacteria | 508 |
| 33 | Ga0070701_10014155 | 3300005438 | Bacteria | 3650 |
| 34 | Ga0070711_100247284 | 3300005439 | Bacteria | 1397 |
| 35 | Ga0070705_100000171 | 3300005440 | Bacteria | 37880 |
| 36 | Ga0070705_100279459 | 3300005440 | Bacteria | 1186 |
| 37 | Ga0070705_100630295 | 3300005440 | Bacteria | 833 |
| 38 | Ga0070700_100000482 | 3300005441 | Bacteria | 19974 |
| 39 | Ga0070700_100095903 | 3300005441 | Bacteria | 1945 |
| 40 | Ga0070700_100531114 | 3300005441 | Bacteria | 910 |
| 41 | Ga0070694_100000555 | 3300005444 | Bacteria | 20563 |
| 42 | Ga0070694_100096916 | 3300005444 | Bacteria | 2080 |
| 43 | Ga0070708_100013464 | 3300005445 | Bacteria | 6700 |
| 44 | Ga0070708_100664097 | 3300005445 | Bacteria | 982 |
| 45 | Ga0070663_100002218 | 3300005455 | Bacteria | 10873 |
| 46 | Ga0070663_100175047 | 3300005455 | Bacteria | 1661 |
| 47 | Ga0070662_100029376 | 3300005457 | Bacteria | 3836 |
| 48 | Ga0070662_100034999 | 3300005457 | Bacteria | 3544 |
| 49 | Ga0070662_100052162 | 3300005457 | Bacteria | 2956 |
| 50 | Ga0070662_100081080 | 3300005457 | Bacteria | 2417 |
| 51 | Ga0070681_10004750 | 3300005458 | Bacteria | 13015 |
| 52 | Ga0070681_11155119 | 3300005458 | Bacteria | 696 |
| 53 | Ga0068867_101238439 | 3300005459 | Bacteria | 687 |
| 54 | Ga0070707_100267680 | 3300005468 | Bacteria | 1662 |
| 55 | Ga0070707_100285734 | 3300005468 | Bacteria | 1603 |
| 56 | Ga0070707_102105393 | 3300005468 | Bacteria | 532 |
| 57 | Ga0070698_100228289 | 3300005471 | Bacteria | 1795 |
| 58 | Ga0070698_100492073 | 3300005471 | Bacteria | 1164 |
| 59 | Ga0070699_100000167 | 3300005518 | Bacteria | 63239 |
| 60 | Ga0068853_101322548 | 3300005539 | Bacteria | 697 |
| 61 | Ga0070672_100928853 | 3300005543 | Bacteria | 769 |
| 62 | Ga0070686_100258268 | 3300005544 | Bacteria | 1276 |
| 63 | Ga0070695_100192066 | 3300005545 | Bacteria | 1454 |
| 64 | Ga0070696_100000097 | 3300005546 | Bacteria | 44009 |
| 65 | Ga0070696_100292825 | 3300005546 | Bacteria | 1244 |
| 66 | Ga0070696_100795984 | 3300005546 | Bacteria | 778 |
| 67 | Ga0070693_100057111 | 3300005547 | Bacteria | 2255 |
| 68 | Ga0070693_100235970 | 3300005547 | Bacteria | 1205 |
| 69 | Ga0070665_100004744 | 3300005548 | Bacteria | 14149 |
| 70 | Ga0070665_100248732 | 3300005548 | Bacteria | 1778 |
| 71 | Ga0070665_101282120 | 3300005548 | Bacteria | 743 |
| 72 | Ga0070704_100000566 | 3300005549 | Bacteria | 17827 |
| 73 | Ga0070704_100134290 | 3300005549 | Bacteria | 1923 |
| 74 | Ga0070704_100650864 | 3300005549 | Bacteria | 930 |
| 75 | Ga0068855_100089464 | 3300005563 | Bacteria | 3554 |
| 76 | Ga0068857_100009356 | 3300005577 | Bacteria | 8508 |
| 77 | Ga0068854_100521173 | 3300005578 | Bacteria | 1004 |
| 78 | Ga0068856_101400144 | 3300005614 | Bacteria | 714 |
| 79 | Ga0070702_100027411 | 3300005615 | Bacteria | 3074 |
| 80 | Ga0070702_100149780 | 3300005615 | Bacteria | 1496 |
| 81 | Ga0068852_100152582 | 3300005616 | Bacteria | 2150 |
| 82 | Ga0068859_100001658 | 3300005617 | Bacteria | 22662 |
| 83 | Ga0068859_100018700 | 3300005617 | Bacteria | 6962 |
| 84 | Ga0068859_100138423 | 3300005617 | Bacteria | 2508 |
| 85 | Ga0068864_100230011 | 3300005618 | Bacteria | 1714 |
| 86 | Ga0068864_100322093 | 3300005618 | Bacteria | 1452 |
| 87 | Ga0068864_100654863 | 3300005618 | Bacteria | 1023 |
| 88 | Ga0068864_100927009 | 3300005618 | Bacteria | 861 |
| 89 | Ga0068861_100055890 | 3300005719 | Bacteria | 3011 |
| 90 | Ga0068861_100076482 | 3300005719 | Bacteria | 2609 |
| 91 | Ga0068861_100078434 | 3300005719 | Bacteria | 2579 |
| 92 | Ga0068851_10285585 | 3300005834 | Bacteria | 945 |
| 93 | Ga0068863_100027165 | 3300005841 | Bacteria | 5459 |
| 94 | Ga0068863_101289689 | 3300005841 | Bacteria | 737 |
| 95 | Ga0068858_100066089 | 3300005842 | Bacteria | 3347 |
| 96 | Ga0068858_100247091 | 3300005842 | Bacteria | 1694 |
| 97 | Ga0068858_100287720 | 3300005842 | Bacteria | 1566 |
| 98 | Ga0068858_100377541 | 3300005842 | Bacteria | 1360 |
| 99 | Ga0068858_101216245 | 3300005842 | Bacteria | 741 |
| 100 | Ga0068860_100001592 | 3300005843 | Bacteria | 24376 |
| 101 | Ga0068860_100044929 | 3300005843 | Bacteria | 4210 |
| 102 | Ga0068860_100069279 | 3300005843 | Bacteria | 3353 |
| 103 | Ga0068860_100900984 | 3300005843 | Bacteria | 900 |
| 104 | Ga0068862_100001428 | 3300005844 | Bacteria | 22066 |
| 105 | Ga0068862_100033211 | 3300005844 | Bacteria | 4360 |
| 106 | Ga0068862_100403506 | 3300005844 | Bacteria | 1279 |
| 107 | Ga0070712_100495967 | 3300006175 | Bacteria | 1023 |
| 108 | Ga0097621_100464354 | 3300006237 | Bacteria | 1142 |
| 109 | Ga0097621_100784503 | 3300006237 | Bacteria | 882 |
| 110 | Ga0068871_101154379 | 3300006358 | Bacteria | 725 |
| 111 | Ga0075428_101035473 | 3300006844 | Bacteria | 868 |
| 112 | Ga0075430_100545958 | 3300006846 | Bacteria | 956 |
| 113 | Ga0075431_100000652 | 3300006847 | Bacteria | 29451 |
| 114 | Ga0075431_100414498 | 3300006847 | Bacteria | 1347 |
| 115 | Ga0075433_10024314 | 3300006852 | Bacteria | 5111 |
| 116 | Ga0075433_10480909 | 3300006852 | Bacteria | 1094 |
| 117 | Ga0075434_100228066 | 3300006871 | Bacteria | 1882 |
| 118 | Ga0068865_100248755 | 3300006881 | Bacteria | 1402 |
| 119 | Ga0068865_100620588 | 3300006881 | Bacteria | 916 |
| 120 | Ga0097620_100001658 | 3300006931 | Bacteria | 22662 |
| 121 | Ga0097620_100018700 | 3300006931 | Bacteria | 6962 |
| 122 | Ga0097620_100138424 | 3300006931 | Bacteria | 2508 |
| 123 | Ga0075435_100577628 | 3300007076 | Bacteria | 974 |
| 124 | Ga0075435_100746974 | 3300007076 | Bacteria | 851 |
| 125 | Ga0075435_100902436 | 3300007076 | Bacteria | 771 |
| 126 | Ga0105240_10135001 | 3300009093 | Bacteria | 2955 |
| 127 | Ga0105240_10195588 | 3300009093 | Bacteria | 2375 |
| 128 | Ga0105240_10301352 | 3300009093 | Bacteria | 1833 |
| 129 | Ga0105240_10360470 | 3300009093 | Bacteria | 1647 |
| 130 | Ga0111539_10018884 | 3300009094 | Bacteria | 8529 |
| 131 | Ga0105245_10151876 | 3300009098 | Bacteria | 2191 |
| 132 | Ga0105245_10306002 | 3300009098 | Bacteria | 1561 |
| 133 | Ga0105245_10451541 | 3300009098 | Bacteria | 1294 |
| 134 | Ga0105245_10587001 | 3300009098 | Bacteria | 1139 |
| 135 | Ga0114129_10189058 | 3300009147 | Bacteria | 2797 |
| 136 | Ga0114129_10353743 | 3300009147 | Bacteria | 1945 |
| 137 | Ga0114129_10436153 | 3300009147 | Bacteria | 1720 |
| 138 | Ga0114129_10751688 | 3300009147 | Bacteria | 1248 |
| 139 | Ga0105243_10090794 | 3300009148 | Bacteria | 2514 |
| 140 | Ga0105243_10240159 | 3300009148 | Bacteria | 1612 |
| 141 | Ga0105243_10400778 | 3300009148 | Bacteria | 1274 |
| 142 | Ga0105243_10441408 | 3300009148 | Bacteria | 1219 |
| 143 | Ga0105242_10157289 | 3300009176 | Bacteria | 1986 |
| 144 | Ga0105248_10161255 | 3300009177 | Bacteria | 2529 |
| 145 | Ga0105248_10360308 | 3300009177 | Bacteria | 1637 |
| 146 | Ga0105248_12072374 | 3300009177 | Bacteria | 647 |
| 147 | Ga0105238_10001483 | 3300009551 | Bacteria | 23558 |
| 148 | Ga0105238_10335262 | 3300009551 | Bacteria | 1500 |
| 149 | Ga0105249_10037438 | 3300009553 | Bacteria | 4403 |
| 150 | Ga0105249_10043257 | 3300009553 | Bacteria | 4097 |
| 151 | Ga0105249_10554876 | 3300009553 | Bacteria | 1200 |
| 152 | Ga0105249_10903075 | 3300009553 | Bacteria | 950 |
| 153 | Ga0105239_10168691 | 3300010375 | Bacteria | 2447 |
| 154 | Ga0105239_10234600 | 3300010375 | Bacteria | 2059 |
| 155 | Ga0105239_10276437 | 3300010375 | Bacteria | 1890 |
| 156 | Ga0105239_10628665 | 3300010375 | Bacteria | 1225 |
| 157 | Ga0105239_11645035 | 3300010375 | Bacteria | 743 |
| 158 | Ga0105246_10004309 | 3300011119 | Bacteria | 8653 |
| 159 | Ga0105246_10011521 | 3300011119 | Bacteria | 5489 |
| 160 | Ga0105246_10244580 | 3300011119 | Bacteria | 1420 |
| 161 | Ga0105246_11375049 | 3300011119 | Bacteria | 658 |
| 162 | Ga0157338_1006018 | 3300012515 | Bacteria | 1110 |
| 163 | Ga0157373_10282672 | 3300013100 | Bacteria | 1176 |
| 164 | Ga0157371_11235545 | 3300013102 | Bacteria | 577 |
| 165 | Ga0157369_10396633 | 3300013105 | Bacteria | 1432 |
| 166 | Ga0157369_11484844 | 3300013105 | Bacteria | 690 |
| 167 | Ga0157378_10084611 | 3300013297 | Bacteria | 2872 |
| 168 | Ga0157378_10200142 | 3300013297 | Bacteria | 1889 |
| 169 | Ga0157378_10421139 | 3300013297 | Bacteria | 1320 |
| 170 | Ga0163162_10126833 | 3300013306 | Bacteria | 2659 |
| 171 | Ga0163162_10205282 | 3300013306 | Bacteria | 2100 |
| 172 | Ga0163162_10822745 | 3300013306 | Bacteria | 1045 |
| 173 | Ga0163162_10893931 | 3300013306 | Bacteria | 1002 |
| 174 | Ga0157372_10258767 | 3300013307 | Bacteria | 2021 |
| 175 | Ga0157372_10297153 | 3300013307 | Bacteria | 1878 |
| 176 | Ga0157372_10515495 | 3300013307 | Bacteria | 1394 |
| 177 | Ga0157375_10072994 | 3300013308 | Bacteria | 3450 |
| 178 | Ga0157375_10126363 | 3300013308 | Bacteria | 2672 |
| 179 | Ga0157375_10324228 | 3300013308 | Bacteria | 1705 |
| 180 | Ga0163163_10202242 | 3300014325 | Bacteria | 2035 |
| 181 | Ga0163163_10229598 | 3300014325 | Bacteria | 1905 |
| 182 | Ga0163163_10428995 | 3300014325 | Bacteria | 1381 |
| 183 | Ga0163163_10840053 | 3300014325 | Bacteria | 982 |
| 184 | Ga0163163_12596501 | 3300014325 | Bacteria | 564 |
| 185 | Ga0157380_10266891 | 3300014326 | Bacteria | 1558 |
| 186 | Ga0157379_10016306 | 3300014968 | Bacteria | 6536 |
| 187 | Ga0157379_11214016 | 3300014968 | Bacteria | 726 |
| 188 | Ga0163161_10025400 | 3300017792 | Bacteria | 4192 |
| 189 | Ga0163161_10425344 | 3300017792 | Bacteria | 1069 |
| 190 | Ga0163161_10473732 | 3300017792 | Bacteria | 1015 |
| 191 | Ga0163161_10997841 | 3300017792 | Bacteria | 715 |
| 192 | Ga0213872_10102986 | 3300021361 | Bacteria | 1271 |
| 193 | Ga0213874_10132935 | 3300021377 | Bacteria | 856 |
| 194 | Ga0207653_10002541 | 3300025885 | Bacteria | 5795 |
| 195 | Ga0207680_10031608 | 3300025903 | Bacteria | 3000 |
| 196 | Ga0207647_10145415 | 3300025904 | Bacteria | 1388 |
| 197 | Ga0207645_10417234 | 3300025907 | Bacteria | 904 |
| 198 | Ga0207654_10428162 | 3300025911 | Bacteria | 925 |
| 199 | Ga0207707_10451114 | 3300025912 | Bacteria | 1100 |
| 200 | Ga0207695_10061810 | 3300025913 | Bacteria | 3870 |
| 201 | Ga0207695_10182630 | 3300025913 | Bacteria | 2018 |
| 202 | Ga0207695_10403838 | 3300025913 | Bacteria | 1251 |
| 203 | Ga0207671_10231775 | 3300025914 | Bacteria | 1449 |
| 204 | Ga0207671_10824738 | 3300025914 | Bacteria | 735 |
| 205 | Ga0207693_10077348 | 3300025915 | Bacteria | 2605 |
| 206 | Ga0207660_10005384 | 3300025917 | Bacteria | 8309 |
| 207 | Ga0207660_10472934 | 3300025917 | Bacteria | 1015 |
| 208 | Ga0207660_10689114 | 3300025917 | Bacteria | 833 |
| 209 | Ga0207662_10624943 | 3300025918 | Bacteria | 751 |
| 210 | Ga0207657_10187880 | 3300025919 | Bacteria | 1668 |
| 211 | Ga0207657_10312121 | 3300025919 | Bacteria | 1244 |
| 212 | Ga0207646_10229402 | 3300025922 | Bacteria | 1678 |
