F474082

General Info

Members Datasets Scaffolds Average Seq Length
670 277 665 121

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10771994|Ga0163163_107719942
Length 132
Sequence MSNARPGLVGATRQSPHCRETILESAAVCPSCKHHLRYGAAADGSAAQEPALTPLRIEGSIRHPSDGEPWEYTVVVVIRNDRGQEIARKLVGVGAMGPNEQRTFTLSVEAVTAKPKIARERLPAAAMSHYKS

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2643221593 Lysobacter sp. Root690 Isolate Unclassified
4 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
5 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
214 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
215 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
220 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
221 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
226 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
227 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
269 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.45
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 0
Rhizoplane 3.13
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 3.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10028155 3300002077 Bacteria 1084
2 JGI25150J39212_1025385 3300002774 Bacteria 865
3 JGI25151J46595_10000059 3300003187 Bacteria 147998
4 rootH1_10141190 3300003316 Bacteria 1660
5 rootH1_10258062 3300003323 Bacteria 1433
6 Ga0055529_1006361 3300003763 Bacteria 1655
7 Ga0055526_1000039 3300003771 Bacteria 131421
8 Ga0055537_1000970 3300003773 Bacteria 13065
9 Ga0055524_1000067 3300003775 Bacteria 131421
10 Ga0055534_1000025 3300003784 Bacteria 131421
11 Ga0055528_1000024 3300003790 Bacteria 131421
12 Ga0055531_10020826 3300003794 Bacteria 2574
13 Ga0055531_10034350 3300003794 Bacteria 1611
14 Ga0070658_10185011 3300005327 Bacteria 1754
15 Ga0070658_10197520 3300005327 Bacteria 1696
16 Ga0070658_10389076 3300005327 Bacteria 1197
17 Ga0070658_10721862 3300005327 Bacteria 865
18 Ga0070676_10001328 3300005328 Bacteria 12430
19 Ga0070676_10002764 3300005328 Bacteria 9066
20 Ga0070676_10208852 3300005328 Unclassified 1284
21 Ga0070676_10305975 3300005328 Bacteria 1079
22 Ga0070676_10760030 3300005328 Unclassified 712
23 Ga0070690_100078817 3300005330 Bacteria 2153
24 Ga0070690_100226220 3300005330 Bacteria 1313
25 Ga0070690_100256499 3300005330 Bacteria 1239
26 Ga0070690_100316531 3300005330 Bacteria 1123
27 Ga0070670_100008428 3300005331 Bacteria 8791
28 Ga0070670_100035734 3300005331 Bacteria 4277
29 Ga0070670_100102268 3300005331 Bacteria 2468
30 Ga0070670_100257470 3300005331 Bacteria 1521
31 Ga0070670_100552812 3300005331 Bacteria 1027
32 Ga0070677_10001696 3300005333 Bacteria 6967
33 Ga0070677_10118220 3300005333 Bacteria 1193
34 Ga0070677_10289372 3300005333 Bacteria 828
35 Ga0068869_100003702 3300005334 Bacteria 9408
36 Ga0068869_100144345 3300005334 Bacteria 1841
37 Ga0068869_100228667 3300005334 Unclassified 1477
38 Ga0068869_100958741 3300005334 Bacteria 743
39 Ga0068869_101131478 3300005334 Bacteria 686
40 Ga0070666_10000243 3300005335 Bacteria 37033
41 Ga0070666_10024731 3300005335 Bacteria 3915
42 Ga0070666_10038412 3300005335 Bacteria 3186
43 Ga0070666_10090274 3300005335 Bacteria 2104
44 Ga0070666_10111070 3300005335 Bacteria 1896
45 Ga0070666_10144975 3300005335 Bacteria 1655
46 Ga0070666_10439698 3300005335 Bacteria 941
47 Ga0070666_10580334 3300005335 Unclassified 817
48 Ga0070680_100227352 3300005336 Bacteria 1575
49 Ga0070682_100296212 3300005337 Bacteria 1185
50 Ga0068868_100008085 3300005338 Bacteria 7523
51 Ga0068868_100063280 3300005338 Bacteria 2935
52 Ga0068868_100085591 3300005338 Bacteria 2533
53 Ga0068868_100242723 3300005338 Bacteria 1514
54 Ga0068868_100981508 3300005338 Bacteria 772
55 Ga0068868_101745456 3300005338 Unclassified 587
56 Ga0070689_100236243 3300005340 Bacteria 1504
57 Ga0070689_100999200 3300005340 Unclassified 744
58 Ga0070687_101464844 3300005343 Bacteria 512
59 Ga0070661_100084763 3300005344 Bacteria 2341
60 Ga0070661_100171394 3300005344 Bacteria 1648
61 Ga0070661_100426498 3300005344 Bacteria 1052
62 Ga0070692_10372560 3300005345 Bacteria 893
63 Ga0070668_100001020 3300005347 Bacteria 19602
64 Ga0070668_100007024 3300005347 Bacteria 8342
65 Ga0070668_100009853 3300005347 Bacteria 7077
66 Ga0070668_100031162 3300005347 Bacteria 4057
67 Ga0070668_100086196 3300005347 Bacteria 2469
68 Ga0070668_100126686 3300005347 Bacteria 2046
69 Ga0070668_100497955 3300005347 Bacteria 1054
70 Ga0070668_100595168 3300005347 Bacteria 967
71 Ga0070668_101005321 3300005347 Unclassified 749
72 Ga0070669_100027849 3300005353 Bacteria 4068
73 Ga0070669_100039196 3300005353 Bacteria 3442
74 Ga0070669_100189753 3300005353 Bacteria 1612
75 Ga0070669_100577299 3300005353 Unclassified 940
76 Ga0070669_100911823 3300005353 Unclassified 751
77 Ga0070675_100006444 3300005354 Bacteria 9007
78 Ga0070671_100004584 3300005355 Bacteria 10949
79 Ga0070671_100005816 3300005355 Bacteria 9822
80 Ga0070671_100009918 3300005355 Bacteria 7650
81 Ga0070671_100178741 3300005355 Bacteria 1796
82 Ga0070671_100371048 3300005355 Bacteria 1222
83 Ga0070671_100729798 3300005355 Bacteria 860
84 Ga0070671_100994493 3300005355 Bacteria 735
85 Ga0070674_100014257 3300005356 Bacteria 4938
86 Ga0070674_100221420 3300005356 Bacteria 1472
87 Ga0070673_100009480 3300005364 Bacteria 6534
88 Ga0070673_100011769 3300005364 Bacteria 5984
89 Ga0070673_100024978 3300005364 Bacteria 4390
90 Ga0070673_100031389 3300005364 Bacteria 3986
91 Ga0070673_100278762 3300005364 Unclassified 1466
92 Ga0070673_102321733 3300005364 Unclassified 510
93 Ga0070659_100429201 3300005366 Bacteria 1118
94 Ga0070667_100001177 3300005367 Bacteria 23791
95 Ga0070667_100011659 3300005367 Bacteria 7267
96 Ga0070667_100197493 3300005367 Bacteria 1784
97 Ga0070667_100201635 3300005367 Bacteria 1766
98 Ga0070667_100305166 3300005367 Unclassified 1434
99 Ga0070667_100616589 3300005367 Bacteria 1000
100 Ga0070667_100843577 3300005367 Bacteria 852
101 Ga0070667_102130715 3300005367 Unclassified 528
102 Ga0070714_100763834 3300005435 Unclassified 935
103 Ga0070701_10594484 3300005438 Bacteria 732
104 Ga0070705_100132254 3300005440 Bacteria 1629
105 Ga0070700_100487716 3300005441 Unclassified 945
106 Ga0070663_100006160 3300005455 Bacteria 7184
107 Ga0070663_100054769 3300005455 Unclassified 2852
108 Ga0070663_100190604 3300005455 Bacteria 1595
109 Ga0070663_100284310 3300005455 Bacteria 1319
110 Ga0070663_100553421 3300005455 Bacteria 962
111 Ga0070678_100033420 3300005456 Bacteria 3571
112 Ga0070662_100003406 3300005457 Bacteria 9913
113 Ga0070662_100316559 3300005457 Bacteria 1271
114 Ga0070681_10002030 3300005458 Bacteria 18327
115 Ga0068867_100019601 3300005459 Bacteria 4818
116 Ga0068867_100066199 3300005459 Bacteria 2691
117 Ga0068867_100211391 3300005459 Bacteria 1558
118 Ga0068867_100227492 3300005459 Bacteria 1506
119 Ga0068867_102273998 3300005459 Bacteria 515
120 Ga0070685_10003326 3300005466 Bacteria 8177
121 Ga0070685_10074633 3300005466 Bacteria 2018
122 Ga0070685_10746981 3300005466 Bacteria 717
123 Ga0070706_100108047 3300005467 Bacteria 2588
124 Ga0070706_100147469 3300005467 Unclassified 2197
125 Ga0070699_100568316 3300005518 Bacteria 1033
126 Ga0070699_101012419 3300005518 Bacteria 762
127 Ga0070679_100382832 3300005530 Bacteria 1353
128 Ga0070697_100050758 3300005536 Bacteria 3368
129 Ga0070697_100084333 3300005536 Bacteria 2620
130 Ga0068853_100026450 3300005539 Bacteria 4872
131 Ga0068853_100161865 3300005539 Unclassified 2020
132 Ga0068853_100972993 3300005539 Bacteria 816
133 Ga0070672_100003844 3300005543 Bacteria 9776
134 Ga0070672_100005073 3300005543 Bacteria 8687
135 Ga0070672_100327375 3300005543 Bacteria 1303
136 Ga0070672_100506535 3300005543 Bacteria 1045
137 Ga0070672_100741073 3300005543 Bacteria 862
138 Ga0070695_101012913 3300005545 Unclassified 676
139 Ga0070696_100326072 3300005546 Bacteria 1183
140 Ga0070693_100000485 3300005547 Bacteria 17816
141 Ga0070665_100009116 3300005548 Bacteria 10051
142 Ga0070665_100027210 3300005548 Bacteria 5759
143 Ga0070665_100036651 3300005548 Bacteria 4931
144 Ga0070704_101543238 3300005549 Unclassified 611
145 Ga0068855_100024004 3300005563 Bacteria 7300
146 Ga0068855_100067920 3300005563 Bacteria 4151
147 Ga0068855_100156491 3300005563 Bacteria 2589
148 Ga0068855_100232099 3300005563 Bacteria 2066
149 Ga0068855_100448569 3300005563 Bacteria 1408
150 Ga0070664_100297366 3300005564 Bacteria 1458
151 Ga0070664_100959540 3300005564 Bacteria 803
152 Ga0068857_100072694 3300005577 Bacteria 3064
153 Ga0068857_100325944 3300005577 Bacteria 1419
154 Ga0068857_101317239 3300005577 Bacteria 701
155 Ga0068854_100006573 3300005578 Bacteria 7404
156 Ga0068854_100276652 3300005578 Bacteria 1350
157 Ga0068854_102014696 3300005578 Unclassified 532
158 Ga0068856_100000158 3300005614 Bacteria 70033
159 Ga0068852_100001467 3300005616 Bacteria 15945
160 Ga0068852_100114003 3300005616 Bacteria 2462
161 Ga0068852_100174413 3300005616 Bacteria 2018
162 Ga0068852_100177058 3300005616 Bacteria 2003
163 Ga0068852_100895626 3300005616 Bacteria 904
164 Ga0068852_101187854 3300005616 Bacteria 784
165 Ga0068852_101319905 3300005616 Bacteria 743
166 Ga0068859_100003068 3300005617 Bacteria 16938
167 Ga0068859_100047278 3300005617 Bacteria 4323
168 Ga0068859_100049000 3300005617 Bacteria 4243
169 Ga0068859_100105870 3300005617 Bacteria 2872
170 Ga0068859_100150214 3300005617 Bacteria 2405
171 Ga0068859_100175520 3300005617 Bacteria 2224
172 Ga0068859_100365691 3300005617 Bacteria 1538
173 Ga0068859_100990812 3300005617 Bacteria 923
174 Ga0068859_101222105 3300005617 Unclassified 828
175 Ga0068864_100001880 3300005618 Bacteria 17239
176 Ga0068864_100013312 3300005618 Bacteria 6813
177 Ga0068864_100016674 3300005618 Bacteria 6122
178 Ga0068864_101726923 3300005618 Unclassified 631
179 Ga0068861_100004164 3300005719 Bacteria 9698
180 Ga0068861_100087413 3300005719 Bacteria 2453
181 Ga0068861_100737640 3300005719 Unclassified 919
182 Ga0068861_102678237 3300005719 Unclassified 503
183 Ga0068851_10000626 3300005834 Bacteria 15011
184 Ga0068851_10042739 3300005834 Bacteria 2282
185 Ga0068870_10001728 3300005840 Bacteria 8943
186 Ga0068870_10019799 3300005840 Bacteria 3269
187 Ga0068863_100004156 3300005841 Bacteria 14294
188 Ga0068863_100005809 3300005841 Bacteria 12094
189 Ga0068863_100010149 3300005841 Bacteria 9160
190 Ga0068863_100067477 3300005841 Bacteria 3383
191 Ga0068863_100187981 3300005841 Bacteria 1984
192 Ga0068863_100241591 3300005841 Bacteria 1743
193 Ga0068863_100261300 3300005841 Bacteria 1674
194 Ga0068863_100858141 3300005841 Bacteria 907
195 Ga0068858_100010172 3300005842 Bacteria 8929
196 Ga0068858_100018432 3300005842 Bacteria 6535
197 Ga0068858_100025453 3300005842 Bacteria 5506
198 Ga0068858_100030229 3300005842 Bacteria 5031
199 Ga0068858_100081716 3300005842 Bacteria 3004
200 Ga0068858_100199035 3300005842 Bacteria 1894
201 Ga0068858_100295430 3300005842 Bacteria 1545
202 Ga0068858_101413991 3300005842 Unclassified 685
203 Ga0068860_100009177 3300005843 Bacteria 9831
204 Ga0068860_100016950 3300005843 Bacteria 7101
205 Ga0068860_100229107 3300005843 Bacteria 1805
206 Ga0068860_101102990 3300005843 Bacteria 813
207 Ga0068860_101134403 3300005843 Bacteria 801
208 Ga0068860_101290623 3300005843 Bacteria 751
209 Ga0068862_100243607 3300005844 Bacteria 1636
210 Ga0068862_100392611 3300005844 Bacteria 1296
211 Ga0068862_100422531 3300005844 Unclassified 1251
212 Ga0068862_100450488 3300005844 Bacteria 1213
213 Ga0068862_100562815 3300005844 Bacteria 1090
214 Ga0068862_101363684 3300005844 Unclassified 712
215 Ga0068862_102129901 3300005844 Unclassified 572
216 Ga0081539_10037553 3300005985 Bacteria 2884
217 Ga0070717_10875988 3300006028 Unclassified 817
218 Ga0070716_100241286 3300006173 Bacteria 1226
219 Ga0097621_100127563 3300006237 Bacteria 2162
220 Ga0097621_100287792 3300006237 Bacteria 1448
221 Ga0097621_100548367 3300006237 Bacteria 1052
222 Ga0097621_100609324 3300006237 Bacteria 999
223 Ga0097621_100956602 3300006237 Unclassified 800
224 Ga0097621_101130457 3300006237 Bacteria 736
225 Ga0097621_101997225 3300006237 Bacteria 554
226 Ga0068871_100008125 3300006358 Bacteria 7533
227 Ga0068871_100115364 3300006358 Bacteria 2264
228 Ga0068871_100373085 3300006358 Bacteria 1266
229 Ga0068871_101195234 3300006358 Bacteria 713
230 Ga0068871_101237401 3300006358 Bacteria 701
231 Ga0068871_101300818 3300006358 Bacteria 684
232 Ga0075428_100377095 3300006844 Bacteria 1521
233 Ga0075428_100770751 3300006844 Bacteria 1023
234 Ga0075430_100722336 3300006846 Bacteria 821
235 Ga0075431_100623903 3300006847 Bacteria 1060
236 Ga0075433_10005479 3300006852 Bacteria 9971
237 Ga0075434_100035645 3300006871 Bacteria 4919
238 Ga0075434_100493857 3300006871 Bacteria 1245
239 Ga0075434_100697476 3300006871 Bacteria 1033
240 Ga0068865_100004385 3300006881 Bacteria 8503
241 Ga0068865_100064563 3300006881 Bacteria 2577
242 Ga0068865_100196696 3300006881 Bacteria 1563
243 Ga0097620_100003068 3300006931 Bacteria 16938
244 Ga0097620_100047278 3300006931 Bacteria 4323
245 Ga0097620_100049000 3300006931 Bacteria 4243
246 Ga0097620_100105874 3300006931 Bacteria 2872
247 Ga0097620_100150211 3300006931 Bacteria 2405
248 Ga0097620_100175519 3300006931 Bacteria 2224
249 Ga0097620_100365666 3300006931 Bacteria 1538
250 Ga0097620_100990869 3300006931 Bacteria 923
251 Ga0097620_101222151 3300006931 Unclassified 828
252 Ga0075435_100055957 3300007076 Bacteria 3188
253 Ga0105240_10001066 3300009093 Bacteria 48453
254 Ga0105240_10035462 3300009093 Bacteria 6428
255 Ga0105240_10323247 3300009093 Bacteria 1758
256 Ga0105240_10673222 3300009093 Bacteria 1132
257 Ga0105240_10871965 3300009093 Bacteria 970
258 Ga0105240_12731157 3300009093 Bacteria 509
259 Ga0111539_12463489 3300009094 Unclassified 604
260 Ga0105245_10157482 3300009098 Bacteria 2152
261 Ga0105245_10412452 3300009098 Bacteria 1352
262 Ga0105245_10772752 3300009098 Unclassified 997
263 Ga0105245_11232190 3300009098 Bacteria 796
264 Ga0105245_11819394 3300009098 Unclassified 662
265 Ga0105245_13259275 3300009098 Bacteria 503
266 Ga0105247_10080002 3300009101 Bacteria 2057
267 Ga0105247_10808752 3300009101 Unclassified 716
268 Ga0114129_10381143 3300009147 Bacteria 1862
269 Ga0114129_12319367 3300009147 Unclassified 644
270 Ga0105241_10019053 3300009174 Bacteria 5061
271 Ga0105241_11976234 3300009174 Unclassified 573
272 Ga0105248_10010111 3300009177 Bacteria 10392
273 Ga0105248_10048578 3300009177 Bacteria 4760
274 Ga0105248_10264347 3300009177 Bacteria 1937
275 Ga0105248_10349748 3300009177 Unclassified 1664
276 Ga0105248_10653594 3300009177 Bacteria 1186
277 Ga0105248_10810777 3300009177 Bacteria 1056
278 Ga0105237_10000487 3300009545 Bacteria 56564
279 Ga0105237_10030239 3300009545 Bacteria 5503
280 Ga0105237_11688290 3300009545 Bacteria 641
281 Ga0105238_10009941 3300009551 Bacteria 9540
282 Ga0105238_10044849 3300009551 Bacteria 4468
283 Ga0105238_10070080 3300009551 Bacteria 3506
284 Ga0105238_10098350 3300009551 Bacteria 2910
285 Ga0105238_10144595 3300009551 Bacteria 2354
286 Ga0105249_10153983 3300009553 Bacteria 2216
287 Ga0105249_10216348 3300009553 Bacteria 1883
288 Ga0105249_10330255 3300009553 Bacteria 1538
289 Ga0105239_10017865 3300010375 Bacteria 7845
290 Ga0105239_10183050 3300010375 Bacteria 2344
291 Ga0105239_11627828 3300010375 Bacteria 747
292 Ga0105239_11692414 3300010375 Unclassified 732
293 Ga0105246_10128605 3300011119 Bacteria 1888
294 Ga0105246_10299425 3300011119 Bacteria 1298
295 Ga0105246_11961239 3300011119 Bacteria 564
296 Ga0105246_12417959 3300011119 Bacteria 516
297 Ga0157317_1003088 3300012475 Bacteria 1020
298 Ga0157371_10951074 3300013102 Unclassified 653
299 Ga0157370_10047891 3300013104 Bacteria 4096
300 Ga0157370_11036315 3300013104 Bacteria 742
301 Ga0157369_10009417 3300013105 Bacteria 11166
302 Ga0157369_10222272 3300013105 Bacteria 1976
303 Ga0157374_10029373 3300013296 Bacteria 4977
304 Ga0157374_10380858 3300013296 Unclassified 1405
305 Ga0157374_10611992 3300013296 Bacteria 1100
306 Ga0157378_10000033 3300013297 Bacteria 120764
307 Ga0157378_10011995 3300013297 Bacteria 7588
308 Ga0157378_10022574 3300013297 Bacteria 5537
309 Ga0157378_10045984 3300013297 Bacteria 3880
310 Ga0157378_10061661 3300013297 Bacteria 3348
311 Ga0157378_10828810 3300013297 Unclassified 952
312 Ga0157378_11373149 3300013297 Bacteria 749
313 Ga0163162_10051655 3300013306 Bacteria 4125
314 Ga0163162_10072772 3300013306 Bacteria 3492
315 Ga0163162_10095595 3300013306 Bacteria 3058
316 Ga0163162_10104702 3300013306 Bacteria 2924
317 Ga0163162_10178520 3300013306 Bacteria 2249
318 Ga0163162_10217872 3300013306 Bacteria 2039
319 Ga0157372_11080464 3300013307 Bacteria 928
320 Ga0157372_11181710 3300013307 Bacteria 884
321 Ga0157375_10244877 3300013308 Bacteria 1953
322 Ga0157375_10260369 3300013308 Bacteria 1896
323 Ga0157375_10602218 3300013308 Unclassified 1258
324 Ga0157375_10654026 3300013308 Bacteria 1207
325 Ga0157375_11199895 3300013308 Unclassified 890
326 Ga0163163_10000117 3300014325 Bacteria 84938
327 Ga0163163_10005924 3300014325 Bacteria 10637
328 Ga0163163_10006992 3300014325 Bacteria 9916
329 Ga0163163_10041419 3300014325 Bacteria 4503
330 Ga0163163_10243111 3300014325 Bacteria 1850
331 Ga0163163_10771994 3300014325 Bacteria 1024
332 Ga0157380_10213542 3300014326 Bacteria 1721
333 Ga0157380_11012657 3300014326 Bacteria 865
334 Ga0157380_11186419 3300014326 Unclassified 806
335 Ga0182008_10259483 3300014497 Bacteria 898
336 Ga0157379_10002783 3300014968 Bacteria 14745
337 Ga0157379_10005585 3300014968 Bacteria 10808
338 Ga0157379_10015311 3300014968 Bacteria 6727
339 Ga0157379_10443109 3300014968 Unclassified 1198
340 Ga0157379_11152369 3300014968 Bacteria 744
341 Ga0157379_12412239 3300014968 Unclassified 525
342 Ga0157379_12586060 3300014968 Bacteria 508
343 Ga0157376_10054232 3300014969 Bacteria 3341
344 Ga0157376_10054301 3300014969 Bacteria 3340
345 Ga0157376_12183153 3300014969 Bacteria 592
346 Ga0183360_10001 3300015689 Bacteria 3943671
347 Ga0163161_10101972 3300017792 Bacteria 2137
348 Ga0163161_11662717 3300017792 Bacteria 565
349 Ga0163161_11909107 3300017792 Bacteria 528
350 Ga0197907_10520165 3300020069 Bacteria 1534
351 Ga0206356_11766869 3300020070 Bacteria 2774
352 Ga0224712_10179286 3300022467 Bacteria 954
353 Ga0207425_1035183 3300025245 Bacteria 979
354 Ga0209026_1000281 3300025250 Bacteria 58797
355 Ga0209759_1005553 3300025256 Bacteria 4389
356 Ga0209759_1012586 3300025256 Bacteria 2335
357 Ga0209565_1000005 3300025263 Bacteria 947317
358 Ga0209565_1012074 3300025263 Bacteria 2075
359 Ga0209455_1000465 3300025272 Bacteria 30599
360 Ga0209673_1000027 3300025273 Bacteria 360561
361 Ga0209675_1000004 3300025291 Bacteria 947166