| 213 | Ga0207646_10325578 | 3300025922 | Bacteria | 1389 |
| 214 | Ga0207646_11102143 | 3300025922 | Bacteria | 699 |
| 215 | Ga0207681_10725594 | 3300025923 | Bacteria | 827 |
| 216 | Ga0207694_10001304 | 3300025924 | Bacteria | 21470 |
| 217 | Ga0207694_10139461 | 3300025924 | Bacteria | 1949 |
| 218 | Ga0207687_10093656 | 3300025927 | Bacteria | 2197 |
| 219 | Ga0207664_10845821 | 3300025929 | Bacteria | 822 |
| 220 | Ga0207644_10962154 | 3300025931 | Bacteria | 716 |
| 221 | Ga0207690_10847107 | 3300025932 | Bacteria | 757 |
| 222 | Ga0207706_10110067 | 3300025933 | Bacteria | 2424 |
| 223 | Ga0207706_10129735 | 3300025933 | Bacteria | 2217 |
| 224 | Ga0207706_10340257 | 3300025933 | Bacteria | 1305 |
| 225 | Ga0207686_10283761 | 3300025934 | Bacteria | 1223 |
| 226 | Ga0207686_10552103 | 3300025934 | Bacteria | 901 |
| 227 | Ga0207709_10041366 | 3300025935 | Bacteria | 2765 |
| 228 | Ga0207709_10102890 | 3300025935 | Bacteria | 1892 |
| 229 | Ga0207709_10105095 | 3300025935 | Bacteria | 1875 |
| 230 | Ga0207670_10071600 | 3300025936 | Bacteria | 2398 |
| 231 | Ga0207670_10271815 | 3300025936 | Bacteria | 1318 |
| 232 | Ga0207669_10254159 | 3300025937 | Bacteria | 1310 |
| 233 | Ga0207704_10575280 | 3300025938 | Bacteria | 919 |
| 234 | Ga0207704_11259257 | 3300025938 | Bacteria | 632 |
| 235 | Ga0207691_10883181 | 3300025940 | Bacteria | 749 |
| 236 | Ga0207711_10219152 | 3300025941 | Bacteria | 1740 |
| 237 | Ga0207711_10369988 | 3300025941 | Bacteria | 1329 |
| 238 | Ga0207711_11151744 | 3300025941 | Bacteria | 717 |
| 239 | Ga0207689_10046017 | 3300025942 | Bacteria | 3608 |
| 240 | Ga0207661_10096634 | 3300025944 | Bacteria | 2472 |
| 241 | Ga0207667_10390040 | 3300025949 | Bacteria | 1418 |
| 242 | Ga0207667_10553330 | 3300025949 | Bacteria | 1163 |
| 243 | Ga0207651_11468162 | 3300025960 | Bacteria | 614 |
| 244 | Ga0207712_10024078 | 3300025961 | Bacteria | 4027 |
| 245 | Ga0207712_10340422 | 3300025961 | Bacteria | 1244 |
| 246 | Ga0207712_10489577 | 3300025961 | Bacteria | 1049 |
| 247 | Ga0207712_10859900 | 3300025961 | Bacteria | 800 |
| 248 | Ga0207668_10003322 | 3300025972 | Bacteria | 9419 |
| 249 | Ga0207668_10038442 | 3300025972 | Bacteria | 3212 |
| 250 | Ga0207668_10399489 | 3300025972 | Bacteria | 1162 |
| 251 | Ga0207640_10130889 | 3300025981 | Bacteria | 1813 |
| 252 | Ga0207640_10995842 | 3300025981 | Bacteria | 737 |
| 253 | Ga0207658_10553779 | 3300025986 | Bacteria | 1029 |
| 254 | Ga0207658_10653662 | 3300025986 | Bacteria | 948 |
| 255 | Ga0207658_10693462 | 3300025986 | Bacteria | 920 |
| 256 | Ga0207677_10313038 | 3300026023 | Bacteria | 1302 |
| 257 | Ga0207703_10050402 | 3300026035 | Bacteria | 3369 |
| 258 | Ga0207703_10201848 | 3300026035 | Bacteria | 1767 |
| 259 | Ga0207703_10259977 | 3300026035 | Bacteria | 1569 |
| 260 | Ga0207703_10962798 | 3300026035 | Bacteria | 818 |
| 261 | Ga0207703_11831716 | 3300026035 | Bacteria | 583 |
| 262 | Ga0207639_11218992 | 3300026041 | Bacteria | 706 |
| 263 | Ga0207678_10005726 | 3300026067 | Bacteria | 11092 |
| 264 | Ga0207678_10142618 | 3300026067 | Bacteria | 2045 |
| 265 | Ga0207678_10800125 | 3300026067 | Bacteria | 832 |
| 266 | Ga0207708_10000296 | 3300026075 | Bacteria | 39206 |
| 267 | Ga0207708_10071218 | 3300026075 | Bacteria | 2663 |
| 268 | Ga0207708_10553389 | 3300026075 | Bacteria | 970 |
| 269 | Ga0207708_10683620 | 3300026075 | Bacteria | 876 |
| 270 | Ga0207702_11591522 | 3300026078 | Bacteria | 647 |
| 271 | Ga0207641_10022099 | 3300026088 | Bacteria | 5234 |
| 272 | Ga0207641_11271775 | 3300026088 | Bacteria | 736 |
| 273 | Ga0207648_10294933 | 3300026089 | Bacteria | 1453 |
| 274 | Ga0207676_10067986 | 3300026095 | Bacteria | 2848 |
| 275 | Ga0207676_10070220 | 3300026095 | Bacteria | 2808 |
| 276 | Ga0207676_10556027 | 3300026095 | Bacteria | 1097 |
| 277 | Ga0207676_10885382 | 3300026095 | Bacteria | 875 |
| 278 | Ga0207674_10004822 | 3300026116 | Bacteria | 16164 |
| 279 | Ga0207674_10185022 | 3300026116 | Bacteria | 2034 |
| 280 | Ga0207674_11431300 | 3300026116 | Bacteria | 660 |
| 281 | Ga0207675_100012855 | 3300026118 | Bacteria | 7819 |
| 282 | Ga0207675_100043436 | 3300026118 | Bacteria | 4197 |
| 283 | Ga0207675_100086733 | 3300026118 | Bacteria | 2939 |
| 284 | Ga0207675_100302590 | 3300026118 | Bacteria | 1558 |
| 285 | Ga0207675_100621088 | 3300026118 | Bacteria | 1085 |
| 286 | Ga0207675_100741210 | 3300026118 | Bacteria | 993 |
| 287 | Ga0207683_10023066 | 3300026121 | Bacteria | 5348 |
| 288 | Ga0268266_10003259 | 3300028379 | Bacteria | 16360 |
| 289 | Ga0268266_10076843 | 3300028379 | Bacteria | 2902 |
| 290 | Ga0268266_10106531 | 3300028379 | Bacteria | 2478 |
| 291 | Ga0268265_10000508 | 3300028380 | Bacteria | 40027 |
| 292 | Ga0268265_10232233 | 3300028380 | Bacteria | 1622 |
| 293 | Ga0268265_10331466 | 3300028380 | Bacteria | 1382 |
| 294 | Ga0268265_10432025 | 3300028380 | Bacteria | 1225 |
| 295 | Ga0268264_10003796 | 3300028381 | Bacteria | 12956 |
| 296 | Ga0268264_10036495 | 3300028381 | Bacteria | 4050 |
| 297 | Ga0268264_10751625 | 3300028381 | Bacteria | 971 |
| 298 | Ga0268264_11073943 | 3300028381 | Bacteria | 813 |
| 299 | Ga0268264_11091014 | 3300028381 | Bacteria | 806 |
| 300 | Ga0265330_10380382 | 3300031235 | Bacteria | 597 |
| 301 | Ga0265325_10066791 | 3300031241 | Bacteria | 1813 |
| 302 | Ga0265340_10383306 | 3300031247 | Bacteria | 620 |
| 303 | Ga0265331_10000129 | 3300031250 | Bacteria | 99170 |
| 304 | Ga0265327_10000292 | 3300031251 | Bacteria | 97787 |
| 305 | Ga0307513_10014267 | 3300031456 | Bacteria | 9714 |
| 306 | Ga0307408_100048660 | 3300031548 | Bacteria | 3042 |
| 307 | Ga0265313_10232980 | 3300031595 | Bacteria | 756 |
| 308 | Ga0316579_10058415 | 3300031691 | Bacteria | 1812 |
| 309 | Ga0265314_10021087 | 3300031711 | Bacteria | 5019 |
| 310 | Ga0316576_10139416 | 3300031727 | Bacteria | 1825 |
| 311 | Ga0307405_10148725 | 3300031731 | Bacteria | 1644 |
| 312 | Ga0307413_10238592 | 3300031824 | Bacteria | 1341 |
| 313 | Ga0307410_11045101 | 3300031852 | Bacteria | 706 |
| 314 | Ga0307406_10527221 | 3300031901 | Bacteria | 962 |
| 315 | Ga0307412_11780681 | 3300031911 | Unclassified | 566 |
| 316 | Ga0307409_100875419 | 3300031995 | Bacteria | 910 |
| 317 | Ga0316583_10015512 | 3300032133 | Bacteria | 2741 |
| 318 | Ga0316580_10054191 | 3300032139 | Bacteria | 1234 |
| 319 | Ga0373939_0274975 | 3300035114 | Bacteria | 663 |
| 320 | Ga0373945_0069025 | 3300035116 | Bacteria | 1334 |
| 321 | Ga0373946_0077239 | 3300035171 | Bacteria | 1451 |
| 322 | Ga0373961_0210164 | 3300035241 | Bacteria | 690 |
| 323 | Ga0373962_0097976 | 3300035242 | Bacteria | 911 |
| 324 | Ga0373931_0024643 | 3300035691 | Bacteria | 3050 |
| 325 | Ga0373935_0089753 | 3300035692 | Bacteria | 2010 |
| 326 | Ga0373927_0766353 | 3300035695 | Bacteria | 637 |
| 327 | Ga0316582_0706051 | 3300036647 | Bacteria | 692 |
| 328 | Ga0316584_0210669 | 3300036712 | Bacteria | 1430 |
| 329 | Ga0395899_0019749 | 3300037312 | Bacteria | 5116 |
| 330 | Ga0436364_0530473 | 3300037853 | Bacteria | 1071 |
| 331 | Ga0436364_0747645 | 3300037853 | Bacteria | 2045 |
| 332 | Ga0436360_0247471 | 3300039438 | Bacteria | 826 |
| 333 | Ga0436360_1199555 | 3300039438 | Bacteria | 588 |
| 334 | Ga0436361_0045550 | 3300039447 | Bacteria | 6059 |
| 335 | Ga0436363_1456083 | 3300039450 | Bacteria | 1652 |
| 336 | Ga0439453_0024997 | 3300041408 | Bacteria | 1100 |
| 337 | Ga0451802_0507537 | 3300041460 | Bacteria | 590 |
| 338 | Ga0451841_1012353 | 3300041498 | Bacteria | 773 |
| 339 | Ga0439435_0002941 | 3300042436 | Bacteria | 3464 |
| 340 | Ga0439459_0233306 | 3300042438 | Bacteria | 514 |
| 341 | Ga0466966_0024751 | 3300044684 | Bacteria | 3927 |
| 342 | Ga0466961_0375228 | 3300044693 | Bacteria | 864 |
| 343 | Ga0466971_0047201 | 3300044719 | Bacteria | 1936 |
| 344 | Ga0466957_0701650 | 3300044842 | Bacteria | 714 |
| 345 | Ga0466959_0204156 | 3300045049 | Bacteria | 1375 |
| 346 | Ga0451576_1161003 | 3300045051 | Bacteria | 807 |
| 347 | Ga0451576_2343035 | 3300045051 | Bacteria | 547 |
| 348 | Ga0466958_0152517 | 3300045836 | Bacteria | 1458 |
| 349 | Ga0495617_241172 | 3300046452 | Bacteria | 558 |
| 350 | Ga0495603_0000627 | 3300046455 | Bacteria | 19818 |
| 351 | Ga0495629_0007106 | 3300046459 | Bacteria | 8248 |
| 352 | Ga0495641_0007313 | 3300046461 | Bacteria | 6916 |
| 353 | Ga0495580_0000299 | 3300046472 | Bacteria | 40203 |
| 354 | Ga0495639_0002035 | 3300046475 | Bacteria | 8950 |
| 355 | Ga0495584_0026383 | 3300046491 | Bacteria | 2943 |
| 356 | Ga0495584_0400180 | 3300046491 | Bacteria | 698 |
| 357 | Ga0495585_0109548 | 3300046492 | Bacteria | 1470 |
| 358 | Ga0495594_0000131 | 3300046499 | Bacteria | 35452 |
| 359 | Ga0495607_0387675 | 3300046501 | Bacteria | 638 |
| 360 | Ga0495608_0473015 | 3300046511 | Bacteria | 761 |
| 361 | Ga0495616_0133079 | 3300046513 | Bacteria | 1138 |
| 362 | Ga0495616_0278684 | 3300046513 | Bacteria | 711 |
| 363 | Ga0495637_0101299 | 3300046520 | Bacteria | 1125 |
| 364 | Ga0495665_0002454 | 3300046531 | Bacteria | 10015 |
| 365 | Ga0495587_0066743 | 3300046536 | Bacteria | 2098 |
| 366 | Ga0495609_0349414 | 3300046538 | Bacteria | 597 |
| 367 | Ga0495622_0004321 | 3300046557 | Bacteria | 6615 |
| 368 | Ga0495656_0017177 | 3300046615 | Bacteria | 2758 |
| 369 | Ga0495668_0474763 | 3300046616 | Bacteria | 689 |
| 370 | Ga0495634_0017557 | 3300046642 | Bacteria | 5103 |
| 371 | Ga0495625_0221462 | 3300046660 | Bacteria | 1240 |
| 372 | Ga0495661_0253567 | 3300046665 | Bacteria | 897 |
| 373 | Ga0495588_0000613 | 3300046674 | Bacteria | 16801 |
| 374 | Ga0495658_0002461 | 3300046683 | Bacteria | 9324 |
| 375 | Ga0495669_0506806 | 3300046684 | Bacteria | 587 |
| 376 | Ga0495624_0177926 | 3300046690 | Bacteria | 1297 |
| 377 | Ga0495670_0807314 | 3300046691 | Bacteria | 512 |
| 378 | Ga0495581_0000843 | 3300047315 | Bacteria | 16344 |
| 379 | Ga0495581_0598538 | 3300047315 | Bacteria | 639 |
| 380 | Ga0495672_0099357 | 3300047320 | Bacteria | 1582 |
| 381 | Ga0495675_0513036 | 3300047444 | Bacteria | 687 |
| 382 | Ga0495677_0048043 | 3300047445 | Bacteria | 1568 |
| 383 | Ga0495684_0485136 | 3300047471 | Bacteria | 853 |
| 384 | Ga0495602_0266929 | 3300048088 | Bacteria | 1267 |
| 385 | Ga0495614_0000595 | 3300048089 | Bacteria | 15125 |
| 386 | Ga0496100_0088386 | 3300048903 | Bacteria | 2109 |
| 387 | Ga0496100_0230180 | 3300048903 | Bacteria | 1363 |
| 388 | Ga0496101_0275972 | 3300048904 | Bacteria | 1313 |
| 389 | Ga0496101_1155395 | 3300048904 | Bacteria | 607 |
| 390 | Ga0496101_1186577 | 3300048904 | Bacteria | 598 |
| 391 | Ga0496102_0003290 | 3300048905 | Bacteria | 13702 |
| 392 | Ga0496102_0009775 | 3300048905 | Bacteria | 8250 |
| 393 | Ga0496102_0114053 | 3300048905 | Bacteria | 2521 |
| 394 | Ga0496102_0450756 | 3300048905 | Bacteria | 1207 |
| 395 | Ga0496103_0003743 | 3300048906 | Bacteria | 9250 |
| 396 | Ga0496103_0008489 | 3300048906 | Bacteria | 6104 |
| 397 | Ga0496104_0023377 | 3300048907 | Bacteria | 5683 |
| 398 | Ga0496104_0306877 | 3300048907 | Bacteria | 1499 |
| 399 | Ga0496104_0735116 | 3300048907 | Bacteria | 894 |
| 400 | Ga0496104_0837724 | 3300048907 | Bacteria | 825 |
| 401 | Ga0496105_0315015 | 3300048908 | Bacteria | 1255 |
| 402 | Ga0496105_0728021 | 3300048908 | Bacteria | 759 |
| 403 | Ga0496106_0013938 | 3300048909 | Bacteria | 5944 |
| 404 | Ga0496106_0023578 | 3300048909 | Bacteria | 4570 |
| 405 | Ga0496106_0070147 | 3300048909 | Bacteria | 2676 |
| 406 | Ga0496106_0264884 | 3300048909 | Bacteria | 1375 |
| 407 | Ga0496107_0001227 | 3300048910 | Bacteria | 15652 |
| 408 | Ga0496107_0024412 | 3300048910 | Bacteria | 4276 |
| 409 | Ga0496107_0058795 | 3300048910 | Bacteria | 2780 |
| 410 | Ga0496108_0117227 | 3300048911 | Bacteria | 2282 |
| 411 | Ga0496108_0189284 | 3300048911 | Bacteria | 1783 |
| 412 | Ga0496108_1011418 | 3300048911 | Bacteria | 709 |
| 413 | Ga0496109_0011144 | 3300048912 | Bacteria | 7711 |
| 414 | Ga0496109_0023962 | 3300048912 | Bacteria | 5421 |
| 415 | Ga0496109_0063870 | 3300048912 | Bacteria | 3368 |
| 416 | Ga0496110_0093793 | 3300048913 | Bacteria | 2687 |
| 417 | Ga0496110_0484000 | 3300048913 | Bacteria | 1127 |
| 418 | Ga0496111_0359525 | 3300048914 | Bacteria | 1077 |
| 419 | Ga0496112_0012419 | 3300048915 | Bacteria | 7831 |
| 420 | Ga0496112_0229806 | 3300048915 | Bacteria | 1810 |
| 421 | Ga0496112_0904927 | 3300048915 | Bacteria | 804 |
| 422 | Ga0496112_1084745 | 3300048915 | Bacteria | 719 |
| 423 | Ga0496112_1127120 | 3300048915 | Bacteria | 702 |
| 424 | Ga0496113_0065408 | 3300048916 | Bacteria | 2752 |
| 425 | Ga0496113_0211701 | 3300048916 | Bacteria | 1543 |
| 426 | Ga0496114_0006475 | 3300048917 | Bacteria | 9229 |
| 427 | Ga0496115_0065176 | 3300048918 | Bacteria | 2942 |
| 428 | Ga0496121_0686703 | 3300048924 | Bacteria | 618 |
| 429 | Ga0496126_0301478 | 3300048929 | Bacteria | 1322 |
| 430 | Ga0496126_1022797 | 3300048929 | Bacteria | 619 |
| 431 | Ga0501031_0038071 | 3300049568 | Bacteria | 3139 |
| 432 | Ga0501031_0496849 | 3300049568 | Bacteria | 787 |
| 433 | Ga0501031_0961442 | 3300049568 | Bacteria | 546 |
| 434 | Ga0501032_0025300 | 3300049569 | Bacteria | 4093 |
| 435 | Ga0501032_0193534 | 3300049569 | Bacteria | 1329 |
| 436 | Ga0501032_0406552 | 3300049569 | Bacteria | 874 |
| 437 | Ga0501033_0111113 | 3300049570 | Bacteria | 1994 |
| 438 | Ga0501033_0603605 | 3300049570 | Bacteria | 752 |
| 439 | Ga0501033_0687574 | 3300049570 | Bacteria | 697 |
| 440 | Ga0501034_0004261 | 3300049571 | Bacteria | 15956 |
| 441 | Ga0501034_0005961 | 3300049571 | Bacteria | 13193 |
| 442 | Ga0501034_0018906 | 3300049571 | Bacteria | 7058 |
| 443 | Ga0501034_0231328 | 3300049571 | Bacteria | 1797 |
| 444 | Ga0501036_0070372 | 3300049572 | Bacteria | 2958 |
| 445 | Ga0501036_0094129 | 3300049572 | Bacteria | 2532 |
| 446 | Ga0501036_0171298 | 3300049572 | Bacteria | 1829 |
| 447 | Ga0501036_0179190 | 3300049572 | Bacteria | 1784 |
| 448 | Ga0501036_0380133 | 3300049572 | Bacteria | 1179 |
| 449 | Ga0501037_0352891 | 3300049573 | Bacteria | 1014 |
| 450 | Ga0501037_0477216 | 3300049573 | Bacteria | 848 |
| 451 | Ga0501037_0822883 | 3300049573 | Bacteria | 612 |
| 452 | Ga0501038_0011728 | 3300049574 | Bacteria | 7995 |
| 453 | Ga0501038_0062640 | 3300049574 | Bacteria | 3178 |
| 454 | Ga0501038_0110360 | 3300049574 | Bacteria | 2279 |
| 455 | Ga0501038_0339780 | 3300049574 | Bacteria | 1171 |
| 456 | Ga0501038_0398767 | 3300049574 | Bacteria | 1065 |
| 457 | Ga0501039_0042416 | 3300049575 | Bacteria | 3515 |
| 458 | Ga0501039_0061840 | 3300049575 | Bacteria | 2900 |
| 459 | Ga0501039_0089351 | 3300049575 | Bacteria | 2401 |
| 460 | Ga0501039_0178067 | 3300049575 | Bacteria | 1672 |
| 461 | Ga0501039_0183921 | 3300049575 | Bacteria | 1643 |
| 462 | Ga0501039_0733426 | 3300049575 | Bacteria | 772 |
| 463 | Ga0501039_1398429 | 3300049575 | Bacteria | 539 |
| 464 | Ga0501040_0027155 | 3300049576 | Bacteria | 3852 |
| 465 | Ga0501040_0085580 | 3300049576 | Bacteria | 2188 |
| 466 | Ga0501040_0090293 | 3300049576 | Bacteria | 2129 |
| 467 | Ga0501040_0249267 | 3300049576 | Bacteria | 1266 |
| 468 | Ga0501040_0290747 | 3300049576 | Bacteria | 1168 |
| 469 | Ga0501040_0652483 | 3300049576 | Bacteria | 760 |
| 470 | Ga0501041_0017902 | 3300049577 | Bacteria | 4216 |
| 471 | Ga0501041_0320879 | 3300049577 | Bacteria | 977 |
| 472 | Ga0501042_0087966 | 3300049578 | Bacteria | 2229 |
| 473 | Ga0501042_0093570 | 3300049578 | Bacteria | 2158 |
| 474 | Ga0501042_0109144 | 3300049578 | Bacteria | 1992 |
| 475 | Ga0501043_0037738 | 3300049579 | Bacteria | 3800 |
| 476 | Ga0501043_0079525 | 3300049579 | Bacteria | 2576 |
| 477 | Ga0501043_0127109 | 3300049579 | Bacteria | 1999 |
| 478 | Ga0501043_0176369 | 3300049579 | Bacteria | 1666 |
| 479 | Ga0501043_0179370 | 3300049579 | Bacteria | 1650 |
| 480 | Ga0501043_0491061 | 3300049579 | Bacteria | 918 |
| 481 | Ga0501046_0005370 | 3300049580 | Bacteria | 11456 |
| 482 | Ga0501046_0043143 | 3300049580 | Bacteria | 3592 |
| 483 | Ga0501046_0065978 | 3300049580 | Bacteria | 2822 |
| 484 | Ga0501046_0112238 | 3300049580 | Bacteria | 2081 |
| 485 | Ga0501046_0210691 | 3300049580 | Bacteria | 1443 |
| 486 | Ga0501046_0494448 | 3300049580 | Bacteria | 876 |
| 487 | Ga0501047_0102782 | 3300049581 | Bacteria | 2737 |
| 488 | Ga0501047_0129543 | 3300049581 | Bacteria | 2403 |
| 489 | Ga0501047_0154272 | 3300049581 | Bacteria | 2171 |
| 490 | Ga0501047_0179097 | 3300049581 | Bacteria | 1986 |
| 491 | Ga0501047_0310190 | 3300049581 | Bacteria | 1418 |
| 492 | Ga0501047_0329015 | 3300049581 | Bacteria | 1367 |
| 493 | Ga0501047_0406822 | 3300049581 | Bacteria | 1193 |
| 494 | Ga0501048_0012118 | 3300049582 | Bacteria | 6425 |
| 495 | Ga0501048_0019338 | 3300049582 | Bacteria | 4998 |
| 496 | Ga0501048_0094546 | 3300049582 | Bacteria | 2108 |
| 497 | Ga0501048_0210649 | 3300049582 | Bacteria | 1378 |
| 498 | Ga0501048_0263931 | 3300049582 | Bacteria | 1223 |
| 499 | Ga0501048_0673930 | 3300049582 | Bacteria | 743 |
| 500 | Ga0501048_0716363 | 3300049582 | Bacteria | 719 |
| 501 | Ga0501067_0001416 | 3300049583 | Bacteria | 13004 |
| 502 | Ga0501067_0046177 | 3300049583 | Bacteria | 2418 |
| 503 | Ga0501068_0056384 | 3300049584 | Bacteria | 2382 |
| 504 | Ga0501068_0149739 | 3300049584 | Bacteria | 1466 |
| 505 | Ga0501069_0431211 | 3300049585 | Bacteria | 782 |
| 506 | Ga0501070_0211820 | 3300049586 | Bacteria | 1590 |
| 507 | Ga0501071_0189680 | 3300049587 | Bacteria | 1541 |
| 508 | Ga0501071_0281108 | 3300049587 | Bacteria | 1259 |
| 509 | Ga0501071_0350578 | 3300049587 | Bacteria | 1123 |
| 510 | Ga0501071_0390866 | 3300049587 | Bacteria | 1061 |
| 511 | Ga0501071_0842714 | 3300049587 | Bacteria | 707 |
| 512 | Ga0501072_0014249 | 3300049588 | Bacteria | 6091 |
| 513 | Ga0501072_0108051 | 3300049588 | Bacteria | 2213 |
| 514 | Ga0501072_0547296 | 3300049588 | Bacteria | 914 |
| 515 | Ga0501072_0821301 | 3300049588 | Bacteria | 727 |
| 516 | Ga0501072_1039086 | 3300049588 | Bacteria | 638 |
| 517 | Ga0501072_1116412 | 3300049588 | Bacteria | 613 |
| 518 | Ga0501073_0014072 | 3300049589 | Bacteria | 5812 |
| 519 | Ga0501073_0146493 | 3300049589 | Bacteria | 1636 |
| 520 | Ga0501073_0194547 | 3300049589 | Bacteria | 1403 |
| 521 | Ga0501073_0295487 | 3300049589 | Bacteria | 1118 |
| 522 | Ga0501073_0400517 | 3300049589 | Bacteria | 948 |
| 523 | Ga0501073_0530605 | 3300049589 | Bacteria | 813 |
| 524 | Ga0501074_0035756 | 3300049590 | Bacteria | 3599 |
| 525 | Ga0501074_0056825 | 3300049590 | Bacteria | 2820 |
| 526 | Ga0501074_0168670 | 3300049590 | Bacteria | 1563 |
| 527 | Ga0501074_0367731 | 3300049590 | Bacteria | 1020 |
| 528 | Ga0501074_0699541 | 3300049590 | Bacteria | 715 |
| 529 | Ga0501075_0171395 | 3300049591 | Bacteria | 1656 |
| 530 | Ga0501075_0453870 | 3300049591 | Bacteria | 977 |
| 531 | Ga0501075_0765425 | 3300049591 | Bacteria | 735 |
| 532 | Ga0501075_1548174 | 3300049591 | Bacteria | 502 |
| 533 | Ga0501076_0029662 | 3300049592 | Bacteria | 4255 |
| 534 | Ga0501076_0040748 | 3300049592 | Bacteria | 3650 |
| 535 | Ga0501076_0098084 | 3300049592 | Bacteria | 2361 |
| 536 | Ga0501076_0177808 | 3300049592 | Bacteria | 1734 |
| 537 | Ga0501076_0211185 | 3300049592 | Bacteria | 1586 |
| 538 | Ga0501076_0412659 | 3300049592 | Bacteria | 1111 |
| 539 | Ga0501076_0556244 | 3300049592 | Bacteria | 946 |
| 540 | Ga0501076_1138538 | 3300049592 | Bacteria | 642 |
| 541 | Ga0501076_1492929 | 3300049592 | Bacteria | 555 |
| 542 | Ga0501077_0012381 | 3300049593 | Bacteria | 5343 |
| 543 | Ga0501077_0068503 | 3300049593 | Bacteria | 2249 |
| 544 | Ga0501077_0103895 | 3300049593 | Bacteria | 1800 |
| 545 | Ga0501077_0166759 | 3300049593 | Bacteria | 1399 |
| 546 | Ga0501077_0185905 | 3300049593 | Bacteria | 1320 |
| 547 | Ga0501077_0195592 | 3300049593 | Bacteria | 1284 |
| 548 | Ga0501077_0703827 | 3300049593 | Bacteria | 649 |
| 549 | Ga0501079_0014826 | 3300049741 | Bacteria | 5941 |
| 550 | Ga0501079_0088493 | 3300049741 | Bacteria | 2398 |
| 551 | Ga0501079_0210132 | 3300049741 | Bacteria | 1520 |
| 552 | Ga0501079_0211701 | 3300049741 | Bacteria | 1514 |
| 553 | Ga0501079_0263041 | 3300049741 | Bacteria | 1348 |
| 554 | Ga0501080_0492198 | 3300049742 | Bacteria | 1096 |
| 555 | Ga0501080_0627889 | 3300049742 | Bacteria | 952 |
| 556 | Ga0501080_0831263 | 3300049742 | Bacteria | 808 |
| 557 | Ga0501080_1001771 | 3300049742 | Bacteria | 725 |
| 558 | Ga0501080_1297626 | 3300049742 | Bacteria | 623 |
| 559 | Ga0501081_0003077 | 3300049743 | Bacteria | 10592 |
| 560 | Ga0501081_0012801 | 3300049743 | Bacteria | 5515 |
| 561 | Ga0501081_0043930 | 3300049743 | Bacteria | 3066 |
| 562 | Ga0501081_0110113 | 3300049743 | Bacteria | 1954 |
| 563 | Ga0501081_0117405 | 3300049743 | Bacteria | 1892 |
| 564 | Ga0501081_1351364 | 3300049743 | Bacteria | 541 |
| 565 | Ga0501083_0003409 | 3300049744 | Bacteria | 11117 |
| 566 | Ga0501083_0014402 | 3300049744 | Bacteria | 5529 |
| 567 | Ga0501083_0045435 | 3300049744 | Bacteria | 2971 |
| 568 | Ga0501083_0099967 | 3300049744 | Bacteria | 1913 |
| 569 | Ga0501083_0129767 | 3300049744 | Bacteria | 1652 |
| 570 | Ga0501083_0249577 | 3300049744 | Bacteria | 1155 |
| 571 | Ga0501083_0327259 | 3300049744 | Bacteria | 996 |
| 572 | Ga0501083_0366336 | 3300049744 | Bacteria | 937 |
| 573 | Ga0501280_003723 | 3300049776 | Bacteria | 2310 |
| 574 | Ga0501035_0034629 | 3300049822 | Bacteria | 4587 |
| 575 | Ga0501035_0094712 | 3300049822 | Bacteria | 2625 |
| 576 | Ga0501035_0211090 | 3300049822 | Bacteria | 1661 |
| 577 | Ga0501035_0328378 | 3300049822 | Bacteria | 1284 |
| 578 | Ga0501044_0028936 | 3300049823 | Bacteria | 5844 |
| 579 | Ga0501044_0056089 | 3300049823 | Bacteria | 4045 |