362 Ga0209025_1000005 3300025294 Bacteria 1272149
363 Ga0209025_1029411 3300025294 Bacteria 2658
364 Ga0209564_1000050 3300025295 Bacteria 360560
365 Ga0209758_1019657 3300025297 Bacteria 3243
366 Ga0209256_1000031 3300025299 Bacteria 410189
367 Ga0209257_1000263 3300025304 Bacteria 120530
368 Ga0209257_1000645 3300025304 Bacteria 55704
369 Ga0207697_10145710 3300025315 Bacteria 1029
370 Ga0207697_10162692 3300025315 Bacteria 974
371 Ga0207656_10016671 3300025321 Unclassified 2864
372 Ga0207656_10078173 3300025321 Bacteria 1482
373 Ga0207656_10130747 3300025321 Bacteria 1176
374 Ga0207682_10000299 3300025893 Bacteria 22382
375 Ga0207688_10515534 3300025901 Bacteria 750
376 Ga0207680_10000114 3300025903 Bacteria 37044
377 Ga0207680_10019316 3300025903 Bacteria 3642
378 Ga0207680_10161290 3300025903 Bacteria 1504
379 Ga0207680_10193719 3300025903 Bacteria 1381
380 Ga0207680_10256724 3300025903 Bacteria 1209
381 Ga0207647_10000157 3300025904 Bacteria 53737
382 Ga0207647_10043861 3300025904 Bacteria 2796
383 Ga0207645_10001423 3300025907 Bacteria 19581
384 Ga0207645_10020545 3300025907 Bacteria 4321
385 Ga0207645_10090476 3300025907 Bacteria 1968
386 Ga0207645_10250888 3300025907 Bacteria 1171
387 Ga0207645_10393304 3300025907 Bacteria 932
388 Ga0207645_10619758 3300025907 Bacteria 735
389 Ga0207643_10019292 3300025908 Bacteria 3737
390 Ga0207643_10306605 3300025908 Bacteria 989
391 Ga0207705_10113978 3300025909 Bacteria 2000
392 Ga0207684_10099567 3300025910 Bacteria 2483
393 Ga0207684_10283987 3300025910 Bacteria 1427
394 Ga0207654_10049702 3300025911 Bacteria 2407
395 Ga0207707_10000018 3300025912 Bacteria 215518
396 Ga0207695_10013067 3300025913 Bacteria 9912
397 Ga0207695_10091521 3300025913 Bacteria 3055
398 Ga0207695_10110526 3300025913 Bacteria 2728
399 Ga0207671_10000374 3300025914 Bacteria 63535
400 Ga0207671_10082488 3300025914 Bacteria 2413
401 Ga0207671_11541317 3300025914 Unclassified 512
402 Ga0207649_10260924 3300025920 Bacteria 1252
403 Ga0207649_10349068 3300025920 Bacteria 1094
404 Ga0207646_10790555 3300025922 Bacteria 845
405 Ga0207681_10202988 3300025923 Bacteria 1523
406 Ga0207681_10273319 3300025923 Bacteria 1327
407 Ga0207681_10497716 3300025923 Bacteria 997
408 Ga0207694_10011157 3300025924 Bacteria 6783
409 Ga0207694_10039101 3300025924 Bacteria 3649
410 Ga0207694_10218021 3300025924 Bacteria 1556
411 Ga0207650_10039577 3300025925 Bacteria 3445
412 Ga0207650_10077220 3300025925 Bacteria 2517
413 Ga0207650_10204497 3300025925 Bacteria 1583
414 Ga0207650_10255395 3300025925 Bacteria 1420
415 Ga0207650_10485098 3300025925 Unclassified 1032
416 Ga0207650_10608520 3300025925 Bacteria 919
417 Ga0207659_10020422 3300025926 Bacteria 4378
418 Ga0207659_10890078 3300025926 Bacteria 765
419 Ga0207687_10299892 3300025927 Bacteria 1294
420 Ga0207687_10527170 3300025927 Bacteria 989
421 Ga0207687_10932431 3300025927 Unclassified 743
422 Ga0207687_11165409 3300025927 Unclassified 662
423 Ga0207644_10018576 3300025931 Bacteria 4707
424 Ga0207644_10027550 3300025931 Bacteria 3926
425 Ga0207644_10107214 3300025931 Bacteria 2107
426 Ga0207644_10435158 3300025931 Bacteria 1076
427 Ga0207690_10834033 3300025932 Bacteria 763
428 Ga0207706_10004507 3300025933 Bacteria 13081
429 Ga0207706_10137643 3300025933 Bacteria 2148
430 Ga0207706_10512192 3300025933 Bacteria 1035
431 Ga0207670_10211281 3300025936 Bacteria 1480
432 Ga0207669_10007022 3300025937 Bacteria 5181
433 Ga0207669_10115575 3300025937 Bacteria 1809
434 Ga0207704_10036864 3300025938 Bacteria 2818
435 Ga0207704_10142373 3300025938 Bacteria 1679
436 Ga0207704_10169944 3300025938 Bacteria 1562
437 Ga0207704_10355351 3300025938 Bacteria 1142
438 Ga0207665_10438044 3300025939 Bacteria 1001
439 Ga0207691_10000016 3300025940 Bacteria 141024
440 Ga0207691_10008755 3300025940 Bacteria 9706
441 Ga0207691_10146131 3300025940 Bacteria 2081
442 Ga0207711_10029362 3300025941 Bacteria 4638
443 Ga0207711_10114480 3300025941 Bacteria 2402
444 Ga0207711_10724561 3300025941 Bacteria 927
445 Ga0207711_11290281 3300025941 Bacteria 672
446 Ga0207689_10003539 3300025942 Bacteria 14278
447 Ga0207689_10025878 3300025942 Bacteria 4915
448 Ga0207689_10031723 3300025942 Bacteria 4396
449 Ga0207689_10218767 3300025942 Unclassified 1573
450 Ga0207689_10360605 3300025942 Bacteria 1209
451 Ga0207689_10723281 3300025942 Bacteria 840
452 Ga0207689_10951373 3300025942 Bacteria 725
453 Ga0207667_10063574 3300025949 Bacteria 3856
454 Ga0207667_10106036 3300025949 Bacteria 2899
455 Ga0207667_10183999 3300025949 Bacteria 2145
456 Ga0207667_10300789 3300025949 Bacteria 1639
457 Ga0207667_11681093 3300025949 Unclassified 602
458 Ga0207651_10011379 3300025960 Bacteria 4980
459 Ga0207651_10037484 3300025960 Bacteria 3177
460 Ga0207651_10185054 3300025960 Bacteria 1656
461 Ga0207651_10323798 3300025960 Unclassified 1289
462 Ga0207712_10000197 3300025961 Bacteria 61066
463 Ga0207712_10093749 3300025961 Bacteria 2216
464 Ga0207712_10168580 3300025961 Bacteria 1709
465 Ga0207668_10009432 3300025972 Bacteria 5852
466 Ga0207668_10012378 3300025972 Bacteria 5222
467 Ga0207668_10030335 3300025972 Bacteria 3552
468 Ga0207668_10053138 3300025972 Bacteria 2806
469 Ga0207668_10329700 3300025972 Bacteria 1269
470 Ga0207668_10344710 3300025972 Bacteria 1244
471 Ga0207668_10618915 3300025972 Bacteria 945
472 Ga0207668_10693820 3300025972 Unclassified 894
473 Ga0207668_12013296 3300025972 Unclassified 520
474 Ga0207640_10004947 3300025981 Bacteria 7242
475 Ga0207640_10971458 3300025981 Bacteria 746
476 Ga0207658_10022594 3300025986 Bacteria 4381
477 Ga0207658_10181013 3300025986 Bacteria 1744
478 Ga0207658_10219610 3300025986 Bacteria 1598
479 Ga0207658_10476646 3300025986 Bacteria 1108
480 Ga0207658_10685626 3300025986 Bacteria 925
481 Ga0207658_11537611 3300025986 Bacteria 608
482 Ga0207658_11543487 3300025986 Unclassified 607
483 Ga0207677_10021067 3300026023 Bacteria 3976
484 Ga0207677_10151160 3300026023 Bacteria 1792
485 Ga0207677_10189469 3300026023 Bacteria 1625
486 Ga0207677_10667186 3300026023 Bacteria 919
487 Ga0207677_11190633 3300026023 Bacteria 697
488 Ga0207703_10040161 3300026035 Bacteria 3743
489 Ga0207703_10082844 3300026035 Bacteria 2678
490 Ga0207703_10436988 3300026035 Bacteria 1220
491 Ga0207703_10886051 3300026035 Bacteria 854
492 Ga0207703_11093359 3300026035 Unclassified 766
493 Ga0207703_11241707 3300026035 Bacteria 716
494 Ga0207639_10000446 3300026041 Bacteria 28443
495 Ga0207639_10025923 3300026041 Bacteria 4255
496 Ga0207639_11210947 3300026041 Unclassified 709
497 Ga0207678_10001892 3300026067 Bacteria 19098
498 Ga0207678_10004226 3300026067 Bacteria 12875
499 Ga0207678_10067389 3300026067 Bacteria 3073
500 Ga0207678_11442678 3300026067 Unclassified 608
501 Ga0207702_10000167 3300026078 Bacteria 78662
502 Ga0207702_10175999 3300026078 Bacteria 1966
503 Ga0207702_10249895 3300026078 Bacteria 1665
504 Ga0207641_10016203 3300026088 Bacteria 6104
505 Ga0207641_10021701 3300026088 Bacteria 5277
506 Ga0207641_10195580 3300026088 Bacteria 1861
507 Ga0207641_10207363 3300026088 Bacteria 1811
508 Ga0207641_10218331 3300026088 Bacteria 1767
509 Ga0207641_10352228 3300026088 Bacteria 1403
510 Ga0207641_10810171 3300026088 Unclassified 927
511 Ga0207648_10003215 3300026089 Bacteria 17203
512 Ga0207648_10008770 3300026089 Bacteria 9745
513 Ga0207648_10046725 3300026089 Bacteria 3796
514 Ga0207648_10481243 3300026089 Unclassified 1134
515 Ga0207676_10012675 3300026095 Bacteria 6047
516 Ga0207676_10025226 3300026095 Bacteria 4411
517 Ga0207676_10028606 3300026095 Bacteria 4165
518 Ga0207676_10312254 3300026095 Bacteria 1440
519 Ga0207674_10030180 3300026116 Bacteria 5702
520 Ga0207674_10350045 3300026116 Bacteria 1428
521 Ga0207674_10699498 3300026116 Bacteria 979
522 Ga0207675_100007990 3300026118 Bacteria 9971
523 Ga0207675_100052782 3300026118 Bacteria 3793
524 Ga0207675_100184112 3300026118 Bacteria 2001
525 Ga0207683_10000057 3300026121 Bacteria 84479
526 Ga0207683_10047376 3300026121 Bacteria 3764
527 Ga0207698_10018386 3300026142 Bacteria 4761
528 Ga0207698_10733936 3300026142 Unclassified 985
529 Ga0207698_11818103 3300026142 Bacteria 624
530 Ga0209973_1011521 3300027252 Bacteria 1062
531 Ga0209984_1002123 3300027424 Bacteria 2199
532 Ga0209982_1002754 3300027552 Bacteria 2471
533 Ga0209983_1024080 3300027665 Bacteria 1281
534 Ga0209971_1063343 3300027682 Bacteria 896
535 Ga0209974_10024792 3300027876 Bacteria 1984
536 Ga0268266_10000006 3300028379 Bacteria 1410021
537 Ga0268266_10003576 3300028379 Bacteria 15407
538 Ga0268266_10515650 3300028379 Bacteria 1143
539 Ga0268265_10087070 3300028380 Bacteria 2484
540 Ga0268265_10116638 3300028380 Bacteria 2191
541 Ga0268265_10415830 3300028380 Bacteria 1247
542 Ga0268265_11873837 3300028380 Unclassified 606
543 Ga0268265_12065845 3300028380 Unclassified 577
544 Ga0268264_10014295 3300028381 Bacteria 6527
545 Ga0268264_10074750 3300028381 Bacteria 2879
546 Ga0268264_10290925 3300028381 Bacteria 1534
547 Ga0268264_10395170 3300028381 Bacteria 1327
548 Ga0268264_11178153 3300028381 Bacteria 775
549 Ga0268264_11428742 3300028381 Bacteria 702
550 Ga0268264_11592312 3300028381 Unclassified 664
551 Ga0307515_10525391 3300028794 Bacteria 793
552 Ga0307513_10083926 3300031456 Bacteria 3274
553 Ga0307513_10244622 3300031456 Bacteria 1596
554 Ga0307408_100016229 3300031548 Bacteria 4967
555 Ga0316576_10002379 3300031727 Bacteria 10699
556 Ga0307405_10096808 3300031731 Bacteria 1969
557 Ga0307405_10902743 3300031731 Unclassified 747
558 Ga0307413_10558983 3300031824 Bacteria 929
559 Ga0307413_10805747 3300031824 Bacteria 790
560 Ga0307406_10001746 3300031901 Bacteria 11913
561 Ga0307406_10101260 3300031901 Bacteria 1963
562 Ga0307406_10157995 3300031901 Bacteria 1626
563 Ga0307412_10238975 3300031911 Bacteria 1404
564 Ga0307412_10253067 3300031911 Bacteria 1369
565 Ga0307414_10040337 3300032004 Bacteria 3152
566 Ga0307414_10046276 3300032004 Bacteria 2985
567 Ga0307414_10138848 3300032004 Bacteria 1899
568 Ga0307414_11683813 3300032004 Bacteria 591
569 Ga0307411_10717449 3300032005 Bacteria 873
570 Ga0373928_0209141 3300035084 Unclassified 566
571 Ga0373945_0573170 3300035116 Unclassified 508
572 Ga0373956_0300887 3300035119 Bacteria 764
573 Ga0373955_0644667 3300035172 Bacteria 649
574 Ga0373931_0084133 3300035691 Bacteria 1761
575 Ga0373931_0905685 3300035691 Unclassified 593
576 Ga0373933_0065213 3300035724 Bacteria 2205
577 Ga0373937_0268844 3300036401 Bacteria 1609
578 Ga0316584_0045361 3300036712 Bacteria 3281
579 Ga0373925_0526797 3300037068 Bacteria 971
580 Ga0395900_0000439 3300037418 Bacteria 59811
581 Ga0395900_0003253 3300037418 Bacteria 17593
582 Ga0395898_0005858 3300037466 Bacteria 13218
583 Ga0395901_0041616 3300038443 Bacteria 4763
584 Ga0436365_0043459 3300039437 Bacteria 2669
585 Ga0439436_0005922 3300041404 Bacteria 3749
586 Ga0439447_003163 3300041407 Bacteria 5865
587 Ga0439466_0072802 3300041411 Bacteria 1092
588 Ga0439465_0001078 3300041413 Bacteria 8729
589 Ga0451791_0513229 3300041451 Bacteria 1641
590 Ga0451791_1604906 3300041451 Bacteria 1519
591 Ga0451793_1463101 3300041452 Bacteria 640
592 Ga0451797_0751603 3300041453 Bacteria 1014
593 Ga0451795_0235484 3300041456 Bacteria 967
594 Ga0451800_0681495 3300041459 Bacteria 672
595 Ga0451807_0106323 3300041486 Bacteria 627
596 Ga0451837_1152633 3300041494 Bacteria 621
597 Ga0451837_1688733 3300041494 Bacteria 1317
598 Ga0451839_1393893 3300041496 Unclassified 500
599 Ga0451841_0210267 3300041498 Bacteria 916
600 Ga0451841_0364395 3300041498 Bacteria 1007
601 Ga0451843_0478485 3300041509 Bacteria 1443
602 Ga0451843_1333241 3300041509 Bacteria 2026
603 Ga0451843_1594455 3300041509 Unclassified 687
604 Ga0451855_1849199 3300041511 Bacteria 760
605 Ga0451853_3160813 3300041512 Bacteria 504
606 Ga0439433_0030552 3300041999 Bacteria 1232
607 Ga0439432_076248 3300042006 Bacteria 1018
608 Ga0439449_0070066 3300042007 Bacteria 1292
609 Ga0439449_0137246 3300042007 Bacteria 909
610 Ga0439446_0152929 3300042156 Bacteria 760
611 Ga0439446_0280128 3300042156 Unclassified 581
612 Ga0451577_0025346 3300042876 Bacteria 5381
613 Ga0453683_1027986 3300044673 Unclassified 548
614 Ga0495616_0063888 3300046513 Bacteria 1798
615 Ga0495643_0085181 3300046522 Bacteria 1639
616 Ga0495663_0011527 3300046525 Bacteria 2459
617 Ga0495656_0006617 3300046615 Bacteria 4068
618 Ga0495668_0000625 3300046616 Bacteria 42737
619 Ga0495647_0411525 3300046681 Unclassified 622
620 Ga0495636_0005345 3300047318 Bacteria 5046
621 Ga0495636_0302337 3300047318 Bacteria 749
622 Ga0496101_0484415 3300048904 Bacteria 977
623 Ga0496102_0035311 3300048905 Bacteria 4500
624 Ga0496102_1065864 3300048905 Bacteria 728
625 Ga0496103_0174255 3300048906 Bacteria 1382
626 Ga0496104_1125273 3300048907 Bacteria 689
627 Ga0496106_0175677 3300048909 Bacteria 1699
628 Ga0496108_0502573 3300048911 Bacteria 1059
629 Ga0496109_0096664 3300048912 Bacteria 2737
630 Ga0496109_0711845 3300048912 Bacteria 942
631 Ga0496109_1878381 3300048912 Unclassified 531
632 Ga0496110_0966418 3300048913 Bacteria 759
633 Ga0496112_0216305 3300048915 Bacteria 1873
634 Ga0496114_0207161 3300048917 Bacteria 1719
635 Ga0496115_0631634 3300048918 Bacteria 848
636 Ga0496121_0011637 3300048924 Bacteria 9729
637 Ga0496122_0025177 3300048925 Bacteria 5178
638 Ga0496123_0004944 3300048926 Bacteria 13665
639 Ga0496126_0232656 3300048929 Bacteria 1543
640 Ga0501034_1668579 3300049571 Bacteria 510
641 Ga0501037_0067506 3300049573 Bacteria 2604
642 Ga0501047_0046204 3300049581 Bacteria 4208
643 Ga0501068_0275321 3300049584 Unclassified 1075
644 Ga0501069_0061599 3300049585 Bacteria 2095
645 Ga0501070_0014516 3300049586 Bacteria 6627
646 Ga0501070_0345811 3300049586 Bacteria 1207
647 Ga0501070_1384070 3300049586 Bacteria 535
648 Ga0501071_0000973 3300049587 Bacteria 15658
649 Ga0501071_0591566 3300049587 Unclassified 853
650 Ga0501073_0001354 3300049589 Bacteria 18080
651 Ga0501074_0006572 3300049590 Bacteria 8406
652 Ga0501076_0256294 3300049592 Bacteria 1432
653 Ga0501080_0079514 3300049742 Bacteria 3048
654 Ga0501275_000722 3300049772 Bacteria 3607
655 Ga0501276_018049 3300049773 Bacteria 654
656 Ga0501035_0272430 3300049822 Bacteria 1432
657 Ga0501044_0039950 3300049823 Bacteria 4892
658 Ga0501044_1273312 3300049823 Bacteria 602
659 Ga0501045_0260855 3300049824 Bacteria 1290
660 nmdc:mga05p37_2122318_c1 3300050507 Unclassified 525
661 nmdc:mga0qj67_629425_c1 3300050509 Bacteria 857
662 nmdc:mga0n895_39828_c1 3300050512 Bacteria 4563
663 nmdc:mga0n895_608740_c1 3300050512 Bacteria 1094
664 nmdc:mga0rr50_116561_c1 3300050513 Bacteria 2121
665 nmdc:mga0a205_17083_c1 3300050515 Bacteria 6794

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10035462 Ga0105240_100354623 85
2 3300013104 Ga0157370_11036315 Ga0157370_110363151 85
3 3300048925 Ga0496122_0025177 Ga0496122_0025177_733_1050 94
4 3300048926 Ga0496123_0004944 Ga0496123_0004944_1957_2274 94
5 3300005327 Ga0070658_10721862 Ga0070658_107218621 95
6 3300005328 Ga0070676_10001328 Ga0070676_100013287 95
7 3300005331 Ga0070670_100102268 Ga0070670_1001022683 95
8 3300005333 Ga0070677_10001696 Ga0070677_100016967 95
9 3300005335 Ga0070666_10024731 Ga0070666_100247313 95
10 3300005338 Ga0068868_100008085 Ga0068868_1000080855 95
11 3300005340 Ga0070689_100999200 Ga0070689_1009992001 95
12 3300005347 Ga0070668_100001020 Ga0070668_1000010205 95
13 3300005353 Ga0070669_100039196 Ga0070669_1000391963 95
14 3300005354 Ga0070675_100006444 Ga0070675_10000644411 95
15 3300005355 Ga0070671_100009918 Ga0070671_1000099185 95
16 3300005356 Ga0070674_100014257 Ga0070674_1000142575 95
17 3300005364 Ga0070673_100009480 Ga0070673_1000094806 95
18 3300005367 Ga0070667_100001177 Ga0070667_10000117714 95
19 3300005455 Ga0070663_100006160 Ga0070663_1000061602 95
20 3300005456 Ga0070678_100033420 Ga0070678_1000334201 95
21 3300005459 Ga0068867_100066199 Ga0068867_1000661993 95
22 3300005466 Ga0070685_10074633 Ga0070685_100746332 95
23 3300005539 Ga0068853_100026450 Ga0068853_1000264502 95
24 3300005543 Ga0070672_100005073 Ga0070672_1000050736 95
25 3300005548 Ga0070665_100027210 Ga0070665_1000272106 95
26 3300005616 Ga0068852_100001467 Ga0068852_10000146718 95
27 3300005617 Ga0068859_100150214 Ga0068859_1001502142 95
28 3300005618 Ga0068864_100001880 Ga0068864_1000018809 95
29 3300005719 Ga0068861_100087413 Ga0068861_1000874132 95
30 3300005834 Ga0068851_10042739 Ga0068851_100427392 95
31 3300005840 Ga0068870_10001728 Ga0068870_100017281 95
32 3300005841 Ga0068863_100004156 Ga0068863_10000415614 95
33 3300005842 Ga0068858_100025453 Ga0068858_1000254535 95
34 3300005843 Ga0068860_100009177 Ga0068860_10000917710 95
35 3300005844 Ga0068862_102129901 Ga0068862_1021299011 95
36 3300006358 Ga0068871_100008125 Ga0068871_1000081256 95
37 3300006881 Ga0068865_100004385 Ga0068865_1000043854 95
38 3300006931 Ga0097620_100150211 Ga0097620_1001502112 95
39 3300009098 Ga0105245_11819394 Ga0105245_118193941 95
40 3300013306 Ga0163162_10072772 Ga0163162_100727722 95
41 3300013308 Ga0157375_10260369 Ga0157375_102603691 95
42 3300014968 Ga0157379_12412239 Ga0157379_124122391 95
43 3300014969 Ga0157376_10054301 Ga0157376_100543014 95
44 3300017792 Ga0163161_10101972 Ga0163161_101019722 95
45 3300025315 Ga0207697_10162692 Ga0207697_101626921 95
46 3300025321 Ga0207656_10078173 Ga0207656_100781732 95
47 3300025893 Ga0207682_10000299 Ga0207682_100002996 95
48 3300025901 Ga0207688_10515534 Ga0207688_105155342 95
49 3300025903 Ga0207680_10193719 Ga0207680_101937192 95
50 3300025907 Ga0207645_10001423 Ga0207645_1000142319 95
51 3300025908 Ga0207643_10306605 Ga0207643_103066052 95
52 3300025925 Ga0207650_10204497 Ga0207650_102044971 95
53 3300025926 Ga0207659_10020422 Ga0207659_100204222 95
54 3300025927 Ga0207687_11165409 Ga0207687_111654091 95
55 3300025931 Ga0207644_10027550 Ga0207644_100275502 95
56 3300025933 Ga0207706_10137643 Ga0207706_101376432 95
57 3300025937 Ga0207669_10007022 Ga0207669_100070225 95
58 3300025938 Ga0207704_10355351 Ga0207704_103553512 95
59 3300025940 Ga0207691_10000016 Ga0207691_1000001651 95
60 3300025942 Ga0207689_10025878 Ga0207689_100258783 95
61 3300025960 Ga0207651_10011379 Ga0207651_100113793 95
62 3300025972 Ga0207668_10030335 Ga0207668_100303352 95
63 3300025986 Ga0207658_10022594 Ga0207658_100225942 95
64 3300026023 Ga0207677_10021067 Ga0207677_100210675 95
65 3300026035 Ga0207703_10082844 Ga0207703_100828442 95
66 3300026041 Ga0207639_10025923 Ga0207639_100259232 95
67 3300026067 Ga0207678_10067389 Ga0207678_100673894 95
68 3300026088 Ga0207641_10021701 Ga0207641_100217015 95
69 3300026089 Ga0207648_10003215 Ga0207648_100032155 95
70 3300026095 Ga0207676_10028606 Ga0207676_100286062 95
71 3300026118 Ga0207675_100184112 Ga0207675_1001841122 95