| 580 | Ga0501044_0212229 | 3300049823 | Bacteria | 1889 |
| 581 | Ga0501044_0289188 | 3300049823 | Bacteria | 1571 |
| 582 | Ga0501044_0335099 | 3300049823 | Bacteria | 1435 |
| 583 | Ga0501044_0444007 | 3300049823 | Bacteria | 1205 |
| 584 | Ga0501044_1044403 | 3300049823 | Bacteria | 688 |
| 585 | Ga0501045_0022567 | 3300049824 | Bacteria | 4507 |
| 586 | Ga0501045_0049850 | 3300049824 | Bacteria | 3054 |
| 587 | Ga0501045_0168582 | 3300049824 | Bacteria | 1631 |
| 588 | Ga0501045_0545046 | 3300049824 | Bacteria | 860 |
| 589 | nmdc:mga05p37_1445357_c1 | 3300050507 | Bacteria | 689 |
| 590 | nmdc:mga05p37_354393_c1 | 3300050507 | Bacteria | 1727 |
| 591 | nmdc:mga05p37_562706_c1 | 3300050507 | Bacteria | 1295 |
| 592 | nmdc:mga0qj67_555104_c1 | 3300050509 | Bacteria | 921 |
| 593 | nmdc:mga0qj67_8450_c1 | 3300050509 | Bacteria | 7639 |
| 594 | nmdc:mga06r32_1315_c1 | 3300050510 | Bacteria | 22385 |
| 595 | nmdc:mga06r32_404575_c1 | 3300050510 | Bacteria | 1347 |
| 596 | nmdc:mga08y16_114430_c1 | 3300050511 | Bacteria | 2808 |
| 597 | nmdc:mga08y16_328932_c1 | 3300050511 | Bacteria | 1572 |
| 598 | nmdc:mga0n895_348068_c1 | 3300050512 | Bacteria | 1501 |
| 599 | nmdc:mga0rr50_1141444_c1 | 3300050513 | Bacteria | 662 |
| 600 | nmdc:mga0a205_489308_c1 | 3300050515 | Bacteria | 1088 |
| 601 | nmdc:mga0a205_75071_c1 | 3300050515 | Bacteria | 3266 |
| 602 | Ga0495612_0146744 | 3300053078 | Bacteria | 1025 |
| 603 | Ga0495612_0211089 | 3300053078 | Bacteria | 858 |
| 604 | Ga0495655_0083809 | 3300053083 | Bacteria | 916 |
| 605 | Ga0495619_0004904 | 3300053085 | Bacteria | 8497 |
| 606 | Ga0495619_0046494 | 3300053085 | Bacteria | 2854 |
| 607 | Ga0500583_0124548 | 3300053092 | Bacteria | 1276 |
| 608 | Ga0500651_0296726 | 3300053093 | Bacteria | 928 |
| 609 | Ga0500566_0062953 | 3300053094 | Bacteria | 2096 |
| 610 | Ga0500641_0079550 | 3300053096 | Bacteria | 1390 |
| 611 | Ga0500554_081610 | 3300053102 | Bacteria | 1066 |
| 612 | Ga0500555_116509 | 3300053103 | Bacteria | 669 |
| 613 | Ga0500556_0000903 | 3300053104 | Bacteria | 16509 |
| 614 | Ga0500562_019830 | 3300053108 | Bacteria | 1743 |
| 615 | Ga0500595_030648 | 3300053119 | Bacteria | 1810 |
| 616 | Ga0500642_0058722 | 3300053130 | Bacteria | 1721 |
| 617 | Ga0500573_0000050 | 3300053140 | Bacteria | 95598 |
| 618 | Ga0500588_0135843 | 3300053146 | Bacteria | 880 |
| 619 | Ga0500616_0000139 | 3300053153 | Bacteria | 123841 |
| 620 | Ga0500616_0013071 | 3300053153 | Bacteria | 4834 |
| 621 | Ga0500627_0134264 | 3300053158 | Bacteria | 1118 |
| 622 | Ga0501084_0009497 | 3300054114 | Bacteria | 8049 |
| 623 | Ga0501084_0048742 | 3300054114 | Bacteria | 3545 |
| 624 | Ga0501084_0080943 | 3300054114 | Bacteria | 2723 |
| 625 | Ga0501084_0211690 | 3300054114 | Bacteria | 1635 |
| 626 | Ga0501084_0335243 | 3300054114 | Bacteria | 1277 |
| 627 | Ga0501084_0490384 | 3300054114 | Bacteria | 1038 |
| 628 | Ga0501084_1611793 | 3300054114 | Bacteria | 543 |
| 629 | Ga0501082_0007775 | 3300060353 | Bacteria | 9250 |
| 630 | Ga0501082_0020366 | 3300060353 | Bacteria | 5718 |
| 631 | Ga0501082_0078325 | 3300060353 | Bacteria | 2851 |
| 632 | Ga0501082_0192855 | 3300060353 | Bacteria | 1772 |
| 633 | Ga0501082_0405337 | 3300060353 | Bacteria | 1190 |
| 634 | Ga0501082_0515768 | 3300060353 | Bacteria | 1045 |
| 635 | Ga0501082_0540745 | 3300060353 | Bacteria | 1019 |
| 636 | Ga0501082_0668604 | 3300060353 | Bacteria | 909 |
| 637 | Ga0501082_1122709 | 3300060353 | Bacteria | 687 |
| 638 | Ga0501082_1133969 | 3300060353 | Bacteria | 683 |
| 639 | Ga0501082_1562402 | 3300060353 | Bacteria | 576 |
| 640 | Ga0501082_1612446 | 3300060353 | Bacteria | 566 |
| 641 | Ga0530510_0020365 | 3300061734 | Bacteria | 4716 |
| 642 | Ga0530510_0035380 | 3300061734 | Bacteria | 3599 |
| 643 | Ga0530510_0713812 | 3300061734 | Bacteria | 764 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0444007 | Ga0501044_0444007_307_732 | 124 |
| 2 | 3300025914 | Ga0207671_10824738 | Ga0207671_108247382 | 126 |
| 3 | 3300049579 | Ga0501043_0491061 | Ga0501043_0491061_10_405 | 126 |
| 4 | 3300025929 | Ga0207664_10845821 | Ga0207664_108458212 | 128 |
| 5 | 3300049572 | Ga0501036_0094129 | Ga0501036_0094129_286_699 | 128 |
| 6 | 3300049573 | Ga0501037_0822883 | Ga0501037_0822883_168_581 | 128 |
| 7 | 3300049575 | Ga0501039_0089351 | Ga0501039_0089351_1253_1666 | 128 |
| 8 | 3300049576 | Ga0501040_0085580 | Ga0501040_0085580_1276_1689 | 128 |
| 9 | 3300049577 | Ga0501041_0320879 | Ga0501041_0320879_212_625 | 128 |
| 10 | 3300049578 | Ga0501042_0109144 | Ga0501042_0109144_681_1094 | 128 |
| 11 | 3300049582 | Ga0501048_0210649 | Ga0501048_0210649_385_798 | 128 |
| 12 | 3300049587 | Ga0501071_0842714 | Ga0501071_0842714_37_450 | 128 |
| 13 | 3300049588 | Ga0501072_1116412 | Ga0501072_1116412_126_539 | 128 |
| 14 | 3300049590 | Ga0501074_0367731 | Ga0501074_0367731_176_589 | 128 |
| 15 | 3300049592 | Ga0501076_0211185 | Ga0501076_0211185_583_996 | 128 |
| 16 | 3300049593 | Ga0501077_0103895 | Ga0501077_0103895_1347_1760 | 128 |
| 17 | 3300049741 | Ga0501079_0088493 | Ga0501079_0088493_1815_2228 | 128 |
| 18 | 3300049824 | Ga0501045_0049850 | Ga0501045_0049850_305_718 | 128 |
| 19 | 3300060353 | Ga0501082_1122709 | Ga0501082_1122709_254_667 | 128 |
| 20 | 3300005336 | Ga0070680_100003662 | Ga0070680_10000366215 | 129 |
| 21 | 3300005340 | Ga0070689_100295999 | Ga0070689_1002959992 | 129 |
| 22 | 3300005341 | Ga0070691_10013483 | Ga0070691_100134833 | 129 |
| 23 | 3300005343 | Ga0070687_100751074 | Ga0070687_1007510741 | 129 |
| 24 | 3300005345 | Ga0070692_10210158 | Ga0070692_102101582 | 129 |
| 25 | 3300005353 | Ga0070669_100218271 | Ga0070669_1002182711 | 129 |
| 26 | 3300005406 | Ga0070703_10051303 | Ga0070703_100513032 | 129 |
| 27 | 3300005438 | Ga0070701_10014155 | Ga0070701_100141553 | 129 |
| 28 | 3300005440 | Ga0070705_100000171 | Ga0070705_1000001719 | 129 |
| 29 | 3300005441 | Ga0070700_100000482 | Ga0070700_1000004825 | 129 |
| 30 | 3300005444 | Ga0070694_100000555 | Ga0070694_10000055510 | 129 |
| 31 | 3300005445 | Ga0070708_100013464 | Ga0070708_1000134644 | 129 |
| 32 | 3300005455 | Ga0070663_100002218 | Ga0070663_1000022184 | 129 |
| 33 | 3300005457 | Ga0070662_100052162 | Ga0070662_1000521624 | 129 |
| 34 | 3300005458 | Ga0070681_10004750 | Ga0070681_100047503 | 129 |
| 35 | 3300005468 | Ga0070707_100285734 | Ga0070707_1002857342 | 129 |
| 36 | 3300005471 | Ga0070698_100492073 | Ga0070698_1004920732 | 129 |
| 37 | 3300005518 | Ga0070699_100000167 | Ga0070699_10000016729 | 129 |
| 38 | 3300005544 | Ga0070686_100258268 | Ga0070686_1002582682 | 129 |
| 39 | 3300005546 | Ga0070696_100000097 | Ga0070696_1000000976 | 129 |
| 40 | 3300005547 | Ga0070693_100057111 | Ga0070693_1000571112 | 129 |
| 41 | 3300005549 | Ga0070704_100000566 | Ga0070704_10000056618 | 129 |
| 42 | 3300005577 | Ga0068857_100009356 | Ga0068857_1000093563 | 129 |
| 43 | 3300005615 | Ga0070702_100149780 | Ga0070702_1001497802 | 129 |
| 44 | 3300005617 | Ga0068859_100001658 | Ga0068859_10000165821 | 129 |
| 45 | 3300005719 | Ga0068861_100055890 | Ga0068861_1000558902 | 129 |
| 46 | 3300005842 | Ga0068858_100247091 | Ga0068858_1002470912 | 129 |
| 47 | 3300005843 | Ga0068860_100001592 | Ga0068860_10000159218 | 129 |
| 48 | 3300005844 | Ga0068862_100001428 | Ga0068862_10000142819 | 129 |
| 49 | 3300006847 | Ga0075431_100000652 | Ga0075431_10000065221 | 129 |
| 50 | 3300006931 | Ga0097620_100001658 | Ga0097620_10000165821 | 129 |
| 51 | 3300009147 | Ga0114129_10353743 | Ga0114129_103537432 | 129 |
| 52 | 3300009148 | Ga0105243_10400778 | Ga0105243_104007782 | 129 |
| 53 | 3300009553 | Ga0105249_10037438 | Ga0105249_100374384 | 129 |
| 54 | 3300011119 | Ga0105246_10004309 | Ga0105246_100043093 | 129 |
| 55 | 3300025885 | Ga0207653_10002541 | Ga0207653_100025413 | 129 |
| 56 | 3300025904 | Ga0207647_10145415 | Ga0207647_101454152 | 129 |
| 57 | 3300025917 | Ga0207660_10005384 | Ga0207660_100053848 | 129 |
| 58 | 3300025918 | Ga0207662_10624943 | Ga0207662_106249432 | 129 |
| 59 | 3300025922 | Ga0207646_10325578 | Ga0207646_103255782 | 129 |
| 60 | 3300025923 | Ga0207681_10725594 | Ga0207681_107255942 | 129 |
| 61 | 3300025933 | Ga0207706_10340257 | Ga0207706_103402572 | 129 |
| 62 | 3300025935 | Ga0207709_10105095 | Ga0207709_101050952 | 129 |
| 63 | 3300025936 | Ga0207670_10071600 | Ga0207670_100716003 | 129 |
| 64 | 3300025942 | Ga0207689_10046017 | Ga0207689_100460172 | 129 |
| 65 | 3300025961 | Ga0207712_10024078 | Ga0207712_100240783 | 129 |
| 66 | 3300026067 | Ga0207678_10005726 | Ga0207678_100057264 | 129 |
| 67 | 3300026075 | Ga0207708_10000296 | Ga0207708_1000029624 | 129 |
| 68 | 3300026095 | Ga0207676_10067986 | Ga0207676_100679864 | 129 |
| 69 | 3300026116 | Ga0207674_10004822 | Ga0207674_1000482219 | 129 |
| 70 | 3300026118 | Ga0207675_100043436 | Ga0207675_1000434361 | 129 |
| 71 | 3300028380 | Ga0268265_10000508 | Ga0268265_1000050817 | 129 |
| 72 | 3300028381 | Ga0268264_10003796 | Ga0268264_100037968 | 129 |
| 73 | 3300048903 | Ga0496100_0230180 | Ga0496100_0230180_821_1240 | 129 |
| 74 | 3300048904 | Ga0496101_0275972 | Ga0496101_0275972_563_982 | 129 |
| 75 | 3300048905 | Ga0496102_0003290 | Ga0496102_0003290_11167_11586 | 129 |
| 76 | 3300048906 | Ga0496103_0003743 | Ga0496103_0003743_4082_4501 | 129 |
| 77 | 3300048907 | Ga0496104_0837724 | Ga0496104_0837724_127_546 | 129 |
| 78 | 3300048909 | Ga0496106_0013938 | Ga0496106_0013938_971_1390 | 129 |
| 79 | 3300048910 | Ga0496107_0001227 | Ga0496107_0001227_4906_5325 | 129 |
| 80 | 3300048911 | Ga0496108_1011418 | Ga0496108_1011418_28_447 | 129 |
| 81 | 3300049570 | Ga0501033_0687574 | Ga0501033_0687574_248_667 | 129 |
| 82 | 3300049574 | Ga0501038_0339780 | Ga0501038_0339780_638_1057 | 129 |
| 83 | 3300049576 | Ga0501040_0249267 | Ga0501040_0249267_262_681 | 129 |
| 84 | 3300049578 | Ga0501042_0087966 | Ga0501042_0087966_1764_2183 | 129 |
| 85 | 3300049579 | Ga0501043_0176369 | Ga0501043_0176369_266_685 | 129 |
| 86 | 3300049580 | Ga0501046_0043143 | Ga0501046_0043143_611_1030 | 129 |
| 87 | 3300049582 | Ga0501048_0673930 | Ga0501048_0673930_250_672 | 129 |
| 88 | 3300049587 | Ga0501071_0390866 | Ga0501071_0390866_598_1017 | 129 |
| 89 | 3300049590 | Ga0501074_0056825 | Ga0501074_0056825_71_490 | 129 |
| 90 | 3300049590 | Ga0501074_0699541 | Ga0501074_0699541_249_671 | 129 |
| 91 | 3300049591 | Ga0501075_0171395 | Ga0501075_0171395_350_769 | 129 |
| 92 | 3300049591 | Ga0501075_0765425 | Ga0501075_0765425_77_499 | 129 |
| 93 | 3300049592 | Ga0501076_0556244 | Ga0501076_0556244_26_448 | 129 |
| 94 | 3300049592 | Ga0501076_1138538 | Ga0501076_1138538_68_487 | 129 |
| 95 | 3300049743 | Ga0501081_0003077 | Ga0501081_0003077_1558_1977 | 129 |
| 96 | 3300049743 | Ga0501081_0110113 | Ga0501081_0110113_687_1106 | 129 |
| 97 | 3300049824 | Ga0501045_0168582 | Ga0501045_0168582_462_881 | 129 |