72 3300026121 Ga0207683_10000057 Ga0207683_1000005758 95
73 3300026142 Ga0207698_10018386 Ga0207698_100183863 95
74 3300028379 Ga0268266_10003576 Ga0268266_100035766 95
75 3300028380 Ga0268265_11873837 Ga0268265_118738372 95
76 3300028381 Ga0268264_10074750 Ga0268264_100747502 95
77 3300032005 Ga0307411_10717449 Ga0307411_107174492 98
78 3300006844 Ga0075428_100770751 Ga0075428_1007707512 99
79 3300005616 Ga0068852_101187854 Ga0068852_1011878541 100
80 3300026142 Ga0207698_11818103 Ga0207698_118181032 100
81 3300049587 Ga0501071_0591566 Ga0501071_0591566_239_601 100
82 3300003763 Ga0055529_1006361 Ga0055529_10063613 101
83 3300005337 Ga0070682_100296212 Ga0070682_1002962122 101
84 3300005455 Ga0070663_100190604 Ga0070663_1001906043 101
85 3300005563 Ga0068855_100067920 Ga0068855_1000679202 101
86 3300009545 Ga0105237_10000487 Ga0105237_1000048713 101
87 3300009551 Ga0105238_10070080 Ga0105238_100700803 101
88 3300020070 Ga0206356_11766869 Ga0206356_117668692 101
89 3300025250 Ga0209026_1000281 Ga0209026_100028118 101
90 3300025256 Ga0209759_1005553 Ga0209759_10055533 101
91 3300025256 Ga0209759_1012586 Ga0209759_10125863 101
92 3300025272 Ga0209455_1000465 Ga0209455_100046513 101
93 3300025904 Ga0207647_10043861 Ga0207647_100438613 101
94 3300025913 Ga0207695_10013067 Ga0207695_100130679 101
95 3300025914 Ga0207671_10000374 Ga0207671_1000037437 101
96 3300025949 Ga0207667_10063574 Ga0207667_100635742 101
97 3300026067 Ga0207678_10004226 Ga0207678_1000422612 101
98 3300026116 Ga0207674_10699498 Ga0207674_106994982 101
99 3300027252 Ga0209973_1011521 Ga0209973_10115212 101
100 3300027424 Ga0209984_1002123 Ga0209984_10021232 101
101 3300027552 Ga0209982_1002754 Ga0209982_10027542 101
102 3300027665 Ga0209983_1024080 Ga0209983_10240802 101
103 3300027682 Ga0209971_1063343 Ga0209971_10633432 101
104 3300027876 Ga0209974_10024792 Ga0209974_100247923 101
105 3300031824 Ga0307413_10558983 Ga0307413_105589831 101
106 3300032004 Ga0307414_10040337 Ga0307414_100403373 101
107 3300032004 Ga0307414_11683813 Ga0307414_116838132 101
108 3300005546 Ga0070696_100326072 Ga0070696_1003260722 102
109 3300005614 Ga0068856_100000158 Ga0068856_10000015810 102
110 3300009093 Ga0105240_10323247 Ga0105240_103232472 102
111 3300013105 Ga0157369_10009417 Ga0157369_100094176 102
112 3300013307 Ga0157372_11181710 Ga0157372_111817102 102
113 3300022467 Ga0224712_10179286 Ga0224712_101792862 102
114 3300026078 Ga0207702_10000167 Ga0207702_1000016717 102
115 3300012475 Ga0157317_1003088 Ga0157317_10030881 103
116 3300006846 Ga0075430_100722336 Ga0075430_1007223361 104
117 3300037466 Ga0395898_0005858 Ga0395898_0005858_12057_12425 104
118 3300038443 Ga0395901_0041616 Ga0395901_0041616_1566_1934 104
119 3300042006 Ga0439432_076248 Ga0439432_076248_232_600 104
120 3300042007 Ga0439449_0070066 Ga0439449_0070066_717_1085 104
121 3300050509 nmdc:mga0qj67_629425_c1 nmdc:mga0qj67_629425_c1_439_819 104
122 3300005435 Ga0070714_100763834 Ga0070714_1007638342 105
123 3300005467 Ga0070706_100147469 Ga0070706_1001474693 105
124 3300005985 Ga0081539_10037553 Ga0081539_100375533 105
125 3300006871 Ga0075434_100697476 Ga0075434_1006974762 105
126 3300020069 Ga0197907_10520165 Ga0197907_105201652 105
127 3300025910 Ga0207684_10099567 Ga0207684_100995673 105
128 3300025922 Ga0207646_10790555 Ga0207646_107905552 105
129 3300050512 nmdc:mga0n895_608740_c1 nmdc:mga0n895_608740_c1_512_907 105
130 3300005367 Ga0070667_100197493 Ga0070667_1001974932 106
131 3300005617 Ga0068859_100365691 Ga0068859_1003656911 106
132 3300005842 Ga0068858_100081716 Ga0068858_1000817164 106
133 3300005842 Ga0068858_101413991 Ga0068858_1014139912 106
134 3300006844 Ga0075428_100377095 Ga0075428_1003770952 106
135 3300006931 Ga0097620_100365666 Ga0097620_1003656661 106
136 3300009098 Ga0105245_10772752 Ga0105245_107727522 106
137 3300009147 Ga0114129_10381143 Ga0114129_103811433 106
138 3300009177 Ga0105248_10264347 Ga0105248_102643472 106
139 3300009177 Ga0105248_10349748 Ga0105248_103497483 106
140 3300009553 Ga0105249_10330255 Ga0105249_103302552 106
141 3300013306 Ga0163162_10051655 Ga0163162_100516553 106
142 3300014968 Ga0157379_10015311 Ga0157379_100153113 106
143 3300025907 Ga0207645_10393304 Ga0207645_103933042 106
144 3300025927 Ga0207687_10932431 Ga0207687_109324312 106
145 3300025941 Ga0207711_10114480 Ga0207711_101144803 106
146 3300025986 Ga0207658_11537611 Ga0207658_115376111 106
147 3300026035 Ga0207703_10886051 Ga0207703_108860512 106
148 3300026035 Ga0207703_11093359 Ga0207703_110933592 106
149 3300031901 Ga0307406_10157995 Ga0307406_101579952 106
150 3300042156 Ga0439446_0280128 Ga0439446_0280128_137_523 106
151 3300005549 Ga0070704_101543238 Ga0070704_1015432382 107
152 3300035084 Ga0373928_0209141 Ga0373928_0209141_87_437 107
153 3300035691 Ga0373931_0905685 Ga0373931_0905685_209_559 107
154 3300048904 Ga0496101_0484415 Ga0496101_0484415_360_731 107
155 3300005331 Ga0070670_100552812 Ga0070670_1005528122 108
156 3300025939 Ga0207665_10438044 Ga0207665_104380441 108
157 3300037068 Ga0373925_0526797 Ga0373925_0526797_439_816 108
158 3300042876 Ga0451577_0025346 Ga0451577_0025346_1626_1979 108
159 3300048918 Ga0496115_0631634 Ga0496115_0631634_358_708 108
160 3300049772 Ga0501275_000722 Ga0501275_000722_577_930 108
161 3300049773 Ga0501276_018049 Ga0501276_018049_20_373 108
162 3300005333 Ga0070677_10289372 Ga0070677_102893722 109
163 3300005459 Ga0068867_102273998 Ga0068867_1022739981 109
164 iso_pu_bacteria 2643221593 2643976040 109
165 iso_pu_bacteria 2941489479 2941492920 109
166 iso_pu_bacteria 2995948881 2995952242 109
167 3300005335 Ga0070666_10090274 Ga0070666_100902742 110
168 3300005347 Ga0070668_100031162 Ga0070668_1000311625 110
169 3300005455 Ga0070663_100553421 Ga0070663_1005534211 110
170 3300005466 Ga0070685_10003326 Ga0070685_100033262 110
171 3300005616 Ga0068852_100174413 Ga0068852_1001744132 110
172 3300006028 Ga0070717_10875988 Ga0070717_108759881 110
173 3300009093 Ga0105240_10001066 Ga0105240_1000106612 110
174 3300009545 Ga0105237_10030239 Ga0105237_100302396 110
175 3300009551 Ga0105238_10009941 Ga0105238_100099418 110
176 3300013307 Ga0157372_11080464 Ga0157372_110804642 110
177 3300014968 Ga0157379_11152369 Ga0157379_111523692 110
178 3300025972 Ga0207668_10009432 Ga0207668_100094323 110
179 3300046681 Ga0495647_0411525 Ga0495647_0411525_128_508 110
180 3300049586 Ga0501070_0345811 Ga0501070_0345811_527_880 110
181 3300049586 Ga0501070_1384070 Ga0501070_1384070_23_376 110
182 iso_pu_bacteria 2524614729 2525555676 110
183 iso_pu_bacteria 2627854209 2630650690 110
184 3300005327 Ga0070658_10389076 Ga0070658_103890762 111
185 3300005328 Ga0070676_10760030 Ga0070676_107600302 111
186 3300005331 Ga0070670_100035734 Ga0070670_1000357345 111
187 3300005334 Ga0068869_100228667 Ga0068869_1002286672 111
188 3300005335 Ga0070666_10038412 Ga0070666_100384123 111
189 3300005335 Ga0070666_10580334 Ga0070666_105803341 111
190 3300005336 Ga0070680_100227352 Ga0070680_1002273522 111
191 3300005338 Ga0068868_101745456 Ga0068868_1017454561 111
192 3300005344 Ga0070661_100084763 Ga0070661_1000847633 111
193 3300005355 Ga0070671_100178741 Ga0070671_1001787413 111
194 3300005367 Ga0070667_100011659 Ga0070667_1000116592 111
195 3300005367 Ga0070667_100305166 Ga0070667_1003051663 111
196 3300005367 Ga0070667_100843577 Ga0070667_1008435771 111
197 3300005455 Ga0070663_100054769 Ga0070663_1000547692 111
198 3300005457 Ga0070662_100003406 Ga0070662_1000034069 111
199 3300005458 Ga0070681_10002030 Ga0070681_100020306 111
200 3300005539 Ga0068853_100972993 Ga0068853_1009729931 111
201 3300005543 Ga0070672_100506535 Ga0070672_1005065352 111
202 3300005548 Ga0070665_100009116 Ga0070665_1000091169 111
203 3300005563 Ga0068855_100232099 Ga0068855_1002320993 111
204 3300005564 Ga0070664_100959540 Ga0070664_1009595402 111
205 3300005577 Ga0068857_100325944 Ga0068857_1003259442 111
206 3300005578 Ga0068854_100006573 Ga0068854_1000065735 111
207 3300005616 Ga0068852_100114003 Ga0068852_1001140034 111
208 3300005617 Ga0068859_100047278 Ga0068859_1000472781 111
209 3300005618 Ga0068864_100016674 Ga0068864_1000166744 111
210 3300005834 Ga0068851_10000626 Ga0068851_100006264 111
211 3300005842 Ga0068858_100030229 Ga0068858_1000302295 111
212 3300005844 Ga0068862_100422531 Ga0068862_1004225312 111
213 3300006847 Ga0075431_100623903 Ga0075431_1006239032 111
214 3300006881 Ga0068865_100064563 Ga0068865_1000645634 111
215 3300006931 Ga0097620_100047278 Ga0097620_1000472781 111
216 3300009093 Ga0105240_10673222 Ga0105240_106732222 111
217 3300009098 Ga0105245_10157482 Ga0105245_101574822 111
218 3300009098 Ga0105245_13259275 Ga0105245_132592751 111
219 3300009174 Ga0105241_10019053 Ga0105241_100190532 111
220 3300009545 Ga0105237_11688290 Ga0105237_116882901 111
221 3300009551 Ga0105238_10098350 Ga0105238_100983503 111
222 3300010375 Ga0105239_10183050 Ga0105239_101830502 111
223 3300010375 Ga0105239_11692414 Ga0105239_116924142 111
224 3300011119 Ga0105246_10128605 Ga0105246_101286052 111
225 3300013105 Ga0157369_10222272 Ga0157369_102222721 111
226 3300013296 Ga0157374_10029373 Ga0157374_100293732 111
227 3300013297 Ga0157378_10045984 Ga0157378_100459844 111
228 3300013306 Ga0163162_10178520 Ga0163162_101785203 111
229 3300014325 Ga0163163_10243111 Ga0163163_102431112 111
230 3300014497 Ga0182008_10259483 Ga0182008_102594832 111
231 3300014968 Ga0157379_10443109 Ga0157379_104431092 111
232 3300014968 Ga0157379_12586060 Ga0157379_125860602 111
233 3300014969 Ga0157376_10054232 Ga0157376_100542325 111
234 3300025321 Ga0207656_10016671 Ga0207656_100166715 111
235 3300025903 Ga0207680_10019316 Ga0207680_100193164 111
236 3300025904 Ga0207647_10000157 Ga0207647_1000015752 111
237 3300025911 Ga0207654_10049702 Ga0207654_100497022 111
238 3300025912 Ga0207707_10000018 Ga0207707_10000018109 111
239 3300025913 Ga0207695_10091521 Ga0207695_100915215 111
240 3300025913 Ga0207695_10110526 Ga0207695_101105263 111
241 3300025914 Ga0207671_10082488 Ga0207671_100824883 111
242 3300025920 Ga0207649_10349068 Ga0207649_103490682 111
243 3300025924 Ga0207694_10039101 Ga0207694_100391015 111
244 3300025925 Ga0207650_10077220 Ga0207650_100772203 111
245 3300025925 Ga0207650_10608520 Ga0207650_106085201 111
246 3300025927 Ga0207687_10527170 Ga0207687_105271701 111
247 3300025931 Ga0207644_10435158 Ga0207644_104351582 111
248 3300025933 Ga0207706_10004507 Ga0207706_100045074 111
249 3300025938 Ga0207704_10036864 Ga0207704_100368642 111
250 3300025942 Ga0207689_10218767 Ga0207689_102187672 111
251 3300025942 Ga0207689_10951373 Ga0207689_109513731 111
252 3300025949 Ga0207667_10183999 Ga0207667_101839992 111
253 3300025961 Ga0207712_10000197 Ga0207712_1000019728 111
254 3300025972 Ga0207668_12013296 Ga0207668_120132961 111
255 3300025981 Ga0207640_10004947 Ga0207640_100049476 111
256 3300025986 Ga0207658_10219610 Ga0207658_102196103 111
257 3300025986 Ga0207658_10685626 Ga0207658_106856261 111
258 3300026023 Ga0207677_10189469 Ga0207677_101894692 111
259 3300026035 Ga0207703_10040161 Ga0207703_100401612 111
260 3300026041 Ga0207639_10000446 Ga0207639_1000044610 111
261 3300026067 Ga0207678_10001892 Ga0207678_100018928 111
262 3300026078 Ga0207702_10175999 Ga0207702_101759993 111
263 3300026116 Ga0207674_10350045 Ga0207674_103500453 111
264 3300026142 Ga0207698_10733936 Ga0207698_107339362 111
265 3300028379 Ga0268266_10000006 Ga0268266_1000000659 111
266 3300028381 Ga0268264_11592312 Ga0268264_115923122 111
267 3300031731 Ga0307405_10902743 Ga0307405_109027432 111
268 3300031911 Ga0307412_10238975 Ga0307412_102389752 111
269 3300035691 Ga0373931_0084133 Ga0373931_0084133_1002_1397 111
270 3300048907 Ga0496104_1125273 Ga0496104_1125273_197_592 111
271 3300048912 Ga0496109_0711845 Ga0496109_0711845_76_441 111
272 3300048912 Ga0496109_1878381 Ga0496109_1878381_134_496 111
273 3300048915 Ga0496112_0216305 Ga0496112_0216305_466_828 111
274 3300048917 Ga0496114_0207161 Ga0496114_0207161_815_1210 111
275 3300003794 Ga0055531_10020826 Ga0055531_100208262 112
276 3300005327 Ga0070658_10197520 Ga0070658_101975203 112
277 3300005530 Ga0070679_100382832 Ga0070679_1003828321 112
278 3300005577 Ga0068857_101317239 Ga0068857_1013172391 112
279 3300005578 Ga0068854_100276652 Ga0068854_1002766522 112
280 3300005617 Ga0068859_100049000 Ga0068859_1000490003 112
281 3300005841 Ga0068863_100261300 Ga0068863_1002613002 112
282 3300005843 Ga0068860_101290623 Ga0068860_1012906232 112
283 3300006237 Ga0097621_100287792 Ga0097621_1002877922 112
284 3300006237 Ga0097621_100609324 Ga0097621_1006093242 112
285 3300006358 Ga0068871_100373085 Ga0068871_1003730852 112
286 3300006931 Ga0097620_100049000 Ga0097620_1000490003 112
287 3300009098 Ga0105245_11232190 Ga0105245_112321901 112
288 3300009177 Ga0105248_10653594 Ga0105248_106535942 112
289 3300009551 Ga0105238_10044849 Ga0105238_100448495 112
290 3300011119 Ga0105246_12417959 Ga0105246_124179591 112
291 3300013104 Ga0157370_10047891 Ga0157370_100478913 112
292 3300013297 Ga0157378_10828810 Ga0157378_108288102 112
293 3300017792 Ga0163161_11662717 Ga0163161_116627172 112
294 3300025294 Ga0209025_1029411 Ga0209025_10294112 112
295 3300025304 Ga0209257_1000263 Ga0209257_100026331 112
296 3300025924 Ga0207694_10011157 Ga0207694_100111572 112
297 3300025941 Ga0207711_10724561 Ga0207711_107245612 112
298 3300025981 Ga0207640_10971458 Ga0207640_109714581 112
299 3300026088 Ga0207641_10195580 Ga0207641_101955803 112
300 3300028794 Ga0307515_10525391 Ga0307515_105253911 112
301 3300031456 Ga0307513_10083926 Ga0307513_100839262 112
302 3300031456 Ga0307513_10244622 Ga0307513_102446221 112
303 3300031727 Ga0316576_10002379 Ga0316576_100023797 112
304 3300031824 Ga0307413_10805747 Ga0307413_108057472 112
305 3300032004 Ga0307414_10046276 Ga0307414_100462763 112
306 3300032004 Ga0307414_10138848 Ga0307414_101388481 112
307 3300036712 Ga0316584_0045361 Ga0316584_0045361_288_653 112
308 3300037418 Ga0395900_0003253 Ga0395900_0003253_16782_17153 112
309 3300041413 Ga0439465_0001078 Ga0439465_0001078_2831_3205 112
310 3300041451 Ga0451791_0513229 Ga0451791_0513229_686_1063 112
311 3300041451 Ga0451791_1604906 Ga0451791_1604906_1077_1457 112
312 3300041452 Ga0451793_1463101 Ga0451793_1463101_67_444 112
313 3300041453 Ga0451797_0751603 Ga0451797_0751603_374_754 112
314 3300041456 Ga0451795_0235484 Ga0451795_0235484_468_845 112
315 3300041459 Ga0451800_0681495 Ga0451800_0681495_50_430 112
316 3300041486 Ga0451807_0106323 Ga0451807_0106323_127_501 112
317 3300041494 Ga0451837_1152633 Ga0451837_1152633_86_466 112
318 3300041494 Ga0451837_1688733 Ga0451837_1688733_908_1282 112
319 3300041496 Ga0451839_1393893 Ga0451839_1393893_19_396 112
320 3300041498 Ga0451841_0210267 Ga0451841_0210267_417_797 112
321 3300041509 Ga0451843_0478485 Ga0451843_0478485_625_1005 112
322 3300041509 Ga0451843_1333241 Ga0451843_1333241_1120_1494 112
323 3300041509 Ga0451843_1594455 Ga0451843_1594455_121_498 112
324 3300041511 Ga0451855_1849199 Ga0451855_1849199_101_475 112
325 3300041512 Ga0451853_3160813 Ga0451853_3160813_10_387 112
326 3300041999 Ga0439433_0030552 Ga0439433_0030552_683_1057 112
327 3300042007 Ga0439449_0137246 Ga0439449_0137246_249_623 112
328 3300042156 Ga0439446_0152929 Ga0439446_0152929_160_534 112
329 3300046513 Ga0495616_0063888 Ga0495616_0063888_1410_1784 112
330 3300046522 Ga0495643_0085181 Ga0495643_0085181_759_1133 112
331 3300046525 Ga0495663_0011527 Ga0495663_0011527_1333_1707 112
332 3300049571 Ga0501034_1668579 Ga0501034_1668579_38_400 112
333 3300049573 Ga0501037_0067506 Ga0501037_0067506_354_716 112
334 3300049581 Ga0501047_0046204 Ga0501047_0046204_2077_2439 112
335 3300049585 Ga0501069_0061599 Ga0501069_0061599_1085_1447 112
336 3300049586 Ga0501070_0014516 Ga0501070_0014516_662_1024 112
337 3300049587 Ga0501071_0000973 Ga0501071_0000973_13780_14142 112
338 3300049589 Ga0501073_0001354 Ga0501073_0001354_3370_3732 112
339 3300049590 Ga0501074_0006572 Ga0501074_0006572_5147_5509 112
340 3300049592 Ga0501076_0256294 Ga0501076_0256294_460_822 112
341 3300049742 Ga0501080_0079514 Ga0501080_0079514_2498_2860 112
342 3300049822 Ga0501035_0272430 Ga0501035_0272430_516_878 112
343 3300049823 Ga0501044_0039950 Ga0501044_0039950_1304_1666 112
344 3300002774 JGI25150J39212_1025385 JGI25150J39212_10253852 113
345 3300003187 JGI25151J46595_10000059 JGI25151J46595_1000005957 113
346 3300003316 rootH1_10141190 rootH1_101411902 113
347 3300003323 rootH1_10258062 rootH1_102580622 113
348 3300003771 Ga0055526_1000039 Ga0055526_10000396 113
349 3300003773 Ga0055537_1000970 Ga0055537_10009706 113
350 3300003775 Ga0055524_1000067 Ga0055524_1000067125 113
351 3300003784 Ga0055534_1000025 Ga0055534_1000025125 113
352 3300003790 Ga0055528_1000024 Ga0055528_1000024125 113
353 3300005335 Ga0070666_10111070 Ga0070666_101110703 113
354 3300005338 Ga0068868_100981508 Ga0068868_1009815081 113
355 3300005345 Ga0070692_10372560 Ga0070692_103725602 113
356 3300005539 Ga0068853_100161865 Ga0068853_1001618654 113
357 3300005547 Ga0070693_100000485 Ga0070693_10000048519 113
358 3300005616 Ga0068852_100895626 Ga0068852_1008956262 113
359 3300006237 Ga0097621_101130457 Ga0097621_1011304572 113
360 3300009101 Ga0105247_10080002 Ga0105247_100800023 113
361 3300013297 Ga0157378_10000033 Ga0157378_100000333 113
362 3300014969 Ga0157376_12183153 Ga0157376_121831531 113
363 3300015689 Ga0183360_10001 Ga0183360_100011005 113
364 3300025245 Ga0207425_1035183 Ga0207425_10351832 113
365 3300025263 Ga0209565_1000005 Ga0209565_1000005122 113
366 3300025263 Ga0209565_1012074 Ga0209565_10120741 113
367 3300025273 Ga0209673_1000027 Ga0209673_1000027123 113
368 3300025291 Ga0209675_1000004 Ga0209675_1000004122 113
369 3300025294 Ga0209025_1000005 Ga0209025_1000005263 113
370 3300025295 Ga0209564_1000050 Ga0209564_1000050123 113
371 3300025297 Ga0209758_1019657 Ga0209758_10196574 113
372 3300025299 Ga0209256_1000031 Ga0209256_1000031123 113
373 3300025321 Ga0207656_10130747 Ga0207656_101307472 113
374 3300025938 Ga0207704_10169944 Ga0207704_101699442 113
375 3300026023 Ga0207677_10667186 Ga0207677_106671862 113
376 3300026088 Ga0207641_10810171 Ga0207641_108101712 113
377 3300031548 Ga0307408_100016229 Ga0307408_1000162295 113
378 3300031901 Ga0307406_10001746 Ga0307406_100017466 113
379 3300031911 Ga0307412_10253067 Ga0307412_102530671 113
380 3300035119 Ga0373956_0300887 Ga0373956_0300887_174_542 113
381 3300035172 Ga0373955_0644667 Ga0373955_0644667_38_406 113
382 3300035724 Ga0373933_0065213 Ga0373933_0065213_438_806 113
383 3300036401 Ga0373937_0268844 Ga0373937_0268844_513_881 113
384 3300039437 Ga0436365_0043459 Ga0436365_0043459_160_531 113
385 3300041404 Ga0439436_0005922 Ga0439436_0005922_2525_2899 113