| 98 | 3300050507 | nmdc:mga05p37_354393_c1 | nmdc:mga05p37_354393_c1_142_561 | 129 |
| 99 | 3300050509 | nmdc:mga0qj67_8450_c1 | nmdc:mga0qj67_8450_c1_3430_3849 | 129 |
| 100 | 3300050510 | nmdc:mga06r32_1315_c1 | nmdc:mga06r32_1315_c1_7626_8045 | 129 |
| 101 | 3300053103 | Ga0500555_116509 | Ga0500555_116509_81_500 | 129 |
| 102 | 3300054114 | Ga0501084_0080943 | Ga0501084_0080943_318_737 | 129 |
| 103 | 3300060353 | Ga0501082_0078325 | Ga0501082_0078325_2027_2446 | 129 |
| 104 | 3300060353 | Ga0501082_0668604 | Ga0501082_0668604_233_637 | 129 |
| 105 | 3300061734 | Ga0530510_0020365 | Ga0530510_0020365_1374_1793 | 129 |
| 106 | iso_pu_bacteria | 2510917026 | 2511171774 | 129 |
| 107 | iso_pu_bacteria | 2582581293 | 2585199256 | 129 |
| 108 | iso_pu_bacteria | 2585427633 | 2585995045 | 129 |
| 109 | iso_pu_bacteria | 2585427634 | 2585999589 | 129 |
| 110 | iso_pu_bacteria | 2791355048 | 2792459614 | 129 |
| 111 | iso_pu_bacteria | 2843744320 | 2843747269 | 129 |
| 112 | iso_pu_bacteria | 2849560528 | 2849560808 | 129 |
| 113 | iso_pu_bacteria | 2849573788 | 2849574326 | 129 |
| 114 | iso_pu_bacteria | 2851153111 | 2851158048 | 129 |
| 115 | iso_pu_bacteria | 2884960567 | 2884963926 | 129 |
| 116 | iso_pu_bacteria | 2898329390 | 2898333438 | 129 |
| 117 | iso_pu_bacteria | 2919171160 | 2919171497 | 129 |
| 118 | iso_pu_bacteria | 2585428106 | 2587919690 | 130 |
| 119 | iso_pu_bacteria | 2615840624 | 2616298206 | 130 |
| 120 | iso_pu_bacteria | 2643221568 | 2643855923 | 130 |
| 121 | iso_pu_bacteria | 2643221640 | 2644226376 | 130 |
| 122 | iso_pu_bacteria | 2643221642 | 2644235864 | 130 |
| 123 | iso_pu_bacteria | 2818991461 | 2819684196 | 130 |
| 124 | iso_pu_bacteria | 2883354860 | 2883357569 | 130 |
| 125 | iso_pu_bacteria | 2919166419 | 2919167311 | 130 |
| 126 | iso_pu_bacteria | 2978969890 | 2978973744 | 130 |
| 127 | iso_pu_bacteria | 2984587000 | 2984592015 | 130 |
| 128 | iso_pu_bacteria | 8018127388 | 8018131281 | 130 |
| 129 | iso_pu_bacteria | 8054460903 | 8054461845 | 130 |
| 130 | iso_pu_bacteria | 8054563764 | 8054568500 | 130 |
| 131 | 3300005336 | Ga0070680_100059149 | Ga0070680_1000591492 | 132 |
| 132 | 3300005439 | Ga0070711_100247284 | Ga0070711_1002472842 | 132 |
| 133 | 3300005563 | Ga0068855_100089464 | Ga0068855_1000894643 | 132 |
| 134 | 3300005616 | Ga0068852_100152582 | Ga0068852_1001525823 | 132 |
| 135 | 3300009093 | Ga0105240_10301352 | Ga0105240_103013523 | 132 |
| 136 | 3300009098 | Ga0105245_10451541 | Ga0105245_104515412 | 132 |
| 137 | 3300013105 | Ga0157369_11484844 | Ga0157369_114848441 | 132 |
| 138 | 3300013307 | Ga0157372_10297153 | Ga0157372_102971533 | 132 |
| 139 | 3300025912 | Ga0207707_10451114 | Ga0207707_104511142 | 132 |
| 140 | 3300049571 | Ga0501034_0231328 | Ga0501034_0231328_934_1338 | 132 |
| 141 | 3300049572 | Ga0501036_0380133 | Ga0501036_0380133_563_967 | 132 |
| 142 | 3300049579 | Ga0501043_0127109 | Ga0501043_0127109_1430_1834 | 132 |
| 143 | 3300049580 | Ga0501046_0210691 | Ga0501046_0210691_405_809 | 132 |
| 144 | 3300049581 | Ga0501047_0310190 | Ga0501047_0310190_711_1115 | 132 |
| 145 | 3300049581 | Ga0501047_0406822 | Ga0501047_0406822_70_474 | 132 |
| 146 | 3300049588 | Ga0501072_0547296 | Ga0501072_0547296_86_490 | 132 |
| 147 | 3300049742 | Ga0501080_0492198 | Ga0501080_0492198_518_922 | 132 |
| 148 | 3300049742 | Ga0501080_1297626 | Ga0501080_1297626_44_448 | 132 |
| 149 | 3300049744 | Ga0501083_0014402 | Ga0501083_0014402_4411_4815 | 132 |
| 150 | 3300049822 | Ga0501035_0328378 | Ga0501035_0328378_292_696 | 132 |
| 151 | 3300049823 | Ga0501044_0056089 | Ga0501044_0056089_154_558 | 132 |
| 152 | 3300053102 | Ga0500554_081610 | Ga0500554_081610_416_823 | 132 |
| 153 | 3300054114 | Ga0501084_0211690 | Ga0501084_0211690_290_694 | 132 |
| 154 | 3300060353 | Ga0501082_1133969 | Ga0501082_1133969_121_525 | 132 |
| 155 | 3300060353 | Ga0501082_1612446 | Ga0501082_1612446_121_525 | 132 |
| 156 | iso_pu_bacteria | 2842333319 | 2842334773 | 132 |
| 157 | 3300005335 | Ga0070666_10182350 | Ga0070666_101823502 | 133 |
| 158 | 3300005338 | Ga0068868_101848624 | Ga0068868_1018486241 | 133 |
| 159 | 3300005344 | Ga0070661_100885912 | Ga0070661_1008859121 | 133 |
| 160 | 3300005347 | Ga0070668_100021251 | Ga0070668_1000212512 | 133 |
| 161 | 3300005367 | Ga0070667_100017619 | Ga0070667_1000176195 | 133 |
| 162 | 3300005617 | Ga0068859_100018700 | Ga0068859_1000187002 | 133 |
| 163 | 3300005842 | Ga0068858_100287720 | Ga0068858_1002877203 | 133 |
| 164 | 3300005842 | Ga0068858_100377541 | Ga0068858_1003775413 | 133 |
| 165 | 3300005843 | Ga0068860_100044929 | Ga0068860_1000449292 | 133 |
| 166 | 3300005844 | Ga0068862_100033211 | Ga0068862_1000332115 | 133 |
| 167 | 3300005844 | Ga0068862_100403506 | Ga0068862_1004035062 | 133 |
| 168 | 3300006237 | Ga0097621_100784503 | Ga0097621_1007845032 | 133 |
| 169 | 3300006931 | Ga0097620_100018700 | Ga0097620_1000187002 | 133 |
| 170 | 3300009553 | Ga0105249_10554876 | Ga0105249_105548762 | 133 |
| 171 | 3300013102 | Ga0157371_11235545 | Ga0157371_112355451 | 133 |
| 172 | 3300014325 | Ga0163163_10202242 | Ga0163163_102022423 | 133 |
| 173 | 3300014325 | Ga0163163_10840053 | Ga0163163_108400531 | 133 |
| 174 | 3300021361 | Ga0213872_10102986 | Ga0213872_101029862 | 133 |
| 175 | 3300021377 | Ga0213874_10132935 | Ga0213874_101329352 | 133 |
| 176 | 3300025915 | Ga0207693_10077348 | Ga0207693_100773484 | 133 |
| 177 | 3300025934 | Ga0207686_10552103 | Ga0207686_105521032 | 133 |
| 178 | 3300025938 | Ga0207704_10575280 | Ga0207704_105752802 | 133 |
| 179 | 3300025961 | Ga0207712_10489577 | Ga0207712_104895772 | 133 |
| 180 | 3300025972 | Ga0207668_10003322 | Ga0207668_100033228 | 133 |
| 181 | 3300026035 | Ga0207703_10259977 | Ga0207703_102599771 | 133 |
| 182 | 3300026035 | Ga0207703_11831716 | Ga0207703_118317161 | 133 |
| 183 | 3300026075 | Ga0207708_10553389 | Ga0207708_105533892 | 133 |
| 184 | 3300026095 | Ga0207676_10070220 | Ga0207676_100702204 | 133 |
| 185 | 3300026118 | Ga0207675_100621088 | Ga0207675_1006210882 | 133 |
| 186 | 3300028380 | Ga0268265_10232233 | Ga0268265_102322332 | 133 |
| 187 | 3300028380 | Ga0268265_10331466 | Ga0268265_103314662 | 133 |
| 188 | 3300028381 | Ga0268264_10036495 | Ga0268264_100364952 | 133 |
| 189 | 3300031251 | Ga0265327_10000292 | Ga0265327_1000029232 | 133 |
| 190 | 3300031852 | Ga0307410_11045101 | Ga0307410_110451012 | 133 |
| 191 | 3300031911 | Ga0307412_11780681 | Ga0307412_117806812 | 133 |
| 192 | 3300031995 | Ga0307409_100875419 | Ga0307409_1008754192 | 133 |
| 193 | 3300035695 | Ga0373927_0766353 | Ga0373927_0766353_159_596 | 133 |
| 194 | 3300037853 | Ga0436364_0747645 | Ga0436364_0747645_1066_1473 | 133 |
| 195 | 3300039438 | Ga0436360_1199555 | Ga0436360_1199555_124_528 | 133 |
| 196 | 3300039447 | Ga0436361_0045550 | Ga0436361_0045550_1190_1603 | 133 |
| 197 | 3300039450 | Ga0436363_1456083 | Ga0436363_1456083_81_482 | 133 |
| 198 | 3300044684 | Ga0466966_0024751 | Ga0466966_0024751_1046_1453 | 133 |
| 199 | 3300044693 | Ga0466961_0375228 | Ga0466961_0375228_437_844 | 133 |
| 200 | 3300044719 | Ga0466971_0047201 | Ga0466971_0047201_1139_1546 | 133 |
| 201 | 3300044842 | Ga0466957_0701650 | Ga0466957_0701650_158_565 | 133 |
| 202 | 3300045049 | Ga0466959_0204156 | Ga0466959_0204156_769_1176 | 133 |
| 203 | 3300045836 | Ga0466958_0152517 | Ga0466958_0152517_974_1381 | 133 |
| 204 | 3300046491 | Ga0495584_0400180 | Ga0495584_0400180_191_628 | 133 |
| 205 | 3300046511 | Ga0495608_0473015 | Ga0495608_0473015_288_698 | 133 |
| 206 | 3300047320 | Ga0495672_0099357 | Ga0495672_0099357_300_701 | 133 |
| 207 | 3300049568 | Ga0501031_0496849 | Ga0501031_0496849_356_769 | 133 |
| 208 | 3300049569 | Ga0501032_0025300 | Ga0501032_0025300_1616_2029 | 133 |
| 209 | 3300049570 | Ga0501033_0111113 | Ga0501033_0111113_552_965 | 133 |
| 210 | 3300049571 | Ga0501034_0004261 | Ga0501034_0004261_6439_6840 | 133 |
| 211 | 3300049571 | Ga0501034_0018906 | Ga0501034_0018906_1351_1764 | 133 |
| 212 | 3300049572 | Ga0501036_0070372 | Ga0501036_0070372_2078_2491 | 133 |
| 213 | 3300049573 | Ga0501037_0352891 | Ga0501037_0352891_382_795 | 133 |
| 214 | 3300049574 | Ga0501038_0011728 | Ga0501038_0011728_717_1130 | 133 |
| 215 | 3300049575 | Ga0501039_0178067 | Ga0501039_0178067_685_1098 | 133 |
| 216 | 3300049579 | Ga0501043_0179370 | Ga0501043_0179370_635_1048 | 133 |
| 217 | 3300049580 | Ga0501046_0494448 | Ga0501046_0494448_220_633 | 133 |
| 218 | 3300049581 | Ga0501047_0129543 | Ga0501047_0129543_1713_2126 | 133 |
| 219 | 3300049581 | Ga0501047_0329015 | Ga0501047_0329015_184_585 | 133 |
| 220 | 3300049582 | Ga0501048_0263931 | Ga0501048_0263931_527_940 | 133 |
| 221 | 3300049586 | Ga0501070_0211820 | Ga0501070_0211820_573_986 | 133 |
| 222 | 3300049589 | Ga0501073_0530605 | Ga0501073_0530605_385_798 | 133 |
| 223 | 3300049744 | Ga0501083_0129767 | Ga0501083_0129767_893_1306 | 133 |
| 224 | 3300049822 | Ga0501035_0034629 | Ga0501035_0034629_3279_3692 | 133 |
| 225 | 3300049823 | Ga0501044_0212229 | Ga0501044_0212229_945_1358 | 133 |
| 226 | 3300049824 | Ga0501045_0545046 | Ga0501045_0545046_69_482 | 133 |
| 227 | 3300053153 | Ga0500616_0000139 | Ga0500616_0000139_41170_41583 | 133 |
| 228 | iso_pu_bacteria | 8005246636 | 8005251382 | 133 |
| 229 | 3300005329 | Ga0070683_100130330 | Ga0070683_1001303304 | 134 |
| 230 | 3300005329 | Ga0070683_102056422 | Ga0070683_1020564221 | 134 |
| 231 | 3300005335 | Ga0070666_10061030 | Ga0070666_100610303 | 134 |
| 232 | 3300005339 | Ga0070660_100448761 | Ga0070660_1004487612 | 134 |
| 233 | 3300005347 | Ga0070668_100917510 | Ga0070668_1009175102 | 134 |
| 234 | 3300005445 | Ga0070708_100664097 | Ga0070708_1006640972 | 134 |
| 235 | 3300005457 | Ga0070662_100034999 | Ga0070662_1000349994 | 134 |
| 236 | 3300005458 | Ga0070681_11155119 | Ga0070681_111551191 | 134 |
| 237 | 3300005468 | Ga0070707_100267680 | Ga0070707_1002676802 | 134 |
| 238 | 3300005471 | Ga0070698_100228289 | Ga0070698_1002282891 | 134 |
| 239 | 3300005539 | Ga0068853_101322548 | Ga0068853_1013225482 | 134 |
| 240 | 3300005543 | Ga0070672_100928853 | Ga0070672_1009288532 | 134 |
| 241 | 3300005547 | Ga0070693_100235970 | Ga0070693_1002359702 | 134 |
| 242 | 3300005548 | Ga0070665_100004744 | Ga0070665_10000474415 | 134 |
| 243 | 3300005548 | Ga0070665_100248732 | Ga0070665_1002487322 | 134 |
| 244 | 3300005548 | Ga0070665_101282120 | Ga0070665_1012821202 | 134 |
| 245 | 3300005614 | Ga0068856_101400144 | Ga0068856_1014001442 | 134 |
| 246 | 3300005618 | Ga0068864_100230011 | Ga0068864_1002300112 | 134 |
| 247 | 3300005618 | Ga0068864_100322093 | Ga0068864_1003220931 | 134 |
| 248 | 3300005618 | Ga0068864_100654863 | Ga0068864_1006548632 | 134 |
| 249 | 3300005834 | Ga0068851_10285585 | Ga0068851_102855852 | 134 |
| 250 | 3300005841 | Ga0068863_100027165 | Ga0068863_1000271655 | 134 |
| 251 | 3300005842 | Ga0068858_100066089 | Ga0068858_1000660895 | 134 |
| 252 | 3300005843 | Ga0068860_100900984 | Ga0068860_1009009842 | 134 |
| 253 | 3300006358 | Ga0068871_101154379 | Ga0068871_1011543791 | 134 |
| 254 | 3300006844 | Ga0075428_101035473 | Ga0075428_1010354731 | 134 |
| 255 | 3300006881 | Ga0068865_100620588 | Ga0068865_1006205882 | 134 |
| 256 | 3300007076 | Ga0075435_100746974 | Ga0075435_1007469742 | 134 |
| 257 | 3300009093 | Ga0105240_10135001 | Ga0105240_101350012 | 134 |
| 258 | 3300009093 | Ga0105240_10195588 | Ga0105240_101955883 | 134 |
| 259 | 3300009093 | Ga0105240_10360470 | Ga0105240_103604702 | 134 |
| 260 | 3300009098 | Ga0105245_10151876 | Ga0105245_101518762 | 134 |
| 261 | 3300009148 | Ga0105243_10240159 | Ga0105243_102401593 | 134 |
| 262 | 3300009177 | Ga0105248_10360308 | Ga0105248_103603082 | 134 |
| 263 | 3300009551 | Ga0105238_10001483 | Ga0105238_100014837 | 134 |
| 264 | 3300009551 | Ga0105238_10335262 | Ga0105238_103352623 | 134 |
| 265 | 3300010375 | Ga0105239_10168691 | Ga0105239_101686913 | 134 |
| 266 | 3300010375 | Ga0105239_10276437 | Ga0105239_102764373 | 134 |
| 267 | 3300010375 | Ga0105239_11645035 | Ga0105239_116450352 | 134 |
| 268 | 3300011119 | Ga0105246_11375049 | Ga0105246_113750491 | 134 |
| 269 | 3300013105 | Ga0157369_10396633 | Ga0157369_103966332 | 134 |
| 270 | 3300013297 | Ga0157378_10084611 | Ga0157378_100846112 | 134 |
| 271 | 3300013297 | Ga0157378_10421139 | Ga0157378_104211392 | 134 |
| 272 | 3300013307 | Ga0157372_10515495 | Ga0157372_105154952 | 134 |
| 273 | 3300013308 | Ga0157375_10324228 | Ga0157375_103242283 | 134 |
| 274 | 3300014325 | Ga0163163_10229598 | Ga0163163_102295982 | 134 |
| 275 | 3300014325 | Ga0163163_10428995 | Ga0163163_104289952 | 134 |
| 276 | 3300014325 | Ga0163163_12596501 | Ga0163163_125965012 | 134 |
| 277 | 3300017792 | Ga0163161_10997841 | Ga0163161_109978412 | 134 |
| 278 | 3300025903 | Ga0207680_10031608 | Ga0207680_100316083 | 134 |
| 279 | 3300025911 | Ga0207654_10428162 | Ga0207654_104281622 | 134 |
| 280 | 3300025913 | Ga0207695_10061810 | Ga0207695_100618102 | 134 |
| 281 | 3300025913 | Ga0207695_10182630 | Ga0207695_101826303 | 134 |
| 282 | 3300025913 | Ga0207695_10403838 | Ga0207695_104038382 | 134 |
| 283 | 3300025914 | Ga0207671_10231775 | Ga0207671_102317752 | 134 |
| 284 | 3300025919 | Ga0207657_10187880 | Ga0207657_101878802 | 134 |
| 285 | 3300025922 | Ga0207646_10229402 | Ga0207646_102294022 | 134 |
| 286 | 3300025922 | Ga0207646_11102143 | Ga0207646_111021432 | 134 |
| 287 | 3300025924 | Ga0207694_10001304 | Ga0207694_1000130413 | 134 |
| 288 | 3300025924 | Ga0207694_10139461 | Ga0207694_101394611 | 134 |
| 289 | 3300025933 | Ga0207706_10129735 | Ga0207706_101297352 | 134 |
| 290 | 3300025938 | Ga0207704_11259257 | Ga0207704_112592571 | 134 |
| 291 | 3300025941 | Ga0207711_10369988 | Ga0207711_103699882 | 134 |
| 292 | 3300025941 | Ga0207711_11151744 | Ga0207711_111517442 | 134 |
| 293 | 3300025944 | Ga0207661_10096634 | Ga0207661_100966342 | 134 |
| 294 | 3300025949 | Ga0207667_10390040 | Ga0207667_103900402 | 134 |
| 295 | 3300025949 | Ga0207667_10553330 | Ga0207667_105533302 | 134 |
| 296 | 3300025960 | Ga0207651_11468162 | Ga0207651_114681621 | 134 |
| 297 | 3300025986 | Ga0207658_10693462 | Ga0207658_106934622 | 134 |
| 298 | 3300026035 | Ga0207703_10050402 | Ga0207703_100504023 | 134 |
| 299 | 3300026041 | Ga0207639_11218992 | Ga0207639_112189921 | 134 |
| 300 | 3300026067 | Ga0207678_10800125 | Ga0207678_108001252 | 134 |
| 301 | 3300026078 | Ga0207702_11591522 | Ga0207702_115915222 | 134 |
| 302 | 3300026088 | Ga0207641_10022099 | Ga0207641_100220994 | 134 |
| 303 | 3300026116 | Ga0207674_10185022 | Ga0207674_101850222 | 134 |
| 304 | 3300026118 | Ga0207675_100741210 | Ga0207675_1007412102 | 134 |
| 305 | 3300026121 | Ga0207683_10023066 | Ga0207683_100230664 | 134 |
| 306 | 3300028379 | Ga0268266_10003259 | Ga0268266_1000325916 | 134 |
| 307 | 3300028379 | Ga0268266_10076843 | Ga0268266_100768434 | 134 |
| 308 | 3300028379 | Ga0268266_10106531 | Ga0268266_101065314 | 134 |
| 309 | 3300028381 | Ga0268264_10751625 | Ga0268264_107516252 | 134 |
| 310 | 3300028381 | Ga0268264_11091014 | Ga0268264_110910142 | 134 |
| 311 | 3300031235 | Ga0265330_10380382 | Ga0265330_103803822 | 134 |
| 312 | 3300031241 | Ga0265325_10066791 | Ga0265325_100667912 | 134 |
| 313 | 3300031247 | Ga0265340_10383306 | Ga0265340_103833062 | 134 |
| 314 | 3300031250 | Ga0265331_10000129 | Ga0265331_1000012996 | 134 |
| 315 | 3300031456 | Ga0307513_10014267 | Ga0307513_1001426711 | 134 |
| 316 | 3300031548 | Ga0307408_100048660 | Ga0307408_1000486604 | 134 |
| 317 | 3300031595 | Ga0265313_10232980 | Ga0265313_102329802 | 134 |
| 318 | 3300031711 | Ga0265314_10021087 | Ga0265314_100210872 | 134 |
| 319 | 3300031727 | Ga0316576_10139416 | Ga0316576_101394162 | 134 |
| 320 | 3300031731 | Ga0307405_10148725 | Ga0307405_101487252 | 134 |
| 321 | 3300031824 | Ga0307413_10238592 | Ga0307413_102385922 | 134 |
| 322 | 3300031901 | Ga0307406_10527221 | Ga0307406_105272211 | 134 |
| 323 | 3300032133 | Ga0316583_10015512 | Ga0316583_100155122 | 134 |
| 324 | 3300032139 | Ga0316580_10054191 | Ga0316580_100541912 | 134 |
| 325 | 3300036647 | Ga0316582_0706051 | Ga0316582_0706051_32_436 | 134 |
| 326 | 3300036712 | Ga0316584_0210669 | Ga0316584_0210669_286_690 | 134 |
| 327 | 3300037312 | Ga0395899_0019749 | Ga0395899_0019749_1630_2043 | 134 |
| 328 | 3300037853 | Ga0436364_0530473 | Ga0436364_0530473_440_856 | 134 |
| 329 | 3300041408 | Ga0439453_0024997 | Ga0439453_0024997_384_800 | 134 |
| 330 | 3300041498 | Ga0451841_1012353 | Ga0451841_1012353_310_714 | 134 |
| 331 | 3300042436 | Ga0439435_0002941 | Ga0439435_0002941_474_890 | 134 |
| 332 | 3300042438 | Ga0439459_0233306 | Ga0439459_0233306_65_478 | 134 |
| 333 | 3300046660 | Ga0495625_0221462 | Ga0495625_0221462_173_592 | 134 |
| 334 | 3300046665 | Ga0495661_0253567 | Ga0495661_0253567_229_636 | 134 |
| 335 | 3300047315 | Ga0495581_0598538 | Ga0495581_0598538_158_562 | 134 |
| 336 | 3300047445 | Ga0495677_0048043 | Ga0495677_0048043_242_649 | 134 |
| 337 | 3300048088 | Ga0495602_0266929 | Ga0495602_0266929_168_587 | 134 |
| 338 | 3300048904 | Ga0496101_1155395 | Ga0496101_1155395_24_437 | 134 |
| 339 | 3300048915 | Ga0496112_1084745 | Ga0496112_1084745_241_648 | 134 |
| 340 | 3300048915 | Ga0496112_1127120 | Ga0496112_1127120_23_427 | 134 |
| 341 | 3300048924 | Ga0496121_0686703 | Ga0496121_0686703_16_435 | 134 |
| 342 | 3300048929 | Ga0496126_0301478 | Ga0496126_0301478_222_635 | 134 |
| 343 | 3300048929 | Ga0496126_1022797 | Ga0496126_1022797_185_592 | 134 |
| 344 | 3300049568 | Ga0501031_0961442 | Ga0501031_0961442_71_481 | 134 |
| 345 | 3300049571 | Ga0501034_0005961 | Ga0501034_0005961_9570_9986 | 134 |
| 346 | 3300049575 | Ga0501039_0733426 | Ga0501039_0733426_110_526 | 134 |
| 347 | 3300049575 | Ga0501039_1398429 | Ga0501039_1398429_79_492 | 134 |
| 348 | 3300049580 | Ga0501046_0005370 | Ga0501046_0005370_10614_11030 | 134 |
| 349 | 3300049581 | Ga0501047_0102782 | Ga0501047_0102782_1771_2187 | 134 |
| 350 | 3300049581 | Ga0501047_0179097 | Ga0501047_0179097_1300_1716 | 134 |
| 351 | 3300049582 | Ga0501048_0716363 | Ga0501048_0716363_78_482 | 134 |
| 352 | 3300049583 | Ga0501067_0001416 | Ga0501067_0001416_5506_5910 | 134 |
| 353 | 3300049589 | Ga0501073_0014072 | Ga0501073_0014072_5301_5708 | 134 |
| 354 | 3300049589 | Ga0501073_0146493 | Ga0501073_0146493_821_1225 | 134 |
| 355 | 3300049589 | Ga0501073_0400517 | Ga0501073_0400517_15_419 | 134 |
| 356 | 3300049592 | Ga0501076_0412659 | Ga0501076_0412659_350_754 | 134 |
| 357 | 3300049593 | Ga0501077_0166759 | Ga0501077_0166759_923_1327 | 134 |
| 358 | 3300049593 | Ga0501077_0703827 | Ga0501077_0703827_210_614 | 134 |
| 359 | 3300049744 | Ga0501083_0003409 | Ga0501083_0003409_9143_9547 | 134 |
| 360 | 3300049744 | Ga0501083_0045435 | Ga0501083_0045435_599_1003 | 134 |
| 361 | 3300049744 | Ga0501083_0249577 | Ga0501083_0249577_40_447 | 134 |
| 362 | 3300049744 | Ga0501083_0327259 | Ga0501083_0327259_64_468 | 134 |
| 363 | 3300049744 | Ga0501083_0366336 | Ga0501083_0366336_283_708 | 134 |
| 364 | 3300049776 | Ga0501280_003723 | Ga0501280_003723_826_1230 | 134 |
| 365 | 3300049823 | Ga0501044_0028936 | Ga0501044_0028936_4585_5001 | 134 |
| 366 | 3300049823 | Ga0501044_0335099 | Ga0501044_0335099_20_445 | 134 |
| 367 | 3300049823 | Ga0501044_1044403 | Ga0501044_1044403_254_667 | 134 |
| 368 | 3300050513 | nmdc:mga0rr50_1141444_c1 | nmdc:mga0rr50_1141444_c1_58_465 | 134 |
| 369 | 3300053078 | Ga0495612_0211089 | Ga0495612_0211089_50_469 | 134 |
| 370 | 3300053085 | Ga0495619_0046494 | Ga0495619_0046494_1752_2159 | 134 |
| 371 | 3300053092 | Ga0500583_0124548 | Ga0500583_0124548_843_1247 | 134 |
| 372 | 3300053093 | Ga0500651_0296726 | Ga0500651_0296726_439_843 | 134 |
| 373 | 3300053096 | Ga0500641_0079550 | Ga0500641_0079550_620_1024 | 134 |
| 374 | 3300053104 | Ga0500556_0000903 | Ga0500556_0000903_3772_4185 | 134 |
| 375 | 3300053108 | Ga0500562_019830 | Ga0500562_019830_462_875 | 134 |
| 376 | 3300053119 | Ga0500595_030648 | Ga0500595_030648_337_750 | 134 |
| 377 | 3300053130 | Ga0500642_0058722 | Ga0500642_0058722_115_519 | 134 |
| 378 | 3300053140 | Ga0500573_0000050 | Ga0500573_0000050_8015_8422 | 134 |
| 379 | 3300053146 | Ga0500588_0135843 | Ga0500588_0135843_178_582 | 134 |
| 380 | 3300053153 | Ga0500616_0013071 | Ga0500616_0013071_1885_2298 | 134 |
| 381 | 3300053158 | Ga0500627_0134264 | Ga0500627_0134264_384_788 | 134 |
| 382 | 3300054114 | Ga0501084_0009497 | Ga0501084_0009497_6380_6784 | 134 |
| 383 | 3300054114 | Ga0501084_0490384 | Ga0501084_0490384_202_606 | 134 |
| 384 | 3300060353 | Ga0501082_0007775 | Ga0501082_0007775_4707_5111 | 134 |
| 385 | 3300060353 | Ga0501082_0192855 | Ga0501082_0192855_800_1204 | 134 |
| 386 | 3300060353 | Ga0501082_0515768 | Ga0501082_0515768_14_445 | 134 |
| 387 | 3300060353 | Ga0501082_1562402 | Ga0501082_1562402_130_546 | 134 |
| 388 | 3300039438 | Ga0436360_0247471 | Ga0436360_0247471_254_667 | 135 |
| 389 | 3300049576 | Ga0501040_0290747 | Ga0501040_0290747_633_1040 | 135 |
| 390 | 3300049592 | Ga0501076_1492929 | Ga0501076_1492929_88_501 | 135 |
| 391 | 3300054114 | Ga0501084_1611793 | Ga0501084_1611793_31_438 | 135 |
| 392 | 2162886012 | MBSR1b_contig_7412730 | MBSR1b_0930.00003780 | 136 |
| 393 | 3300000043 | ARcpr5yngRDRAFT_c004757 | ARcpr5yngRDRAFT_0047571 | 136 |
| 394 | 3300005293 | Ga0065715_10268011 | Ga0065715_102680112 | 136 |
| 395 | 3300005330 | Ga0070690_101176865 | Ga0070690_1011768652 | 136 |
| 396 | 3300005338 | Ga0068868_100902311 | Ga0068868_1009023111 | 136 |
| 397 | 3300005340 | Ga0070689_100197493 | Ga0070689_1001974933 | 136 |
| 398 | 3300005341 | Ga0070691_10960660 | Ga0070691_109606601 | 136 |