386 3300041407 Ga0439447_003163 Ga0439447_003163_1636_2010 113
387 3300041411 Ga0439466_0072802 Ga0439466_0072802_301_675 113
388 3300046616 Ga0495668_0000625 Ga0495668_0000625_6248_6622 113
389 3300048924 Ga0496121_0011637 Ga0496121_0011637_5016_5390 113
390 3300049584 Ga0501068_0275321 Ga0501068_0275321_689_1063 113
391 3300003794 Ga0055531_10034350 Ga0055531_100343502 114
392 3300005328 Ga0070676_10305975 Ga0070676_103059752 114
393 3300005330 Ga0070690_100078817 Ga0070690_1000788172 114
394 3300005330 Ga0070690_100316531 Ga0070690_1003165312 114
395 3300005331 Ga0070670_100008428 Ga0070670_1000084282 114
396 3300005333 Ga0070677_10118220 Ga0070677_101182202 114
397 3300005334 Ga0068869_100003702 Ga0068869_1000037022 114
398 3300005334 Ga0068869_100958741 Ga0068869_1009587411 114
399 3300005335 Ga0070666_10144975 Ga0070666_101449752 114
400 3300005338 Ga0068868_100242723 Ga0068868_1002427232 114
401 3300005340 Ga0070689_100236243 Ga0070689_1002362433 114
402 3300005344 Ga0070661_100426498 Ga0070661_1004264982 114
403 3300005347 Ga0070668_100007024 Ga0070668_1000070245 114
404 3300005347 Ga0070668_100086196 Ga0070668_1000861962 114
405 3300005347 Ga0070668_100595168 Ga0070668_1005951682 114
406 3300005347 Ga0070668_101005321 Ga0070668_1010053211 114
407 3300005353 Ga0070669_100189753 Ga0070669_1001897532 114
408 3300005353 Ga0070669_100911823 Ga0070669_1009118232 114
409 3300005355 Ga0070671_100004584 Ga0070671_1000045846 114
410 3300005364 Ga0070673_100011769 Ga0070673_1000117695 114
411 3300005364 Ga0070673_100031389 Ga0070673_1000313894 114
412 3300005364 Ga0070673_102321733 Ga0070673_1023217331 114
413 3300005366 Ga0070659_100429201 Ga0070659_1004292011 114
414 3300005367 Ga0070667_100201635 Ga0070667_1002016353 114
415 3300005367 Ga0070667_100616589 Ga0070667_1006165892 114
416 3300005367 Ga0070667_102130715 Ga0070667_1021307152 114
417 3300005438 Ga0070701_10594484 Ga0070701_105944842 114
418 3300005441 Ga0070700_100487716 Ga0070700_1004877162 114
419 3300005457 Ga0070662_100316559 Ga0070662_1003165592 114
420 3300005459 Ga0068867_100019601 Ga0068867_1000196013 114
421 3300005459 Ga0068867_100227492 Ga0068867_1002274922 114
422 3300005466 Ga0070685_10746981 Ga0070685_107469811 114
423 3300005467 Ga0070706_100108047 Ga0070706_1001080473 114
424 3300005518 Ga0070699_100568316 Ga0070699_1005683162 114
425 3300005518 Ga0070699_101012419 Ga0070699_1010124191 114
426 3300005536 Ga0070697_100050758 Ga0070697_1000507581 114
427 3300005536 Ga0070697_100084333 Ga0070697_1000843332 114
428 3300005543 Ga0070672_100327375 Ga0070672_1003273751 114
429 3300005543 Ga0070672_100741073 Ga0070672_1007410732 114
430 3300005545 Ga0070695_101012913 Ga0070695_1010129131 114
431 3300005563 Ga0068855_100156491 Ga0068855_1001564912 114
432 3300005563 Ga0068855_100448569 Ga0068855_1004485692 114
433 3300005564 Ga0070664_100297366 Ga0070664_1002973662 114
434 3300005577 Ga0068857_100072694 Ga0068857_1000726942 114
435 3300005578 Ga0068854_102014696 Ga0068854_1020146962 114
436 3300005616 Ga0068852_100177058 Ga0068852_1001770582 114
437 3300005616 Ga0068852_101319905 Ga0068852_1013199052 114
438 3300005617 Ga0068859_100003068 Ga0068859_1000030689 114
439 3300005617 Ga0068859_100175520 Ga0068859_1001755203 114
440 3300005617 Ga0068859_100990812 Ga0068859_1009908122 114
441 3300005618 Ga0068864_100013312 Ga0068864_1000133126 114
442 3300005719 Ga0068861_100004164 Ga0068861_1000041643 114
443 3300005719 Ga0068861_100737640 Ga0068861_1007376402 114
444 3300005719 Ga0068861_102678237 Ga0068861_1026782372 114
445 3300005841 Ga0068863_100010149 Ga0068863_1000101492 114
446 3300005841 Ga0068863_100241591 Ga0068863_1002415912 114
447 3300005841 Ga0068863_100858141 Ga0068863_1008581412 114
448 3300005842 Ga0068858_100010172 Ga0068858_1000101722 114
449 3300005842 Ga0068858_100199035 Ga0068858_1001990352 114
450 3300005842 Ga0068858_100295430 Ga0068858_1002954302 114
451 3300005843 Ga0068860_101134403 Ga0068860_1011344032 114
452 3300005844 Ga0068862_100243607 Ga0068862_1002436073 114
453 3300005844 Ga0068862_101363684 Ga0068862_1013636841 114
454 3300006173 Ga0070716_100241286 Ga0070716_1002412863 114
455 3300006237 Ga0097621_100127563 Ga0097621_1001275633 114
456 3300006237 Ga0097621_100548367 Ga0097621_1005483672 114
457 3300006358 Ga0068871_101237401 Ga0068871_1012374011 114
458 3300006852 Ga0075433_10005479 Ga0075433_100054799 114
459 3300006871 Ga0075434_100035645 Ga0075434_1000356452 114
460 3300006871 Ga0075434_100493857 Ga0075434_1004938572 114
461 3300006931 Ga0097620_100003068 Ga0097620_10000306812 114
462 3300006931 Ga0097620_100175519 Ga0097620_1001755192 114
463 3300006931 Ga0097620_100990869 Ga0097620_1009908692 114
464 3300007076 Ga0075435_100055957 Ga0075435_1000559572 114
465 3300009093 Ga0105240_12731157 Ga0105240_127311571 114
466 3300009147 Ga0114129_12319367 Ga0114129_123193671 114
467 3300009174 Ga0105241_11976234 Ga0105241_119762342 114
468 3300009177 Ga0105248_10010111 Ga0105248_100101119 114
469 3300009177 Ga0105248_10048578 Ga0105248_100485785 114
470 3300009553 Ga0105249_10153983 Ga0105249_101539832 114
471 3300010375 Ga0105239_11627828 Ga0105239_116278282 114
472 3300013102 Ga0157371_10951074 Ga0157371_109510742 114
473 3300013297 Ga0157378_10011995 Ga0157378_100119959 114
474 3300013297 Ga0157378_11373149 Ga0157378_113731492 114
475 3300013306 Ga0163162_10095595 Ga0163162_100955953 114
476 3300013306 Ga0163162_10217872 Ga0163162_102178723 114
477 3300013308 Ga0157375_10244877 Ga0157375_102448772 114
478 3300013308 Ga0157375_10654026 Ga0157375_106540262 114
479 3300013308 Ga0157375_11199895 Ga0157375_111998952 114
480 3300014325 Ga0163163_10006992 Ga0163163_100069929 114
481 3300014325 Ga0163163_10771994 Ga0163163_107719942 114
482 3300014326 Ga0157380_11012657 Ga0157380_110126572 114
483 3300014326 Ga0157380_11186419 Ga0157380_111864192 114
484 3300014968 Ga0157379_10005585 Ga0157379_100055854 114
485 3300025304 Ga0209257_1000645 Ga0209257_10006452 114
486 3300025903 Ga0207680_10256724 Ga0207680_102567242 114
487 3300025907 Ga0207645_10020545 Ga0207645_100205455 114
488 3300025907 Ga0207645_10250888 Ga0207645_102508882 114
489 3300025910 Ga0207684_10283987 Ga0207684_102839872 114
490 3300025914 Ga0207671_11541317 Ga0207671_115413171 114
491 3300025923 Ga0207681_10202988 Ga0207681_102029882 114
492 3300025923 Ga0207681_10497716 Ga0207681_104977162 114
493 3300025925 Ga0207650_10255395 Ga0207650_102553952 114
494 3300025931 Ga0207644_10018576 Ga0207644_100185763 114
495 3300025932 Ga0207690_10834033 Ga0207690_108340332 114
496 3300025933 Ga0207706_10512192 Ga0207706_105121922 114
497 3300025936 Ga0207670_10211281 Ga0207670_102112812 114
498 3300025941 Ga0207711_10029362 Ga0207711_100293625 114
499 3300025942 Ga0207689_10003539 Ga0207689_100035399 114
500 3300025942 Ga0207689_10360605 Ga0207689_103606052 114
501 3300025949 Ga0207667_10300789 Ga0207667_103007892 114
502 3300025949 Ga0207667_11681093 Ga0207667_116810932 114
503 3300025960 Ga0207651_10185054 Ga0207651_101850543 114
504 3300025961 Ga0207712_10093749 Ga0207712_100937492 114
505 3300025972 Ga0207668_10053138 Ga0207668_100531382 114
506 3300025972 Ga0207668_10329700 Ga0207668_103297001 114
507 3300025972 Ga0207668_10693820 Ga0207668_106938202 114
508 3300025986 Ga0207658_10181013 Ga0207658_101810132 114
509 3300025986 Ga0207658_10476646 Ga0207658_104766462 114
510 3300026035 Ga0207703_10436988 Ga0207703_104369882 114
511 3300026035 Ga0207703_11241707 Ga0207703_112417072 114
512 3300026041 Ga0207639_11210947 Ga0207639_112109472 114
513 3300026088 Ga0207641_10016203 Ga0207641_100162034 114
514 3300026088 Ga0207641_10218331 Ga0207641_102183312 114
515 3300026089 Ga0207648_10008770 Ga0207648_100087709 114
516 3300026089 Ga0207648_10481243 Ga0207648_104812431 114
517 3300026095 Ga0207676_10012675 Ga0207676_100126752 114
518 3300026116 Ga0207674_10030180 Ga0207674_100301806 114
519 3300026118 Ga0207675_100007990 Ga0207675_1000079903 114
520 3300026118 Ga0207675_100052782 Ga0207675_1000527822 114
521 3300028379 Ga0268266_10515650 Ga0268266_105156502 114
522 3300028380 Ga0268265_10116638 Ga0268265_101166383 114
523 3300028380 Ga0268265_12065845 Ga0268265_120658452 114
524 3300028381 Ga0268264_10395170 Ga0268264_103951701 114
525 3300028381 Ga0268264_11178153 Ga0268264_111781531 114
526 3300035116 Ga0373945_0573170 Ga0373945_0573170_62_433 114
527 3300044673 Ga0453683_1027986 Ga0453683_1027986_62_433 114
528 3300047318 Ga0495636_0302337 Ga0495636_0302337_100_471 114
529 3300048905 Ga0496102_0035311 Ga0496102_0035311_1663_2037 114
530 3300048905 Ga0496102_1065864 Ga0496102_1065864_48_419 114
531 3300048906 Ga0496103_0174255 Ga0496103_0174255_303_674 114
532 3300048909 Ga0496106_0175677 Ga0496106_0175677_1299_1670 114
533 3300048911 Ga0496108_0502573 Ga0496108_0502573_606_980 114
534 3300048912 Ga0496109_0096664 Ga0496109_0096664_147_518 114
535 3300048913 Ga0496110_0966418 Ga0496110_0966418_117_488 114
536 3300048929 Ga0496126_0232656 Ga0496126_0232656_411_788 114
537 3300050507 nmdc:mga05p37_2122318_c1 nmdc:mga05p37_2122318_c1_98_469 114
538 3300050512 nmdc:mga0n895_39828_c1 nmdc:mga0n895_39828_c1_3695_4066 114
539 3300050513 nmdc:mga0rr50_116561_c1 nmdc:mga0rr50_116561_c1_658_1029 114
540 3300050515 nmdc:mga0a205_17083_c1 nmdc:mga0a205_17083_c1_2080_2451 114
541 3300005328 Ga0070676_10208852 Ga0070676_102088522 115
542 3300005331 Ga0070670_100257470 Ga0070670_1002574702 115
543 3300005334 Ga0068869_101131478 Ga0068869_1011314781 115
544 3300005343 Ga0070687_101464844 Ga0070687_1014648441 115
545 3300005347 Ga0070668_100126686 Ga0070668_1001266863 115
546 3300005353 Ga0070669_100577299 Ga0070669_1005772992 115
547 3300005364 Ga0070673_100278762 Ga0070673_1002787622 115
548 3300005563 Ga0068855_100024004 Ga0068855_1000240045 115
549 3300005617 Ga0068859_101222105 Ga0068859_1012221052 115
550 3300005618 Ga0068864_101726923 Ga0068864_1017269231 115
551 3300005841 Ga0068863_100067477 Ga0068863_1000674773 115
552 3300005841 Ga0068863_100187981 Ga0068863_1001879812 115
553 3300005843 Ga0068860_100229107 Ga0068860_1002291073 115
554 3300005844 Ga0068862_100392611 Ga0068862_1003926112 115
555 3300006237 Ga0097621_101997225 Ga0097621_1019972252 115
556 3300006358 Ga0068871_101195234 Ga0068871_1011952342 115
557 3300006931 Ga0097620_101222151 Ga0097620_1012221512 115
558 3300009094 Ga0111539_12463489 Ga0111539_124634891 115
559 3300013308 Ga0157375_10602218 Ga0157375_106022182 115
560 3300025925 Ga0207650_10485098 Ga0207650_104850981 115
561 3300025940 Ga0207691_10146131 Ga0207691_101461313 115
562 3300025942 Ga0207689_10723281 Ga0207689_107232812 115
563 3300025949 Ga0207667_10106036 Ga0207667_101060364 115
564 3300025960 Ga0207651_10323798 Ga0207651_103237982 115
565 3300026095 Ga0207676_10312254 Ga0207676_103122543 115
566 3300028380 Ga0268265_10087070 Ga0268265_100870702 115
567 3300028381 Ga0268264_10290925 Ga0268264_102909253 115
568 3300037418 Ga0395900_0000439 Ga0395900_0000439_26623_26982 115
569 3300049823 Ga0501044_1273312 Ga0501044_1273312_147_506 115
570 3300005327 Ga0070658_10185011 Ga0070658_101850112 116
571 3300005328 Ga0070676_10002764 Ga0070676_100027649 116
572 3300005330 Ga0070690_100226220 Ga0070690_1002262201 116
573 3300005334 Ga0068869_100144345 Ga0068869_1001443452 116
574 3300005335 Ga0070666_10439698 Ga0070666_104396982 116
575 3300005338 Ga0068868_100085591 Ga0068868_1000855912 116
576 3300005347 Ga0070668_100009853 Ga0070668_1000098536 116
577 3300005353 Ga0070669_100027849 Ga0070669_1000278492 116
578 3300005355 Ga0070671_100729798 Ga0070671_1007297982 116
579 3300005355 Ga0070671_100994493 Ga0070671_1009944932 116
580 3300005356 Ga0070674_100221420 Ga0070674_1002214201 116
581 3300005364 Ga0070673_100024978 Ga0070673_1000249783 116
582 3300005455 Ga0070663_100284310 Ga0070663_1002843102 116
583 3300005543 Ga0070672_100003844 Ga0070672_1000038448 116
584 3300005548 Ga0070665_100036651 Ga0070665_1000366517 116
585 3300005617 Ga0068859_100105870 Ga0068859_1001058703 116
586 3300005840 Ga0068870_10019799 Ga0068870_100197994 116
587 3300005843 Ga0068860_101102990 Ga0068860_1011029902 116
588 3300005844 Ga0068862_100450488 Ga0068862_1004504882 116
589 3300006358 Ga0068871_101300818 Ga0068871_1013008182 116
590 3300006881 Ga0068865_100196696 Ga0068865_1001966962 116
591 3300006931 Ga0097620_100105874 Ga0097620_1001058743 116
592 3300009093 Ga0105240_10871965 Ga0105240_108719652 116
593 3300009551 Ga0105238_10144595 Ga0105238_101445953 116
594 3300011119 Ga0105246_10299425 Ga0105246_102994252 116
595 3300013296 Ga0157374_10380858 Ga0157374_103808583 116
596 3300025315 Ga0207697_10145710 Ga0207697_101457101 116
597 3300025907 Ga0207645_10090476 Ga0207645_100904763 116
598 3300025908 Ga0207643_10019292 Ga0207643_100192924 116
599 3300025909 Ga0207705_10113978 Ga0207705_101139782 116
600 3300025923 Ga0207681_10273319 Ga0207681_102733192 116
601 3300025924 Ga0207694_10218021 Ga0207694_102180211 116
602 3300025925 Ga0207650_10039577 Ga0207650_100395774 116
603 3300025926 Ga0207659_10890078 Ga0207659_108900782 116
604 3300025937 Ga0207669_10115575 Ga0207669_101155753 116
605 3300025938 Ga0207704_10142373 Ga0207704_101423732 116
606 3300025940 Ga0207691_10008755 Ga0207691_100087553 116
607 3300025942 Ga0207689_10031723 Ga0207689_100317231 116
608 3300025960 Ga0207651_10037484 Ga0207651_100374843 116
609 3300025972 Ga0207668_10012378 Ga0207668_100123782 116
610 3300026023 Ga0207677_11190633 Ga0207677_111906332 116
611 3300026067 Ga0207678_11442678 Ga0207678_114426782 116
612 3300026078 Ga0207702_10249895 Ga0207702_102498953 116
613 3300026089 Ga0207648_10046725 Ga0207648_100467254 116
614 3300026121 Ga0207683_10047376 Ga0207683_100473767 116
615 3300028380 Ga0268265_10415830 Ga0268265_104158302 116
616 3300028381 Ga0268264_11428742 Ga0268264_114287422 116
617 3300041498 Ga0451841_0364395 Ga0451841_0364395_494_862 116
618 3300005338 Ga0068868_100063280 Ga0068868_1000632803 117
619 3300005347 Ga0070668_100497955 Ga0070668_1004979551 117
620 3300005355 Ga0070671_100005816 Ga0070671_1000058167 117
621 3300005440 Ga0070705_100132254 Ga0070705_1001322543 117
622 3300005459 Ga0068867_100211391 Ga0068867_1002113912 117
623 3300005844 Ga0068862_100562815 Ga0068862_1005628153 117
624 3300006237 Ga0097621_100956602 Ga0097621_1009566022 117
625 3300009101 Ga0105247_10808752 Ga0105247_108087521 117
626 3300013297 Ga0157378_10022574 Ga0157378_100225746 117
627 3300013306 Ga0163162_10104702 Ga0163162_101047022 117
628 3300014325 Ga0163163_10041419 Ga0163163_100414195 117
629 3300014326 Ga0157380_10213542 Ga0157380_102135422 117
630 3300017792 Ga0163161_11909107 Ga0163161_119091072 117
631 3300025903 Ga0207680_10161290 Ga0207680_101612901 117
632 3300025907 Ga0207645_10619758 Ga0207645_106197582 117
633 3300025931 Ga0207644_10107214 Ga0207644_101072143 117
634 3300025972 Ga0207668_10344710 Ga0207668_103447102 117
635 3300025972 Ga0207668_10618915 Ga0207668_106189152 117
636 3300026023 Ga0207677_10151160 Ga0207677_101511602 117
637 3300031731 Ga0307405_10096808 Ga0307405_100968083 117
638 3300031901 Ga0307406_10101260 Ga0307406_101012603 117
639 3300046615 Ga0495656_0006617 Ga0495656_0006617_1843_2214 117
640 3300047318 Ga0495636_0005345 Ga0495636_0005345_4481_4852 117
641 3300049824 Ga0501045_0260855 Ga0501045_0260855_182_553 117
642 3300005330 Ga0070690_100256499 Ga0070690_1002564992 118
643 3300005344 Ga0070661_100171394 Ga0070661_1001713942 118
644 3300005355 Ga0070671_100371048 Ga0070671_1003710482 118
645 3300005841 Ga0068863_100005809 Ga0068863_1000058099 118
646 3300005842 Ga0068858_100018432 Ga0068858_1000184324 118
647 3300005843 Ga0068860_100016950 Ga0068860_1000169502 118
648 3300006358 Ga0068871_100115364 Ga0068871_1001153643 118
649 3300009098 Ga0105245_10412452 Ga0105245_104124522 118
650 3300009177 Ga0105248_10810777 Ga0105248_108107771 118
651 3300009553 Ga0105249_10216348 Ga0105249_102163483 118
652 3300010375 Ga0105239_10017865 Ga0105239_100178652 118
653 3300011119 Ga0105246_11961239 Ga0105246_119612392 118
654 3300013296 Ga0157374_10611992 Ga0157374_106119922 118
655 3300014325 Ga0163163_10000117 Ga0163163_1000011753 118
656 3300014325 Ga0163163_10005924 Ga0163163_100059249 118
657 3300014968 Ga0157379_10002783 Ga0157379_100027832 118
658 3300025920 Ga0207649_10260924 Ga0207649_102609241 118
659 3300025927 Ga0207687_10299892 Ga0207687_102998922 118
660 3300025941 Ga0207711_11290281 Ga0207711_112902811 118
661 3300025961 Ga0207712_10168580 Ga0207712_101685803 118
662 3300025986 Ga0207658_11543487 Ga0207658_115434871 118
663 3300026088 Ga0207641_10207363 Ga0207641_102073632 118
664 3300026088 Ga0207641_10352228 Ga0207641_103522282 118
665 3300026095 Ga0207676_10025226 Ga0207676_100252263 118
666 3300028381 Ga0268264_10014295 Ga0268264_100142957 118
667 3300002077 JGI24744J21845_10028155 JGI24744J21845_100281551 119
668 3300005335 Ga0070666_10000243 Ga0070666_1000024325 119
669 3300013297 Ga0157378_10061661 Ga0157378_100616614 119
670 3300025903 Ga0207680_10000114 Ga0207680_1000011411 119

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mns-assembly1.cif.gz_B crystal structure of the znf4 of nucleoporin nup358/ranbp2 in complex with ran-gdp 0.8097 13 36
4s1z-assembly1.cif.gz_G crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin 0.8049 13 36
7mnt-assembly2.cif.gz_D crystal structure of the znf5 or znf6 of nucleoporin nup358/ranbp2 in complex with ran-gdp 0.7975 13 38
7mnu-assembly1.cif.gz_B crystal structure of the znf7 of nucleoporin nup358/ranbp2 in complex with ran-gdp 0.7948 13 38
6cfj-assembly1.cif.gz_15 crystal structure of the thermus thermophilus 70s ribosome in complex with histidyl-cam and bound to mrna and a-, p-, and e-site trnas at 2.8a resolution 0.7935 9 37
ID Description Score Start End Superfamily
af_O50414_43_217_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9023 69 86 3.30.420.10
af_Q54UQ6_98_225_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.8374 13 42 1.10.287.110
af_Q57859_1_190_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7661 13 45 1.25.10.10
af_Q9U0J7_91_204_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7308 69 86 3.30.420.40
3wnoB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7055 52 105 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A0H2XB56-F1-model_v4 Uncharacterized protein 0.8913 51 118
AF-A0A2V6SPW6-F1-model_v4 DUF35 domain-containing protein 0.8837 9 110
AF-A0A7X7PVS5-F1-model_v4 Zinc ribbon domain-containing protein 0.8747 7 105
AF-A0A4Q2WTT4-F1-model_v4 Zinc ribbon domain-containing protein 0.8746 6 109
AF-A0A2K1PZW2-F1-model_v4 Zinc ribbon domain-containing protein 0.8675 5 108

Feature Viewer

pLDDT pTM Quality
84.52 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map