| 399 | 3300005347 | Ga0070668_100027626 | Ga0070668_1000276265 | 136 |
| 400 | 3300005356 | Ga0070674_100006467 | Ga0070674_1000064677 | 136 |
| 401 | 3300005364 | Ga0070673_100256128 | Ga0070673_1002561282 | 136 |
| 402 | 3300005366 | Ga0070659_100543691 | Ga0070659_1005436912 | 136 |
| 403 | 3300005367 | Ga0070667_100337057 | Ga0070667_1003370572 | 136 |
| 404 | 3300005367 | Ga0070667_100684794 | Ga0070667_1006847941 | 136 |
| 405 | 3300005435 | Ga0070714_102441231 | Ga0070714_1024412311 | 136 |
| 406 | 3300005440 | Ga0070705_100279459 | Ga0070705_1002794591 | 136 |
| 407 | 3300005440 | Ga0070705_100630295 | Ga0070705_1006302951 | 136 |
| 408 | 3300005441 | Ga0070700_100095903 | Ga0070700_1000959033 | 136 |
| 409 | 3300005441 | Ga0070700_100531114 | Ga0070700_1005311142 | 136 |
| 410 | 3300005444 | Ga0070694_100096916 | Ga0070694_1000969163 | 136 |
| 411 | 3300005455 | Ga0070663_100175047 | Ga0070663_1001750472 | 136 |
| 412 | 3300005457 | Ga0070662_100029376 | Ga0070662_1000293763 | 136 |
| 413 | 3300005457 | Ga0070662_100081080 | Ga0070662_1000810803 | 136 |
| 414 | 3300005459 | Ga0068867_101238439 | Ga0068867_1012384392 | 136 |
| 415 | 3300005468 | Ga0070707_102105393 | Ga0070707_1021053931 | 136 |
| 416 | 3300005545 | Ga0070695_100192066 | Ga0070695_1001920662 | 136 |
| 417 | 3300005546 | Ga0070696_100292825 | Ga0070696_1002928251 | 136 |
| 418 | 3300005546 | Ga0070696_100795984 | Ga0070696_1007959842 | 136 |
| 419 | 3300005549 | Ga0070704_100134290 | Ga0070704_1001342902 | 136 |
| 420 | 3300005549 | Ga0070704_100650864 | Ga0070704_1006508642 | 136 |
| 421 | 3300005578 | Ga0068854_100521173 | Ga0068854_1005211732 | 136 |
| 422 | 3300005615 | Ga0070702_100027411 | Ga0070702_1000274113 | 136 |
| 423 | 3300005617 | Ga0068859_100138423 | Ga0068859_1001384233 | 136 |
| 424 | 3300005618 | Ga0068864_100927009 | Ga0068864_1009270092 | 136 |
| 425 | 3300005719 | Ga0068861_100076482 | Ga0068861_1000764822 | 136 |
| 426 | 3300005719 | Ga0068861_100078434 | Ga0068861_1000784343 | 136 |
| 427 | 3300005841 | Ga0068863_101289689 | Ga0068863_1012896892 | 136 |
| 428 | 3300005842 | Ga0068858_101216245 | Ga0068858_1012162452 | 136 |
| 429 | 3300005843 | Ga0068860_100069279 | Ga0068860_1000692792 | 136 |
| 430 | 3300006175 | Ga0070712_100495967 | Ga0070712_1004959672 | 136 |
| 431 | 3300006237 | Ga0097621_100464354 | Ga0097621_1004643542 | 136 |
| 432 | 3300006846 | Ga0075430_100545958 | Ga0075430_1005459582 | 136 |
| 433 | 3300006847 | Ga0075431_100414498 | Ga0075431_1004144982 | 136 |
| 434 | 3300006852 | Ga0075433_10024314 | Ga0075433_100243143 | 136 |
| 435 | 3300006852 | Ga0075433_10480909 | Ga0075433_104809092 | 136 |
| 436 | 3300006871 | Ga0075434_100228066 | Ga0075434_1002280662 | 136 |
| 437 | 3300006881 | Ga0068865_100248755 | Ga0068865_1002487552 | 136 |
| 438 | 3300006931 | Ga0097620_100138424 | Ga0097620_1001384243 | 136 |
| 439 | 3300007076 | Ga0075435_100577628 | Ga0075435_1005776281 | 136 |
| 440 | 3300007076 | Ga0075435_100902436 | Ga0075435_1009024362 | 136 |
| 441 | 3300009094 | Ga0111539_10018884 | Ga0111539_100188844 | 136 |
| 442 | 3300009098 | Ga0105245_10306002 | Ga0105245_103060022 | 136 |
| 443 | 3300009098 | Ga0105245_10587001 | Ga0105245_105870011 | 136 |
| 444 | 3300009147 | Ga0114129_10189058 | Ga0114129_101890582 | 136 |
| 445 | 3300009147 | Ga0114129_10436153 | Ga0114129_104361533 | 136 |
| 446 | 3300009147 | Ga0114129_10751688 | Ga0114129_107516882 | 136 |
| 447 | 3300009148 | Ga0105243_10090794 | Ga0105243_100907942 | 136 |
| 448 | 3300009148 | Ga0105243_10441408 | Ga0105243_104414082 | 136 |
| 449 | 3300009176 | Ga0105242_10157289 | Ga0105242_101572892 | 136 |
| 450 | 3300009177 | Ga0105248_10161255 | Ga0105248_101612553 | 136 |
| 451 | 3300009177 | Ga0105248_12072374 | Ga0105248_120723741 | 136 |
| 452 | 3300009553 | Ga0105249_10043257 | Ga0105249_100432573 | 136 |
| 453 | 3300009553 | Ga0105249_10903075 | Ga0105249_109030751 | 136 |
| 454 | 3300010375 | Ga0105239_10234600 | Ga0105239_102346003 | 136 |
| 455 | 3300010375 | Ga0105239_10628665 | Ga0105239_106286652 | 136 |
| 456 | 3300011119 | Ga0105246_10011521 | Ga0105246_100115214 | 136 |
| 457 | 3300011119 | Ga0105246_10244580 | Ga0105246_102445802 | 136 |
| 458 | 3300012515 | Ga0157338_1006018 | Ga0157338_10060181 | 136 |
| 459 | 3300013100 | Ga0157373_10282672 | Ga0157373_102826722 | 136 |
| 460 | 3300013297 | Ga0157378_10200142 | Ga0157378_102001422 | 136 |
| 461 | 3300013306 | Ga0163162_10126833 | Ga0163162_101268334 | 136 |
| 462 | 3300013306 | Ga0163162_10205282 | Ga0163162_102052822 | 136 |
| 463 | 3300013306 | Ga0163162_10822745 | Ga0163162_108227451 | 136 |
| 464 | 3300013306 | Ga0163162_10893931 | Ga0163162_108939311 | 136 |
| 465 | 3300013307 | Ga0157372_10258767 | Ga0157372_102587673 | 136 |
| 466 | 3300013308 | Ga0157375_10072994 | Ga0157375_100729942 | 136 |
| 467 | 3300013308 | Ga0157375_10126363 | Ga0157375_101263632 | 136 |
| 468 | 3300014326 | Ga0157380_10266891 | Ga0157380_102668912 | 136 |
| 469 | 3300014968 | Ga0157379_10016306 | Ga0157379_100163063 | 136 |
| 470 | 3300014968 | Ga0157379_11214016 | Ga0157379_112140162 | 136 |
| 471 | 3300017792 | Ga0163161_10025400 | Ga0163161_100254004 | 136 |
| 472 | 3300017792 | Ga0163161_10425344 | Ga0163161_104253441 | 136 |
| 473 | 3300017792 | Ga0163161_10473732 | Ga0163161_104737321 | 136 |
| 474 | 3300025907 | Ga0207645_10417234 | Ga0207645_104172342 | 136 |
| 475 | 3300025917 | Ga0207660_10472934 | Ga0207660_104729342 | 136 |
| 476 | 3300025917 | Ga0207660_10689114 | Ga0207660_106891142 | 136 |
| 477 | 3300025919 | Ga0207657_10312121 | Ga0207657_103121212 | 136 |
| 478 | 3300025927 | Ga0207687_10093656 | Ga0207687_100936562 | 136 |
| 479 | 3300025931 | Ga0207644_10962154 | Ga0207644_109621542 | 136 |
| 480 | 3300025932 | Ga0207690_10847107 | Ga0207690_108471072 | 136 |
| 481 | 3300025933 | Ga0207706_10110067 | Ga0207706_101100673 | 136 |
| 482 | 3300025934 | Ga0207686_10283761 | Ga0207686_102837612 | 136 |
| 483 | 3300025935 | Ga0207709_10041366 | Ga0207709_100413662 | 136 |
| 484 | 3300025935 | Ga0207709_10102890 | Ga0207709_101028902 | 136 |
| 485 | 3300025936 | Ga0207670_10271815 | Ga0207670_102718152 | 136 |
| 486 | 3300025937 | Ga0207669_10254159 | Ga0207669_102541592 | 136 |
| 487 | 3300025940 | Ga0207691_10883181 | Ga0207691_108831812 | 136 |
| 488 | 3300025941 | Ga0207711_10219152 | Ga0207711_102191523 | 136 |
| 489 | 3300025961 | Ga0207712_10340422 | Ga0207712_103404222 | 136 |
| 490 | 3300025961 | Ga0207712_10859900 | Ga0207712_108599001 | 136 |
| 491 | 3300025972 | Ga0207668_10038442 | Ga0207668_100384422 | 136 |
| 492 | 3300025972 | Ga0207668_10399489 | Ga0207668_103994891 | 136 |
| 493 | 3300025981 | Ga0207640_10130889 | Ga0207640_101308891 | 136 |
| 494 | 3300025981 | Ga0207640_10995842 | Ga0207640_109958422 | 136 |
| 495 | 3300025986 | Ga0207658_10553779 | Ga0207658_105537792 | 136 |
| 496 | 3300025986 | Ga0207658_10653662 | Ga0207658_106536622 | 136 |
| 497 | 3300026023 | Ga0207677_10313038 | Ga0207677_103130382 | 136 |
| 498 | 3300026035 | Ga0207703_10201848 | Ga0207703_102018482 | 136 |
| 499 | 3300026035 | Ga0207703_10962798 | Ga0207703_109627982 | 136 |
| 500 | 3300026067 | Ga0207678_10142618 | Ga0207678_101426183 | 136 |
| 501 | 3300026075 | Ga0207708_10071218 | Ga0207708_100712182 | 136 |
| 502 | 3300026075 | Ga0207708_10683620 | Ga0207708_106836202 | 136 |
| 503 | 3300026088 | Ga0207641_11271775 | Ga0207641_112717752 | 136 |
| 504 | 3300026089 | Ga0207648_10294933 | Ga0207648_102949332 | 136 |
| 505 | 3300026095 | Ga0207676_10556027 | Ga0207676_105560272 | 136 |
| 506 | 3300026095 | Ga0207676_10885382 | Ga0207676_108853822 | 136 |
| 507 | 3300026116 | Ga0207674_11431300 | Ga0207674_114313002 | 136 |
| 508 | 3300026118 | Ga0207675_100012855 | Ga0207675_1000128553 | 136 |
| 509 | 3300026118 | Ga0207675_100086733 | Ga0207675_1000867332 | 136 |
| 510 | 3300026118 | Ga0207675_100302590 | Ga0207675_1003025902 | 136 |
| 511 | 3300028380 | Ga0268265_10432025 | Ga0268265_104320252 | 136 |
| 512 | 3300028381 | Ga0268264_11073943 | Ga0268264_110739431 | 136 |
| 513 | 3300031691 | Ga0316579_10058415 | Ga0316579_100584152 | 136 |
| 514 | 3300035114 | Ga0373939_0274975 | Ga0373939_0274975_94_507 | 136 |
| 515 | 3300035116 | Ga0373945_0069025 | Ga0373945_0069025_581_991 | 136 |
| 516 | 3300035171 | Ga0373946_0077239 | Ga0373946_0077239_437_847 | 136 |
| 517 | 3300035241 | Ga0373961_0210164 | Ga0373961_0210164_116_526 | 136 |
| 518 | 3300035242 | Ga0373962_0097976 | Ga0373962_0097976_169_582 | 136 |
| 519 | 3300035691 | Ga0373931_0024643 | Ga0373931_0024643_314_727 | 136 |
| 520 | 3300035692 | Ga0373935_0089753 | Ga0373935_0089753_181_591 | 136 |
| 521 | 3300041460 | Ga0451802_0507537 | Ga0451802_0507537_28_447 | 136 |
| 522 | 3300045051 | Ga0451576_1161003 | Ga0451576_1161003_36_446 | 136 |
| 523 | 3300045051 | Ga0451576_2343035 | Ga0451576_2343035_75_488 | 136 |
| 524 | 3300046452 | Ga0495617_241172 | Ga0495617_241172_84_494 | 136 |
| 525 | 3300046455 | Ga0495603_0000627 | Ga0495603_0000627_528_938 | 136 |
| 526 | 3300046459 | Ga0495629_0007106 | Ga0495629_0007106_3367_3777 | 136 |
| 527 | 3300046461 | Ga0495641_0007313 | Ga0495641_0007313_2267_2677 | 136 |
| 528 | 3300046472 | Ga0495580_0000299 | Ga0495580_0000299_33603_34013 | 136 |
| 529 | 3300046475 | Ga0495639_0002035 | Ga0495639_0002035_8013_8423 | 136 |
| 530 | 3300046491 | Ga0495584_0026383 | Ga0495584_0026383_2449_2859 | 136 |
| 531 | 3300046492 | Ga0495585_0109548 | Ga0495585_0109548_184_594 | 136 |
| 532 | 3300046499 | Ga0495594_0000131 | Ga0495594_0000131_16024_16434 | 136 |
| 533 | 3300046501 | Ga0495607_0387675 | Ga0495607_0387675_142_552 | 136 |
| 534 | 3300046513 | Ga0495616_0133079 | Ga0495616_0133079_599_1009 | 136 |
| 535 | 3300046513 | Ga0495616_0278684 | Ga0495616_0278684_232_645 | 136 |
| 536 | 3300046520 | Ga0495637_0101299 | Ga0495637_0101299_244_657 | 136 |
| 537 | 3300046531 | Ga0495665_0002454 | Ga0495665_0002454_5110_5520 | 136 |
| 538 | 3300046536 | Ga0495587_0066743 | Ga0495587_0066743_883_1293 | 136 |
| 539 | 3300046538 | Ga0495609_0349414 | Ga0495609_0349414_108_518 | 136 |
| 540 | 3300046557 | Ga0495622_0004321 | Ga0495622_0004321_5472_5882 | 136 |
| 541 | 3300046615 | Ga0495656_0017177 | Ga0495656_0017177_1839_2249 | 136 |
| 542 | 3300046616 | Ga0495668_0474763 | Ga0495668_0474763_59_469 | 136 |
| 543 | 3300046642 | Ga0495634_0017557 | Ga0495634_0017557_115_525 | 136 |
| 544 | 3300046674 | Ga0495588_0000613 | Ga0495588_0000613_10545_10955 | 136 |
| 545 | 3300046683 | Ga0495658_0002461 | Ga0495658_0002461_361_771 | 136 |
| 546 | 3300046684 | Ga0495669_0506806 | Ga0495669_0506806_149_562 | 136 |
| 547 | 3300046690 | Ga0495624_0177926 | Ga0495624_0177926_652_1062 | 136 |
| 548 | 3300046691 | Ga0495670_0807314 | Ga0495670_0807314_38_448 | 136 |
| 549 | 3300047315 | Ga0495581_0000843 | Ga0495581_0000843_13629_14039 | 136 |
| 550 | 3300047444 | Ga0495675_0513036 | Ga0495675_0513036_100_510 | 136 |
| 551 | 3300047471 | Ga0495684_0485136 | Ga0495684_0485136_207_617 | 136 |
| 552 | 3300048089 | Ga0495614_0000595 | Ga0495614_0000595_1708_2118 | 136 |
| 553 | 3300048903 | Ga0496100_0088386 | Ga0496100_0088386_1395_1805 | 136 |
| 554 | 3300048904 | Ga0496101_1186577 | Ga0496101_1186577_176_586 | 136 |
| 555 | 3300048905 | Ga0496102_0009775 | Ga0496102_0009775_4313_4726 | 136 |
| 556 | 3300048905 | Ga0496102_0114053 | Ga0496102_0114053_476_886 | 136 |
| 557 | 3300048905 | Ga0496102_0450756 | Ga0496102_0450756_630_1040 | 136 |
| 558 | 3300048906 | Ga0496103_0008489 | Ga0496103_0008489_3904_4317 | 136 |
| 559 | 3300048907 | Ga0496104_0023377 | Ga0496104_0023377_3475_3885 | 136 |
| 560 | 3300048907 | Ga0496104_0306877 | Ga0496104_0306877_74_484 | 136 |
| 561 | 3300048907 | Ga0496104_0735116 | Ga0496104_0735116_241_654 | 136 |
| 562 | 3300048908 | Ga0496105_0315015 | Ga0496105_0315015_693_1103 | 136 |
| 563 | 3300048908 | Ga0496105_0728021 | Ga0496105_0728021_113_523 | 136 |
| 564 | 3300048909 | Ga0496106_0023578 | Ga0496106_0023578_3578_3988 | 136 |
| 565 | 3300048909 | Ga0496106_0070147 | Ga0496106_0070147_2173_2583 | 136 |
| 566 | 3300048909 | Ga0496106_0264884 | Ga0496106_0264884_779_1192 | 136 |
| 567 | 3300048910 | Ga0496107_0024412 | Ga0496107_0024412_1325_1735 | 136 |
| 568 | 3300048910 | Ga0496107_0058795 | Ga0496107_0058795_469_882 | 136 |
| 569 | 3300048911 | Ga0496108_0117227 | Ga0496108_0117227_1538_1948 | 136 |
| 570 | 3300048911 | Ga0496108_0189284 | Ga0496108_0189284_731_1141 | 136 |
| 571 | 3300048912 | Ga0496109_0011144 | Ga0496109_0011144_3748_4158 | 136 |
| 572 | 3300048912 | Ga0496109_0023962 | Ga0496109_0023962_1939_2349 | 136 |
| 573 | 3300048912 | Ga0496109_0063870 | Ga0496109_0063870_1834_2247 | 136 |
| 574 | 3300048913 | Ga0496110_0093793 | Ga0496110_0093793_1693_2106 | 136 |
| 575 | 3300048913 | Ga0496110_0484000 | Ga0496110_0484000_329_739 | 136 |
| 576 | 3300048914 | Ga0496111_0359525 | Ga0496111_0359525_545_955 | 136 |
| 577 | 3300048915 | Ga0496112_0012419 | Ga0496112_0012419_6939_7349 | 136 |
| 578 | 3300048915 | Ga0496112_0229806 | Ga0496112_0229806_463_873 | 136 |
| 579 | 3300048915 | Ga0496112_0904927 | Ga0496112_0904927_223_636 | 136 |
| 580 | 3300048916 | Ga0496113_0065408 | Ga0496113_0065408_1854_2264 | 136 |
| 581 | 3300048916 | Ga0496113_0211701 | Ga0496113_0211701_498_911 | 136 |
| 582 | 3300048917 | Ga0496114_0006475 | Ga0496114_0006475_4426_4836 | 136 |
| 583 | 3300048918 | Ga0496115_0065176 | Ga0496115_0065176_662_1072 | 136 |
| 584 | 3300049568 | Ga0501031_0038071 | Ga0501031_0038071_1969_2382 | 136 |
| 585 | 3300049569 | Ga0501032_0193534 | Ga0501032_0193534_52_465 | 136 |
| 586 | 3300049569 | Ga0501032_0406552 | Ga0501032_0406552_249_662 | 136 |
| 587 | 3300049570 | Ga0501033_0603605 | Ga0501033_0603605_208_621 | 136 |
| 588 | 3300049572 | Ga0501036_0171298 | Ga0501036_0171298_501_914 | 136 |
| 589 | 3300049572 | Ga0501036_0179190 | Ga0501036_0179190_502_912 | 136 |
| 590 | 3300049573 | Ga0501037_0477216 | Ga0501037_0477216_82_495 | 136 |
| 591 | 3300049574 | Ga0501038_0062640 | Ga0501038_0062640_580_993 | 136 |
| 592 | 3300049574 | Ga0501038_0110360 | Ga0501038_0110360_1754_2167 | 136 |
| 593 | 3300049574 | Ga0501038_0398767 | Ga0501038_0398767_26_439 | 136 |
| 594 | 3300049575 | Ga0501039_0042416 | Ga0501039_0042416_2362_2775 | 136 |
| 595 | 3300049575 | Ga0501039_0061840 | Ga0501039_0061840_1051_1464 | 136 |
| 596 | 3300049575 | Ga0501039_0183921 | Ga0501039_0183921_1197_1610 | 136 |
| 597 | 3300049576 | Ga0501040_0027155 | Ga0501040_0027155_298_711 | 136 |
| 598 | 3300049576 | Ga0501040_0090293 | Ga0501040_0090293_412_825 | 136 |
| 599 | 3300049576 | Ga0501040_0652483 | Ga0501040_0652483_24_437 | 136 |
| 600 | 3300049577 | Ga0501041_0017902 | Ga0501041_0017902_303_716 | 136 |
| 601 | 3300049578 | Ga0501042_0093570 | Ga0501042_0093570_1473_1886 | 136 |
| 602 | 3300049579 | Ga0501043_0037738 | Ga0501043_0037738_1413_1826 | 136 |
| 603 | 3300049579 | Ga0501043_0079525 | Ga0501043_0079525_2042_2455 | 136 |
| 604 | 3300049580 | Ga0501046_0065978 | Ga0501046_0065978_81_494 | 136 |
| 605 | 3300049580 | Ga0501046_0112238 | Ga0501046_0112238_1605_2018 | 136 |
| 606 | 3300049581 | Ga0501047_0154272 | Ga0501047_0154272_1107_1520 | 136 |
| 607 | 3300049582 | Ga0501048_0012118 | Ga0501048_0012118_4870_5283 | 136 |
| 608 | 3300049582 | Ga0501048_0019338 | Ga0501048_0019338_3468_3881 | 136 |
| 609 | 3300049582 | Ga0501048_0094546 | Ga0501048_0094546_529_942 | 136 |
| 610 | 3300049583 | Ga0501067_0046177 | Ga0501067_0046177_194_604 | 136 |
| 611 | 3300049584 | Ga0501068_0056384 | Ga0501068_0056384_911_1324 | 136 |
| 612 | 3300049584 | Ga0501068_0149739 | Ga0501068_0149739_125_538 | 136 |
| 613 | 3300049585 | Ga0501069_0431211 | Ga0501069_0431211_32_445 | 136 |
| 614 | 3300049587 | Ga0501071_0189680 | Ga0501071_0189680_787_1200 | 136 |
| 615 | 3300049587 | Ga0501071_0281108 | Ga0501071_0281108_92_502 | 136 |
| 616 | 3300049587 | Ga0501071_0350578 | Ga0501071_0350578_145_558 | 136 |
| 617 | 3300049588 | Ga0501072_0014249 | Ga0501072_0014249_4211_4624 | 136 |
| 618 | 3300049588 | Ga0501072_0108051 | Ga0501072_0108051_786_1199 | 136 |
| 619 | 3300049588 | Ga0501072_0821301 | Ga0501072_0821301_59_472 | 136 |
| 620 | 3300049588 | Ga0501072_1039086 | Ga0501072_1039086_118_531 | 136 |
| 621 | 3300049589 | Ga0501073_0194547 | Ga0501073_0194547_638_1048 | 136 |
| 622 | 3300049589 | Ga0501073_0295487 | Ga0501073_0295487_682_1095 | 136 |
| 623 | 3300049590 | Ga0501074_0035756 | Ga0501074_0035756_2116_2529 | 136 |
| 624 | 3300049590 | Ga0501074_0168670 | Ga0501074_0168670_1066_1479 | 136 |
| 625 | 3300049591 | Ga0501075_0453870 | Ga0501075_0453870_472_885 | 136 |
| 626 | 3300049591 | Ga0501075_1548174 | Ga0501075_1548174_70_480 | 136 |
| 627 | 3300049592 | Ga0501076_0029662 | Ga0501076_0029662_70_483 | 136 |
| 628 | 3300049592 | Ga0501076_0040748 | Ga0501076_0040748_184_597 | 136 |
| 629 | 3300049592 | Ga0501076_0098084 | Ga0501076_0098084_558_971 | 136 |
| 630 | 3300049592 | Ga0501076_0177808 | Ga0501076_0177808_729_1142 | 136 |
| 631 | 3300049593 | Ga0501077_0012381 | Ga0501077_0012381_4214_4627 | 136 |
| 632 | 3300049593 | Ga0501077_0068503 | Ga0501077_0068503_642_1055 | 136 |
| 633 | 3300049593 | Ga0501077_0185905 | Ga0501077_0185905_604_1014 | 136 |
| 634 | 3300049593 | Ga0501077_0195592 | Ga0501077_0195592_642_1055 | 136 |
| 635 | 3300049741 | Ga0501079_0014826 | Ga0501079_0014826_4567_4980 | 136 |
| 636 | 3300049741 | Ga0501079_0210132 | Ga0501079_0210132_1053_1463 | 136 |
| 637 | 3300049741 | Ga0501079_0211701 | Ga0501079_0211701_603_1013 | 136 |
| 638 | 3300049741 | Ga0501079_0263041 | Ga0501079_0263041_630_1043 | 136 |
| 639 | 3300049742 | Ga0501080_0627889 | Ga0501080_0627889_28_441 | 136 |
| 640 | 3300049742 | Ga0501080_0831263 | Ga0501080_0831263_148_561 | 136 |
| 641 | 3300049742 | Ga0501080_1001771 | Ga0501080_1001771_37_447 | 136 |
| 642 | 3300049743 | Ga0501081_0012801 | Ga0501081_0012801_4979_5392 | 136 |
| 643 | 3300049743 | Ga0501081_0043930 | Ga0501081_0043930_217_630 | 136 |
| 644 | 3300049743 | Ga0501081_0117405 | Ga0501081_0117405_94_507 | 136 |
| 645 | 3300049743 | Ga0501081_1351364 | Ga0501081_1351364_79_492 | 136 |
| 646 | 3300049744 | Ga0501083_0099967 | Ga0501083_0099967_1468_1881 | 136 |
| 647 | 3300049822 | Ga0501035_0094712 | Ga0501035_0094712_205_618 | 136 |
| 648 | 3300049822 | Ga0501035_0211090 | Ga0501035_0211090_657_1070 | 136 |
| 649 | 3300049823 | Ga0501044_0289188 | Ga0501044_0289188_741_1154 | 136 |
| 650 | 3300049824 | Ga0501045_0022567 | Ga0501045_0022567_3794_4207 | 136 |
| 651 | 3300050507 | nmdc:mga05p37_1445357_c1 | nmdc:mga05p37_1445357_c1_80_490 | 136 |
| 652 | 3300050507 | nmdc:mga05p37_562706_c1 | nmdc:mga05p37_562706_c1_772_1185 | 136 |
| 653 | 3300050509 | nmdc:mga0qj67_555104_c1 | nmdc:mga0qj67_555104_c1_432_845 | 136 |
| 654 | 3300050510 | nmdc:mga06r32_404575_c1 | nmdc:mga06r32_404575_c1_290_712 | 136 |
| 655 | 3300050511 | nmdc:mga08y16_114430_c1 | nmdc:mga08y16_114430_c1_2062_2472 | 136 |
| 656 | 3300050511 | nmdc:mga08y16_328932_c1 | nmdc:mga08y16_328932_c1_224_637 | 136 |
| 657 | 3300050512 | nmdc:mga0n895_348068_c1 | nmdc:mga0n895_348068_c1_116_526 | 136 |
| 658 | 3300050515 | nmdc:mga0a205_489308_c1 | nmdc:mga0a205_489308_c1_203_613 | 136 |
| 659 | 3300050515 | nmdc:mga0a205_75071_c1 | nmdc:mga0a205_75071_c1_1138_1548 | 136 |
| 660 | 3300053078 | Ga0495612_0146744 | Ga0495612_0146744_153_563 | 136 |
| 661 | 3300053083 | Ga0495655_0083809 | Ga0495655_0083809_300_713 | 136 |
| 662 | 3300053085 | Ga0495619_0004904 | Ga0495619_0004904_8044_8454 | 136 |
| 663 | 3300053094 | Ga0500566_0062953 | Ga0500566_0062953_387_797 | 136 |
| 664 | 3300054114 | Ga0501084_0048742 | Ga0501084_0048742_2716_3129 | 136 |
| 665 | 3300054114 | Ga0501084_0335243 | Ga0501084_0335243_812_1225 | 136 |
| 666 | 3300060353 | Ga0501082_0020366 | Ga0501082_0020366_396_809 | 136 |
| 667 | 3300060353 | Ga0501082_0405337 | Ga0501082_0405337_59_472 | 136 |
| 668 | 3300060353 | Ga0501082_0540745 | Ga0501082_0540745_85_498 | 136 |
| 669 | 3300061734 | Ga0530510_0035380 | Ga0530510_0035380_312_725 | 136 |
| 670 | 3300061734 | Ga0530510_0713812 | Ga0530510_0713812_278_691 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qmn-assembly1.cif.gz_B | crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor | 0.9391 | 1 | 128 |
| 5xuh-assembly1.cif.gz_C | crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa | 0.9265 | 1 | 128 |
| 2was-assembly2.cif.gz_E | structure of the fungal type i fas ppt domain | 0.921 | 4 | 128 |
| 5xu7-assembly1.cif.gz_C | crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) | 0.9209 | 1 | 128 |
| 3qmn-assembly1.cif.gz_B | crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor | 0.9178 | 1 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9092 | 1 | 128 | 3.90.470.20 |
| 5xukA00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.8987 | 5 | 128 | 3.90.470.20 |
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.8948 | 1 | 128 | 3.90.470.20 |
| 2wasC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.8893 | 4 | 128 | 3.90.470.20 |
| 2wdyA00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.886 | 2 | 127 | 3.90.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E4ATP7-F1-model_v4 | deleted | 0.9981 | 1 | 115 |
|
| AF-A0A397KZG9-F1-model_v4 | deleted | 0.9941 | 1 | 132 |
|
| AF-A0A525KPW6-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9932 | 1 | 132 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A257J4Q7-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9929 | 1 | 132 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A7R7YEP3-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9926 | 1 | 133 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar