F474082
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 277 | 665 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10771994|Ga0163163_107719942 |
| Length | 132 |
| Sequence | MSNARPGLVGATRQSPHCRETILESAAVCPSCKHHLRYGAAADGSAAQEPALTPLRIEGSIRHPSDGEPWEYTVVVVIRNDRGQEIARKLVGVGAMGPNEQRTFTLSVEAVTAKPKIARERLPAAAMSHYKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 4 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 5 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 214 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 215 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 216 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 217 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 224 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 225 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 226 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 227 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 228 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 229 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 230 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 231 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 269 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 0.45 |
| Isolates | 0.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.43 |
| Nodule | 0 |
| Rhizoplane | 3.13 |
| Rhizosphere | 89.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10028155 | 3300002077 | Bacteria | 1084 |
| 2 | JGI25150J39212_1025385 | 3300002774 | Bacteria | 865 |
| 3 | JGI25151J46595_10000059 | 3300003187 | Bacteria | 147998 |
| 4 | rootH1_10141190 | 3300003316 | Bacteria | 1660 |
| 5 | rootH1_10258062 | 3300003323 | Bacteria | 1433 |
| 6 | Ga0055529_1006361 | 3300003763 | Bacteria | 1655 |
| 7 | Ga0055526_1000039 | 3300003771 | Bacteria | 131421 |
| 8 | Ga0055537_1000970 | 3300003773 | Bacteria | 13065 |
| 9 | Ga0055524_1000067 | 3300003775 | Bacteria | 131421 |
| 10 | Ga0055534_1000025 | 3300003784 | Bacteria | 131421 |
| 11 | Ga0055528_1000024 | 3300003790 | Bacteria | 131421 |
| 12 | Ga0055531_10020826 | 3300003794 | Bacteria | 2574 |
| 13 | Ga0055531_10034350 | 3300003794 | Bacteria | 1611 |
| 14 | Ga0070658_10185011 | 3300005327 | Bacteria | 1754 |
| 15 | Ga0070658_10197520 | 3300005327 | Bacteria | 1696 |
| 16 | Ga0070658_10389076 | 3300005327 | Bacteria | 1197 |
| 17 | Ga0070658_10721862 | 3300005327 | Bacteria | 865 |
| 18 | Ga0070676_10001328 | 3300005328 | Bacteria | 12430 |
| 19 | Ga0070676_10002764 | 3300005328 | Bacteria | 9066 |
| 20 | Ga0070676_10208852 | 3300005328 | Unclassified | 1284 |
| 21 | Ga0070676_10305975 | 3300005328 | Bacteria | 1079 |
| 22 | Ga0070676_10760030 | 3300005328 | Unclassified | 712 |
| 23 | Ga0070690_100078817 | 3300005330 | Bacteria | 2153 |
| 24 | Ga0070690_100226220 | 3300005330 | Bacteria | 1313 |
| 25 | Ga0070690_100256499 | 3300005330 | Bacteria | 1239 |
| 26 | Ga0070690_100316531 | 3300005330 | Bacteria | 1123 |
| 27 | Ga0070670_100008428 | 3300005331 | Bacteria | 8791 |
| 28 | Ga0070670_100035734 | 3300005331 | Bacteria | 4277 |
| 29 | Ga0070670_100102268 | 3300005331 | Bacteria | 2468 |
| 30 | Ga0070670_100257470 | 3300005331 | Bacteria | 1521 |
| 31 | Ga0070670_100552812 | 3300005331 | Bacteria | 1027 |
| 32 | Ga0070677_10001696 | 3300005333 | Bacteria | 6967 |
| 33 | Ga0070677_10118220 | 3300005333 | Bacteria | 1193 |
| 34 | Ga0070677_10289372 | 3300005333 | Bacteria | 828 |
| 35 | Ga0068869_100003702 | 3300005334 | Bacteria | 9408 |
| 36 | Ga0068869_100144345 | 3300005334 | Bacteria | 1841 |
| 37 | Ga0068869_100228667 | 3300005334 | Unclassified | 1477 |
| 38 | Ga0068869_100958741 | 3300005334 | Bacteria | 743 |
| 39 | Ga0068869_101131478 | 3300005334 | Bacteria | 686 |
| 40 | Ga0070666_10000243 | 3300005335 | Bacteria | 37033 |
| 41 | Ga0070666_10024731 | 3300005335 | Bacteria | 3915 |
| 42 | Ga0070666_10038412 | 3300005335 | Bacteria | 3186 |
| 43 | Ga0070666_10090274 | 3300005335 | Bacteria | 2104 |
| 44 | Ga0070666_10111070 | 3300005335 | Bacteria | 1896 |
| 45 | Ga0070666_10144975 | 3300005335 | Bacteria | 1655 |
| 46 | Ga0070666_10439698 | 3300005335 | Bacteria | 941 |
| 47 | Ga0070666_10580334 | 3300005335 | Unclassified | 817 |
| 48 | Ga0070680_100227352 | 3300005336 | Bacteria | 1575 |
| 49 | Ga0070682_100296212 | 3300005337 | Bacteria | 1185 |
| 50 | Ga0068868_100008085 | 3300005338 | Bacteria | 7523 |
| 51 | Ga0068868_100063280 | 3300005338 | Bacteria | 2935 |
| 52 | Ga0068868_100085591 | 3300005338 | Bacteria | 2533 |
| 53 | Ga0068868_100242723 | 3300005338 | Bacteria | 1514 |
| 54 | Ga0068868_100981508 | 3300005338 | Bacteria | 772 |
| 55 | Ga0068868_101745456 | 3300005338 | Unclassified | 587 |
| 56 | Ga0070689_100236243 | 3300005340 | Bacteria | 1504 |
| 57 | Ga0070689_100999200 | 3300005340 | Unclassified | 744 |
| 58 | Ga0070687_101464844 | 3300005343 | Bacteria | 512 |
| 59 | Ga0070661_100084763 | 3300005344 | Bacteria | 2341 |
| 60 | Ga0070661_100171394 | 3300005344 | Bacteria | 1648 |
| 61 | Ga0070661_100426498 | 3300005344 | Bacteria | 1052 |
| 62 | Ga0070692_10372560 | 3300005345 | Bacteria | 893 |
| 63 | Ga0070668_100001020 | 3300005347 | Bacteria | 19602 |
| 64 | Ga0070668_100007024 | 3300005347 | Bacteria | 8342 |
| 65 | Ga0070668_100009853 | 3300005347 | Bacteria | 7077 |
| 66 | Ga0070668_100031162 | 3300005347 | Bacteria | 4057 |
| 67 | Ga0070668_100086196 | 3300005347 | Bacteria | 2469 |
| 68 | Ga0070668_100126686 | 3300005347 | Bacteria | 2046 |
| 69 | Ga0070668_100497955 | 3300005347 | Bacteria | 1054 |
| 70 | Ga0070668_100595168 | 3300005347 | Bacteria | 967 |
| 71 | Ga0070668_101005321 | 3300005347 | Unclassified | 749 |
| 72 | Ga0070669_100027849 | 3300005353 | Bacteria | 4068 |
| 73 | Ga0070669_100039196 | 3300005353 | Bacteria | 3442 |
| 74 | Ga0070669_100189753 | 3300005353 | Bacteria | 1612 |
| 75 | Ga0070669_100577299 | 3300005353 | Unclassified | 940 |
| 76 | Ga0070669_100911823 | 3300005353 | Unclassified | 751 |
| 77 | Ga0070675_100006444 | 3300005354 | Bacteria | 9007 |
| 78 | Ga0070671_100004584 | 3300005355 | Bacteria | 10949 |
| 79 | Ga0070671_100005816 | 3300005355 | Bacteria | 9822 |
| 80 | Ga0070671_100009918 | 3300005355 | Bacteria | 7650 |
| 81 | Ga0070671_100178741 | 3300005355 | Bacteria | 1796 |
| 82 | Ga0070671_100371048 | 3300005355 | Bacteria | 1222 |
| 83 | Ga0070671_100729798 | 3300005355 | Bacteria | 860 |
| 84 | Ga0070671_100994493 | 3300005355 | Bacteria | 735 |
| 85 | Ga0070674_100014257 | 3300005356 | Bacteria | 4938 |
| 86 | Ga0070674_100221420 | 3300005356 | Bacteria | 1472 |
| 87 | Ga0070673_100009480 | 3300005364 | Bacteria | 6534 |
| 88 | Ga0070673_100011769 | 3300005364 | Bacteria | 5984 |
| 89 | Ga0070673_100024978 | 3300005364 | Bacteria | 4390 |
| 90 | Ga0070673_100031389 | 3300005364 | Bacteria | 3986 |
| 91 | Ga0070673_100278762 | 3300005364 | Unclassified | 1466 |
| 92 | Ga0070673_102321733 | 3300005364 | Unclassified | 510 |
| 93 | Ga0070659_100429201 | 3300005366 | Bacteria | 1118 |
| 94 | Ga0070667_100001177 | 3300005367 | Bacteria | 23791 |
| 95 | Ga0070667_100011659 | 3300005367 | Bacteria | 7267 |
| 96 | Ga0070667_100197493 | 3300005367 | Bacteria | 1784 |
| 97 | Ga0070667_100201635 | 3300005367 | Bacteria | 1766 |
| 98 | Ga0070667_100305166 | 3300005367 | Unclassified | 1434 |
| 99 | Ga0070667_100616589 | 3300005367 | Bacteria | 1000 |
| 100 | Ga0070667_100843577 | 3300005367 | Bacteria | 852 |
| 101 | Ga0070667_102130715 | 3300005367 | Unclassified | 528 |
| 102 | Ga0070714_100763834 | 3300005435 | Unclassified | 935 |
| 103 | Ga0070701_10594484 | 3300005438 | Bacteria | 732 |
| 104 | Ga0070705_100132254 | 3300005440 | Bacteria | 1629 |
| 105 | Ga0070700_100487716 | 3300005441 | Unclassified | 945 |
| 106 | Ga0070663_100006160 | 3300005455 | Bacteria | 7184 |
| 107 | Ga0070663_100054769 | 3300005455 | Unclassified | 2852 |
| 108 | Ga0070663_100190604 | 3300005455 | Bacteria | 1595 |
| 109 | Ga0070663_100284310 | 3300005455 | Bacteria | 1319 |
| 110 | Ga0070663_100553421 | 3300005455 | Bacteria | 962 |
| 111 | Ga0070678_100033420 | 3300005456 | Bacteria | 3571 |
| 112 | Ga0070662_100003406 | 3300005457 | Bacteria | 9913 |
| 113 | Ga0070662_100316559 | 3300005457 | Bacteria | 1271 |
| 114 | Ga0070681_10002030 | 3300005458 | Bacteria | 18327 |
| 115 | Ga0068867_100019601 | 3300005459 | Bacteria | 4818 |
| 116 | Ga0068867_100066199 | 3300005459 | Bacteria | 2691 |
| 117 | Ga0068867_100211391 | 3300005459 | Bacteria | 1558 |
| 118 | Ga0068867_100227492 | 3300005459 | Bacteria | 1506 |
| 119 | Ga0068867_102273998 | 3300005459 | Bacteria | 515 |
| 120 | Ga0070685_10003326 | 3300005466 | Bacteria | 8177 |
| 121 | Ga0070685_10074633 | 3300005466 | Bacteria | 2018 |
| 122 | Ga0070685_10746981 | 3300005466 | Bacteria | 717 |
| 123 | Ga0070706_100108047 | 3300005467 | Bacteria | 2588 |
| 124 | Ga0070706_100147469 | 3300005467 | Unclassified | 2197 |
| 125 | Ga0070699_100568316 | 3300005518 | Bacteria | 1033 |
| 126 | Ga0070699_101012419 | 3300005518 | Bacteria | 762 |
| 127 | Ga0070679_100382832 | 3300005530 | Bacteria | 1353 |
| 128 | Ga0070697_100050758 | 3300005536 | Bacteria | 3368 |
| 129 | Ga0070697_100084333 | 3300005536 | Bacteria | 2620 |
| 130 | Ga0068853_100026450 | 3300005539 | Bacteria | 4872 |
| 131 | Ga0068853_100161865 | 3300005539 | Unclassified | 2020 |
| 132 | Ga0068853_100972993 | 3300005539 | Bacteria | 816 |
| 133 | Ga0070672_100003844 | 3300005543 | Bacteria | 9776 |
| 134 | Ga0070672_100005073 | 3300005543 | Bacteria | 8687 |
| 135 | Ga0070672_100327375 | 3300005543 | Bacteria | 1303 |
| 136 | Ga0070672_100506535 | 3300005543 | Bacteria | 1045 |
| 137 | Ga0070672_100741073 | 3300005543 | Bacteria | 862 |
| 138 | Ga0070695_101012913 | 3300005545 | Unclassified | 676 |
| 139 | Ga0070696_100326072 | 3300005546 | Bacteria | 1183 |
| 140 | Ga0070693_100000485 | 3300005547 | Bacteria | 17816 |
| 141 | Ga0070665_100009116 | 3300005548 | Bacteria | 10051 |
| 142 | Ga0070665_100027210 | 3300005548 | Bacteria | 5759 |
| 143 | Ga0070665_100036651 | 3300005548 | Bacteria | 4931 |
| 144 | Ga0070704_101543238 | 3300005549 | Unclassified | 611 |
| 145 | Ga0068855_100024004 | 3300005563 | Bacteria | 7300 |
| 146 | Ga0068855_100067920 | 3300005563 | Bacteria | 4151 |
| 147 | Ga0068855_100156491 | 3300005563 | Bacteria | 2589 |
| 148 | Ga0068855_100232099 | 3300005563 | Bacteria | 2066 |
| 149 | Ga0068855_100448569 | 3300005563 | Bacteria | 1408 |
| 150 | Ga0070664_100297366 | 3300005564 | Bacteria | 1458 |
| 151 | Ga0070664_100959540 | 3300005564 | Bacteria | 803 |
| 152 | Ga0068857_100072694 | 3300005577 | Bacteria | 3064 |
| 153 | Ga0068857_100325944 | 3300005577 | Bacteria | 1419 |
| 154 | Ga0068857_101317239 | 3300005577 | Bacteria | 701 |
| 155 | Ga0068854_100006573 | 3300005578 | Bacteria | 7404 |
| 156 | Ga0068854_100276652 | 3300005578 | Bacteria | 1350 |
| 157 | Ga0068854_102014696 | 3300005578 | Unclassified | 532 |
| 158 | Ga0068856_100000158 | 3300005614 | Bacteria | 70033 |
| 159 | Ga0068852_100001467 | 3300005616 | Bacteria | 15945 |
| 160 | Ga0068852_100114003 | 3300005616 | Bacteria | 2462 |
| 161 | Ga0068852_100174413 | 3300005616 | Bacteria | 2018 |
| 162 | Ga0068852_100177058 | 3300005616 | Bacteria | 2003 |
| 163 | Ga0068852_100895626 | 3300005616 | Bacteria | 904 |
| 164 | Ga0068852_101187854 | 3300005616 | Bacteria | 784 |
| 165 | Ga0068852_101319905 | 3300005616 | Bacteria | 743 |
| 166 | Ga0068859_100003068 | 3300005617 | Bacteria | 16938 |
| 167 | Ga0068859_100047278 | 3300005617 | Bacteria | 4323 |
| 168 | Ga0068859_100049000 | 3300005617 | Bacteria | 4243 |
| 169 | Ga0068859_100105870 | 3300005617 | Bacteria | 2872 |
| 170 | Ga0068859_100150214 | 3300005617 | Bacteria | 2405 |
| 171 | Ga0068859_100175520 | 3300005617 | Bacteria | 2224 |
| 172 | Ga0068859_100365691 | 3300005617 | Bacteria | 1538 |
| 173 | Ga0068859_100990812 | 3300005617 | Bacteria | 923 |
| 174 | Ga0068859_101222105 | 3300005617 | Unclassified | 828 |
| 175 | Ga0068864_100001880 | 3300005618 | Bacteria | 17239 |
| 176 | Ga0068864_100013312 | 3300005618 | Bacteria | 6813 |
| 177 | Ga0068864_100016674 | 3300005618 | Bacteria | 6122 |
| 178 | Ga0068864_101726923 | 3300005618 | Unclassified | 631 |
| 179 | Ga0068861_100004164 | 3300005719 | Bacteria | 9698 |
| 180 | Ga0068861_100087413 | 3300005719 | Bacteria | 2453 |
| 181 | Ga0068861_100737640 | 3300005719 | Unclassified | 919 |
| 182 | Ga0068861_102678237 | 3300005719 | Unclassified | 503 |
| 183 | Ga0068851_10000626 | 3300005834 | Bacteria | 15011 |
| 184 | Ga0068851_10042739 | 3300005834 | Bacteria | 2282 |
| 185 | Ga0068870_10001728 | 3300005840 | Bacteria | 8943 |
| 186 | Ga0068870_10019799 | 3300005840 | Bacteria | 3269 |
| 187 | Ga0068863_100004156 | 3300005841 | Bacteria | 14294 |
| 188 | Ga0068863_100005809 | 3300005841 | Bacteria | 12094 |
| 189 | Ga0068863_100010149 | 3300005841 | Bacteria | 9160 |
| 190 | Ga0068863_100067477 | 3300005841 | Bacteria | 3383 |
| 191 | Ga0068863_100187981 | 3300005841 | Bacteria | 1984 |
| 192 | Ga0068863_100241591 | 3300005841 | Bacteria | 1743 |
| 193 | Ga0068863_100261300 | 3300005841 | Bacteria | 1674 |
| 194 | Ga0068863_100858141 | 3300005841 | Bacteria | 907 |
| 195 | Ga0068858_100010172 | 3300005842 | Bacteria | 8929 |
| 196 | Ga0068858_100018432 | 3300005842 | Bacteria | 6535 |
| 197 | Ga0068858_100025453 | 3300005842 | Bacteria | 5506 |
| 198 | Ga0068858_100030229 | 3300005842 | Bacteria | 5031 |
| 199 | Ga0068858_100081716 | 3300005842 | Bacteria | 3004 |
| 200 | Ga0068858_100199035 | 3300005842 | Bacteria | 1894 |
| 201 | Ga0068858_100295430 | 3300005842 | Bacteria | 1545 |
| 202 | Ga0068858_101413991 | 3300005842 | Unclassified | 685 |
| 203 | Ga0068860_100009177 | 3300005843 | Bacteria | 9831 |
| 204 | Ga0068860_100016950 | 3300005843 | Bacteria | 7101 |
| 205 | Ga0068860_100229107 | 3300005843 | Bacteria | 1805 |
| 206 | Ga0068860_101102990 | 3300005843 | Bacteria | 813 |
| 207 | Ga0068860_101134403 | 3300005843 | Bacteria | 801 |
| 208 | Ga0068860_101290623 | 3300005843 | Bacteria | 751 |
| 209 | Ga0068862_100243607 | 3300005844 | Bacteria | 1636 |
| 210 | Ga0068862_100392611 | 3300005844 | Bacteria | 1296 |
| 211 | Ga0068862_100422531 | 3300005844 | Unclassified | 1251 |
| 212 | Ga0068862_100450488 | 3300005844 | Bacteria | 1213 |
| 213 | Ga0068862_100562815 | 3300005844 | Bacteria | 1090 |
| 214 | Ga0068862_101363684 | 3300005844 | Unclassified | 712 |
| 215 | Ga0068862_102129901 | 3300005844 | Unclassified | 572 |
| 216 | Ga0081539_10037553 | 3300005985 | Bacteria | 2884 |
| 217 | Ga0070717_10875988 | 3300006028 | Unclassified | 817 |
| 218 | Ga0070716_100241286 | 3300006173 | Bacteria | 1226 |
| 219 | Ga0097621_100127563 | 3300006237 | Bacteria | 2162 |
| 220 | Ga0097621_100287792 | 3300006237 | Bacteria | 1448 |
| 221 | Ga0097621_100548367 | 3300006237 | Bacteria | 1052 |
| 222 | Ga0097621_100609324 | 3300006237 | Bacteria | 999 |
| 223 | Ga0097621_100956602 | 3300006237 | Unclassified | 800 |
| 224 | Ga0097621_101130457 | 3300006237 | Bacteria | 736 |
| 225 | Ga0097621_101997225 | 3300006237 | Bacteria | 554 |
| 226 | Ga0068871_100008125 | 3300006358 | Bacteria | 7533 |
| 227 | Ga0068871_100115364 | 3300006358 | Bacteria | 2264 |
| 228 | Ga0068871_100373085 | 3300006358 | Bacteria | 1266 |
| 229 | Ga0068871_101195234 | 3300006358 | Bacteria | 713 |
| 230 | Ga0068871_101237401 | 3300006358 | Bacteria | 701 |
| 231 | Ga0068871_101300818 | 3300006358 | Bacteria | 684 |
| 232 | Ga0075428_100377095 | 3300006844 | Bacteria | 1521 |
| 233 | Ga0075428_100770751 | 3300006844 | Bacteria | 1023 |
| 234 | Ga0075430_100722336 | 3300006846 | Bacteria | 821 |
| 235 | Ga0075431_100623903 | 3300006847 | Bacteria | 1060 |
| 236 | Ga0075433_10005479 | 3300006852 | Bacteria | 9971 |
| 237 | Ga0075434_100035645 | 3300006871 | Bacteria | 4919 |
| 238 | Ga0075434_100493857 | 3300006871 | Bacteria | 1245 |
| 239 | Ga0075434_100697476 | 3300006871 | Bacteria | 1033 |
| 240 | Ga0068865_100004385 | 3300006881 | Bacteria | 8503 |
| 241 | Ga0068865_100064563 | 3300006881 | Bacteria | 2577 |
| 242 | Ga0068865_100196696 | 3300006881 | Bacteria | 1563 |
| 243 | Ga0097620_100003068 | 3300006931 | Bacteria | 16938 |
| 244 | Ga0097620_100047278 | 3300006931 | Bacteria | 4323 |
| 245 | Ga0097620_100049000 | 3300006931 | Bacteria | 4243 |
| 246 | Ga0097620_100105874 | 3300006931 | Bacteria | 2872 |
| 247 | Ga0097620_100150211 | 3300006931 | Bacteria | 2405 |
| 248 | Ga0097620_100175519 | 3300006931 | Bacteria | 2224 |
| 249 | Ga0097620_100365666 | 3300006931 | Bacteria | 1538 |
| 250 | Ga0097620_100990869 | 3300006931 | Bacteria | 923 |
| 251 | Ga0097620_101222151 | 3300006931 | Unclassified | 828 |
| 252 | Ga0075435_100055957 | 3300007076 | Bacteria | 3188 |
| 253 | Ga0105240_10001066 | 3300009093 | Bacteria | 48453 |
| 254 | Ga0105240_10035462 | 3300009093 | Bacteria | 6428 |
| 255 | Ga0105240_10323247 | 3300009093 | Bacteria | 1758 |
| 256 | Ga0105240_10673222 | 3300009093 | Bacteria | 1132 |
| 257 | Ga0105240_10871965 | 3300009093 | Bacteria | 970 |
| 258 | Ga0105240_12731157 | 3300009093 | Bacteria | 509 |
| 259 | Ga0111539_12463489 | 3300009094 | Unclassified | 604 |
| 260 | Ga0105245_10157482 | 3300009098 | Bacteria | 2152 |
| 261 | Ga0105245_10412452 | 3300009098 | Bacteria | 1352 |
| 262 | Ga0105245_10772752 | 3300009098 | Unclassified | 997 |
| 263 | Ga0105245_11232190 | 3300009098 | Bacteria | 796 |
| 264 | Ga0105245_11819394 | 3300009098 | Unclassified | 662 |
| 265 | Ga0105245_13259275 | 3300009098 | Bacteria | 503 |
| 266 | Ga0105247_10080002 | 3300009101 | Bacteria | 2057 |
| 267 | Ga0105247_10808752 | 3300009101 | Unclassified | 716 |
| 268 | Ga0114129_10381143 | 3300009147 | Bacteria | 1862 |
| 269 | Ga0114129_12319367 | 3300009147 | Unclassified | 644 |
| 270 | Ga0105241_10019053 | 3300009174 | Bacteria | 5061 |
| 271 | Ga0105241_11976234 | 3300009174 | Unclassified | 573 |
| 272 | Ga0105248_10010111 | 3300009177 | Bacteria | 10392 |
| 273 | Ga0105248_10048578 | 3300009177 | Bacteria | 4760 |
| 274 | Ga0105248_10264347 | 3300009177 | Bacteria | 1937 |
| 275 | Ga0105248_10349748 | 3300009177 | Unclassified | 1664 |
| 276 | Ga0105248_10653594 | 3300009177 | Bacteria | 1186 |
| 277 | Ga0105248_10810777 | 3300009177 | Bacteria | 1056 |
| 278 | Ga0105237_10000487 | 3300009545 | Bacteria | 56564 |
| 279 | Ga0105237_10030239 | 3300009545 | Bacteria | 5503 |
| 280 | Ga0105237_11688290 | 3300009545 | Bacteria | 641 |
| 281 | Ga0105238_10009941 | 3300009551 | Bacteria | 9540 |
| 282 | Ga0105238_10044849 | 3300009551 | Bacteria | 4468 |
| 283 | Ga0105238_10070080 | 3300009551 | Bacteria | 3506 |
| 284 | Ga0105238_10098350 | 3300009551 | Bacteria | 2910 |
| 285 | Ga0105238_10144595 | 3300009551 | Bacteria | 2354 |
| 286 | Ga0105249_10153983 | 3300009553 | Bacteria | 2216 |
| 287 | Ga0105249_10216348 | 3300009553 | Bacteria | 1883 |
| 288 | Ga0105249_10330255 | 3300009553 | Bacteria | 1538 |
| 289 | Ga0105239_10017865 | 3300010375 | Bacteria | 7845 |
| 290 | Ga0105239_10183050 | 3300010375 | Bacteria | 2344 |
| 291 | Ga0105239_11627828 | 3300010375 | Bacteria | 747 |
| 292 | Ga0105239_11692414 | 3300010375 | Unclassified | 732 |
| 293 | Ga0105246_10128605 | 3300011119 | Bacteria | 1888 |
| 294 | Ga0105246_10299425 | 3300011119 | Bacteria | 1298 |
| 295 | Ga0105246_11961239 | 3300011119 | Bacteria | 564 |
| 296 | Ga0105246_12417959 | 3300011119 | Bacteria | 516 |
| 297 | Ga0157317_1003088 | 3300012475 | Bacteria | 1020 |
| 298 | Ga0157371_10951074 | 3300013102 | Unclassified | 653 |
| 299 | Ga0157370_10047891 | 3300013104 | Bacteria | 4096 |
| 300 | Ga0157370_11036315 | 3300013104 | Bacteria | 742 |
| 301 | Ga0157369_10009417 | 3300013105 | Bacteria | 11166 |
| 302 | Ga0157369_10222272 | 3300013105 | Bacteria | 1976 |
| 303 | Ga0157374_10029373 | 3300013296 | Bacteria | 4977 |
| 304 | Ga0157374_10380858 | 3300013296 | Unclassified | 1405 |
| 305 | Ga0157374_10611992 | 3300013296 | Bacteria | 1100 |
| 306 | Ga0157378_10000033 | 3300013297 | Bacteria | 120764 |
| 307 | Ga0157378_10011995 | 3300013297 | Bacteria | 7588 |
| 308 | Ga0157378_10022574 | 3300013297 | Bacteria | 5537 |
| 309 | Ga0157378_10045984 | 3300013297 | Bacteria | 3880 |
| 310 | Ga0157378_10061661 | 3300013297 | Bacteria | 3348 |
| 311 | Ga0157378_10828810 | 3300013297 | Unclassified | 952 |
| 312 | Ga0157378_11373149 | 3300013297 | Bacteria | 749 |
| 313 | Ga0163162_10051655 | 3300013306 | Bacteria | 4125 |
| 314 | Ga0163162_10072772 | 3300013306 | Bacteria | 3492 |
| 315 | Ga0163162_10095595 | 3300013306 | Bacteria | 3058 |
| 316 | Ga0163162_10104702 | 3300013306 | Bacteria | 2924 |
| 317 | Ga0163162_10178520 | 3300013306 | Bacteria | 2249 |
| 318 | Ga0163162_10217872 | 3300013306 | Bacteria | 2039 |
| 319 | Ga0157372_11080464 | 3300013307 | Bacteria | 928 |
| 320 | Ga0157372_11181710 | 3300013307 | Bacteria | 884 |
| 321 | Ga0157375_10244877 | 3300013308 | Bacteria | 1953 |
| 322 | Ga0157375_10260369 | 3300013308 | Bacteria | 1896 |
| 323 | Ga0157375_10602218 | 3300013308 | Unclassified | 1258 |
| 324 | Ga0157375_10654026 | 3300013308 | Bacteria | 1207 |
| 325 | Ga0157375_11199895 | 3300013308 | Unclassified | 890 |
| 326 | Ga0163163_10000117 | 3300014325 | Bacteria | 84938 |
| 327 | Ga0163163_10005924 | 3300014325 | Bacteria | 10637 |
| 328 | Ga0163163_10006992 | 3300014325 | Bacteria | 9916 |
| 329 | Ga0163163_10041419 | 3300014325 | Bacteria | 4503 |
| 330 | Ga0163163_10243111 | 3300014325 | Bacteria | 1850 |
| 331 | Ga0163163_10771994 | 3300014325 | Bacteria | 1024 |
| 332 | Ga0157380_10213542 | 3300014326 | Bacteria | 1721 |
| 333 | Ga0157380_11012657 | 3300014326 | Bacteria | 865 |
| 334 | Ga0157380_11186419 | 3300014326 | Unclassified | 806 |
| 335 | Ga0182008_10259483 | 3300014497 | Bacteria | 898 |
| 336 | Ga0157379_10002783 | 3300014968 | Bacteria | 14745 |
| 337 | Ga0157379_10005585 | 3300014968 | Bacteria | 10808 |
| 338 | Ga0157379_10015311 | 3300014968 | Bacteria | 6727 |
| 339 | Ga0157379_10443109 | 3300014968 | Unclassified | 1198 |
| 340 | Ga0157379_11152369 | 3300014968 | Bacteria | 744 |
| 341 | Ga0157379_12412239 | 3300014968 | Unclassified | 525 |
| 342 | Ga0157379_12586060 | 3300014968 | Bacteria | 508 |
| 343 | Ga0157376_10054232 | 3300014969 | Bacteria | 3341 |
| 344 | Ga0157376_10054301 | 3300014969 | Bacteria | 3340 |
| 345 | Ga0157376_12183153 | 3300014969 | Bacteria | 592 |
| 346 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 347 | Ga0163161_10101972 | 3300017792 | Bacteria | 2137 |
| 348 | Ga0163161_11662717 | 3300017792 | Bacteria | 565 |
| 349 | Ga0163161_11909107 | 3300017792 | Bacteria | 528 |
| 350 | Ga0197907_10520165 | 3300020069 | Bacteria | 1534 |
| 351 | Ga0206356_11766869 | 3300020070 | Bacteria | 2774 |
| 352 | Ga0224712_10179286 | 3300022467 | Bacteria | 954 |
| 353 | Ga0207425_1035183 | 3300025245 | Bacteria | 979 |
| 354 | Ga0209026_1000281 | 3300025250 | Bacteria | 58797 |
| 355 | Ga0209759_1005553 | 3300025256 | Bacteria | 4389 |
| 356 | Ga0209759_1012586 | 3300025256 | Bacteria | 2335 |
| 357 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 358 | Ga0209565_1012074 | 3300025263 | Bacteria | 2075 |
| 359 | Ga0209455_1000465 | 3300025272 | Bacteria | 30599 |
| 360 | Ga0209673_1000027 | 3300025273 | Bacteria | 360561 |
| 361 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 362 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 363 | Ga0209025_1029411 | 3300025294 | Bacteria | 2658 |
| 364 | Ga0209564_1000050 | 3300025295 | Bacteria | 360560 |
| 365 | Ga0209758_1019657 | 3300025297 | Bacteria | 3243 |
| 366 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 367 | Ga0209257_1000263 | 3300025304 | Bacteria | 120530 |
| 368 | Ga0209257_1000645 | 3300025304 | Bacteria | 55704 |
| 369 | Ga0207697_10145710 | 3300025315 | Bacteria | 1029 |
| 370 | Ga0207697_10162692 | 3300025315 | Bacteria | 974 |
| 371 | Ga0207656_10016671 | 3300025321 | Unclassified | 2864 |
| 372 | Ga0207656_10078173 | 3300025321 | Bacteria | 1482 |
| 373 | Ga0207656_10130747 | 3300025321 | Bacteria | 1176 |
| 374 | Ga0207682_10000299 | 3300025893 | Bacteria | 22382 |
| 375 | Ga0207688_10515534 | 3300025901 | Bacteria | 750 |
| 376 | Ga0207680_10000114 | 3300025903 | Bacteria | 37044 |
| 377 | Ga0207680_10019316 | 3300025903 | Bacteria | 3642 |
| 378 | Ga0207680_10161290 | 3300025903 | Bacteria | 1504 |
| 379 | Ga0207680_10193719 | 3300025903 | Bacteria | 1381 |
| 380 | Ga0207680_10256724 | 3300025903 | Bacteria | 1209 |
| 381 | Ga0207647_10000157 | 3300025904 | Bacteria | 53737 |
| 382 | Ga0207647_10043861 | 3300025904 | Bacteria | 2796 |
| 383 | Ga0207645_10001423 | 3300025907 | Bacteria | 19581 |
| 384 | Ga0207645_10020545 | 3300025907 | Bacteria | 4321 |
| 385 | Ga0207645_10090476 | 3300025907 | Bacteria | 1968 |
| 386 | Ga0207645_10250888 | 3300025907 | Bacteria | 1171 |
| 387 | Ga0207645_10393304 | 3300025907 | Bacteria | 932 |
| 388 | Ga0207645_10619758 | 3300025907 | Bacteria | 735 |
| 389 | Ga0207643_10019292 | 3300025908 | Bacteria | 3737 |
| 390 | Ga0207643_10306605 | 3300025908 | Bacteria | 989 |
| 391 | Ga0207705_10113978 | 3300025909 | Bacteria | 2000 |
| 392 | Ga0207684_10099567 | 3300025910 | Bacteria | 2483 |
| 393 | Ga0207684_10283987 | 3300025910 | Bacteria | 1427 |
| 394 | Ga0207654_10049702 | 3300025911 | Bacteria | 2407 |
| 395 | Ga0207707_10000018 | 3300025912 | Bacteria | 215518 |
| 396 | Ga0207695_10013067 | 3300025913 | Bacteria | 9912 |
| 397 | Ga0207695_10091521 | 3300025913 | Bacteria | 3055 |
| 398 | Ga0207695_10110526 | 3300025913 | Bacteria | 2728 |
| 399 | Ga0207671_10000374 | 3300025914 | Bacteria | 63535 |
| 400 | Ga0207671_10082488 | 3300025914 | Bacteria | 2413 |
| 401 | Ga0207671_11541317 | 3300025914 | Unclassified | 512 |
| 402 | Ga0207649_10260924 | 3300025920 | Bacteria | 1252 |
| 403 | Ga0207649_10349068 | 3300025920 | Bacteria | 1094 |
| 404 | Ga0207646_10790555 | 3300025922 | Bacteria | 845 |
| 405 | Ga0207681_10202988 | 3300025923 | Bacteria | 1523 |
| 406 | Ga0207681_10273319 | 3300025923 | Bacteria | 1327 |
| 407 | Ga0207681_10497716 | 3300025923 | Bacteria | 997 |
| 408 | Ga0207694_10011157 | 3300025924 | Bacteria | 6783 |
| 409 | Ga0207694_10039101 | 3300025924 | Bacteria | 3649 |
| 410 | Ga0207694_10218021 | 3300025924 | Bacteria | 1556 |
| 411 | Ga0207650_10039577 | 3300025925 | Bacteria | 3445 |
| 412 | Ga0207650_10077220 | 3300025925 | Bacteria | 2517 |
| 413 | Ga0207650_10204497 | 3300025925 | Bacteria | 1583 |
| 414 | Ga0207650_10255395 | 3300025925 | Bacteria | 1420 |
| 415 | Ga0207650_10485098 | 3300025925 | Unclassified | 1032 |
| 416 | Ga0207650_10608520 | 3300025925 | Bacteria | 919 |
| 417 | Ga0207659_10020422 | 3300025926 | Bacteria | 4378 |
| 418 | Ga0207659_10890078 | 3300025926 | Bacteria | 765 |
| 419 | Ga0207687_10299892 | 3300025927 | Bacteria | 1294 |
| 420 | Ga0207687_10527170 | 3300025927 | Bacteria | 989 |
| 421 | Ga0207687_10932431 | 3300025927 | Unclassified | 743 |
| 422 | Ga0207687_11165409 | 3300025927 | Unclassified | 662 |
| 423 | Ga0207644_10018576 | 3300025931 | Bacteria | 4707 |
| 424 | Ga0207644_10027550 | 3300025931 | Bacteria | 3926 |
| 425 | Ga0207644_10107214 | 3300025931 | Bacteria | 2107 |
| 426 | Ga0207644_10435158 | 3300025931 | Bacteria | 1076 |
| 427 | Ga0207690_10834033 | 3300025932 | Bacteria | 763 |
| 428 | Ga0207706_10004507 | 3300025933 | Bacteria | 13081 |
| 429 | Ga0207706_10137643 | 3300025933 | Bacteria | 2148 |
| 430 | Ga0207706_10512192 | 3300025933 | Bacteria | 1035 |
| 431 | Ga0207670_10211281 | 3300025936 | Bacteria | 1480 |
| 432 | Ga0207669_10007022 | 3300025937 | Bacteria | 5181 |
| 433 | Ga0207669_10115575 | 3300025937 | Bacteria | 1809 |
| 434 | Ga0207704_10036864 | 3300025938 | Bacteria | 2818 |
| 435 | Ga0207704_10142373 | 3300025938 | Bacteria | 1679 |
| 436 | Ga0207704_10169944 | 3300025938 | Bacteria | 1562 |
| 437 | Ga0207704_10355351 | 3300025938 | Bacteria | 1142 |
| 438 | Ga0207665_10438044 | 3300025939 | Bacteria | 1001 |
| 439 | Ga0207691_10000016 | 3300025940 | Bacteria | 141024 |
| 440 | Ga0207691_10008755 | 3300025940 | Bacteria | 9706 |
| 441 | Ga0207691_10146131 | 3300025940 | Bacteria | 2081 |
| 442 | Ga0207711_10029362 | 3300025941 | Bacteria | 4638 |
| 443 | Ga0207711_10114480 | 3300025941 | Bacteria | 2402 |
| 444 | Ga0207711_10724561 | 3300025941 | Bacteria | 927 |
| 445 | Ga0207711_11290281 | 3300025941 | Bacteria | 672 |
| 446 | Ga0207689_10003539 | 3300025942 | Bacteria | 14278 |
| 447 | Ga0207689_10025878 | 3300025942 | Bacteria | 4915 |
| 448 | Ga0207689_10031723 | 3300025942 | Bacteria | 4396 |
| 449 | Ga0207689_10218767 | 3300025942 | Unclassified | 1573 |
| 450 | Ga0207689_10360605 | 3300025942 | Bacteria | 1209 |
| 451 | Ga0207689_10723281 | 3300025942 | Bacteria | 840 |
| 452 | Ga0207689_10951373 | 3300025942 | Bacteria | 725 |
| 453 | Ga0207667_10063574 | 3300025949 | Bacteria | 3856 |
| 454 | Ga0207667_10106036 | 3300025949 | Bacteria | 2899 |
| 455 | Ga0207667_10183999 | 3300025949 | Bacteria | 2145 |
| 456 | Ga0207667_10300789 | 3300025949 | Bacteria | 1639 |
| 457 | Ga0207667_11681093 | 3300025949 | Unclassified | 602 |
| 458 | Ga0207651_10011379 | 3300025960 | Bacteria | 4980 |
| 459 | Ga0207651_10037484 | 3300025960 | Bacteria | 3177 |
| 460 | Ga0207651_10185054 | 3300025960 | Bacteria | 1656 |
| 461 | Ga0207651_10323798 | 3300025960 | Unclassified | 1289 |
| 462 | Ga0207712_10000197 | 3300025961 | Bacteria | 61066 |
| 463 | Ga0207712_10093749 | 3300025961 | Bacteria | 2216 |
| 464 | Ga0207712_10168580 | 3300025961 | Bacteria | 1709 |
| 465 | Ga0207668_10009432 | 3300025972 | Bacteria | 5852 |
| 466 | Ga0207668_10012378 | 3300025972 | Bacteria | 5222 |
| 467 | Ga0207668_10030335 | 3300025972 | Bacteria | 3552 |
| 468 | Ga0207668_10053138 | 3300025972 | Bacteria | 2806 |
| 469 | Ga0207668_10329700 | 3300025972 | Bacteria | 1269 |
| 470 | Ga0207668_10344710 | 3300025972 | Bacteria | 1244 |
| 471 | Ga0207668_10618915 | 3300025972 | Bacteria | 945 |
| 472 | Ga0207668_10693820 | 3300025972 | Unclassified | 894 |
| 473 | Ga0207668_12013296 | 3300025972 | Unclassified | 520 |
| 474 | Ga0207640_10004947 | 3300025981 | Bacteria | 7242 |
| 475 | Ga0207640_10971458 | 3300025981 | Bacteria | 746 |
| 476 | Ga0207658_10022594 | 3300025986 | Bacteria | 4381 |
| 477 | Ga0207658_10181013 | 3300025986 | Bacteria | 1744 |
| 478 | Ga0207658_10219610 | 3300025986 | Bacteria | 1598 |
| 479 | Ga0207658_10476646 | 3300025986 | Bacteria | 1108 |
| 480 | Ga0207658_10685626 | 3300025986 | Bacteria | 925 |
| 481 | Ga0207658_11537611 | 3300025986 | Bacteria | 608 |
| 482 | Ga0207658_11543487 | 3300025986 | Unclassified | 607 |
| 483 | Ga0207677_10021067 | 3300026023 | Bacteria | 3976 |
| 484 | Ga0207677_10151160 | 3300026023 | Bacteria | 1792 |
| 485 | Ga0207677_10189469 | 3300026023 | Bacteria | 1625 |
| 486 | Ga0207677_10667186 | 3300026023 | Bacteria | 919 |
| 487 | Ga0207677_11190633 | 3300026023 | Bacteria | 697 |
| 488 | Ga0207703_10040161 | 3300026035 | Bacteria | 3743 |
| 489 | Ga0207703_10082844 | 3300026035 | Bacteria | 2678 |
| 490 | Ga0207703_10436988 | 3300026035 | Bacteria | 1220 |
| 491 | Ga0207703_10886051 | 3300026035 | Bacteria | 854 |
| 492 | Ga0207703_11093359 | 3300026035 | Unclassified | 766 |
| 493 | Ga0207703_11241707 | 3300026035 | Bacteria | 716 |
| 494 | Ga0207639_10000446 | 3300026041 | Bacteria | 28443 |
| 495 | Ga0207639_10025923 | 3300026041 | Bacteria | 4255 |
| 496 | Ga0207639_11210947 | 3300026041 | Unclassified | 709 |
| 497 | Ga0207678_10001892 | 3300026067 | Bacteria | 19098 |
| 498 | Ga0207678_10004226 | 3300026067 | Bacteria | 12875 |
| 499 | Ga0207678_10067389 | 3300026067 | Bacteria | 3073 |
| 500 | Ga0207678_11442678 | 3300026067 | Unclassified | 608 |
| 501 | Ga0207702_10000167 | 3300026078 | Bacteria | 78662 |
| 502 | Ga0207702_10175999 | 3300026078 | Bacteria | 1966 |
| 503 | Ga0207702_10249895 | 3300026078 | Bacteria | 1665 |
| 504 | Ga0207641_10016203 | 3300026088 | Bacteria | 6104 |
| 505 | Ga0207641_10021701 | 3300026088 | Bacteria | 5277 |
| 506 | Ga0207641_10195580 | 3300026088 | Bacteria | 1861 |
| 507 | Ga0207641_10207363 | 3300026088 | Bacteria | 1811 |
| 508 | Ga0207641_10218331 | 3300026088 | Bacteria | 1767 |
| 509 | Ga0207641_10352228 | 3300026088 | Bacteria | 1403 |
| 510 | Ga0207641_10810171 | 3300026088 | Unclassified | 927 |
| 511 | Ga0207648_10003215 | 3300026089 | Bacteria | 17203 |
| 512 | Ga0207648_10008770 | 3300026089 | Bacteria | 9745 |
| 513 | Ga0207648_10046725 | 3300026089 | Bacteria | 3796 |
| 514 | Ga0207648_10481243 | 3300026089 | Unclassified | 1134 |
| 515 | Ga0207676_10012675 | 3300026095 | Bacteria | 6047 |
| 516 | Ga0207676_10025226 | 3300026095 | Bacteria | 4411 |
| 517 | Ga0207676_10028606 | 3300026095 | Bacteria | 4165 |
| 518 | Ga0207676_10312254 | 3300026095 | Bacteria | 1440 |
| 519 | Ga0207674_10030180 | 3300026116 | Bacteria | 5702 |
| 520 | Ga0207674_10350045 | 3300026116 | Bacteria | 1428 |
| 521 | Ga0207674_10699498 | 3300026116 | Bacteria | 979 |
| 522 | Ga0207675_100007990 | 3300026118 | Bacteria | 9971 |
| 523 | Ga0207675_100052782 | 3300026118 | Bacteria | 3793 |
| 524 | Ga0207675_100184112 | 3300026118 | Bacteria | 2001 |
| 525 | Ga0207683_10000057 | 3300026121 | Bacteria | 84479 |
| 526 | Ga0207683_10047376 | 3300026121 | Bacteria | 3764 |
| 527 | Ga0207698_10018386 | 3300026142 | Bacteria | 4761 |
| 528 | Ga0207698_10733936 | 3300026142 | Unclassified | 985 |
| 529 | Ga0207698_11818103 | 3300026142 | Bacteria | 624 |
| 530 | Ga0209973_1011521 | 3300027252 | Bacteria | 1062 |
| 531 | Ga0209984_1002123 | 3300027424 | Bacteria | 2199 |
| 532 | Ga0209982_1002754 | 3300027552 | Bacteria | 2471 |
| 533 | Ga0209983_1024080 | 3300027665 | Bacteria | 1281 |
| 534 | Ga0209971_1063343 | 3300027682 | Bacteria | 896 |
| 535 | Ga0209974_10024792 | 3300027876 | Bacteria | 1984 |
| 536 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 537 | Ga0268266_10003576 | 3300028379 | Bacteria | 15407 |
| 538 | Ga0268266_10515650 | 3300028379 | Bacteria | 1143 |
| 539 | Ga0268265_10087070 | 3300028380 | Bacteria | 2484 |
| 540 | Ga0268265_10116638 | 3300028380 | Bacteria | 2191 |
| 541 | Ga0268265_10415830 | 3300028380 | Bacteria | 1247 |
| 542 | Ga0268265_11873837 | 3300028380 | Unclassified | 606 |
| 543 | Ga0268265_12065845 | 3300028380 | Unclassified | 577 |
| 544 | Ga0268264_10014295 | 3300028381 | Bacteria | 6527 |
| 545 | Ga0268264_10074750 | 3300028381 | Bacteria | 2879 |
| 546 | Ga0268264_10290925 | 3300028381 | Bacteria | 1534 |
| 547 | Ga0268264_10395170 | 3300028381 | Bacteria | 1327 |
| 548 | Ga0268264_11178153 | 3300028381 | Bacteria | 775 |
| 549 | Ga0268264_11428742 | 3300028381 | Bacteria | 702 |
| 550 | Ga0268264_11592312 | 3300028381 | Unclassified | 664 |
| 551 | Ga0307515_10525391 | 3300028794 | Bacteria | 793 |
| 552 | Ga0307513_10083926 | 3300031456 | Bacteria | 3274 |
| 553 | Ga0307513_10244622 | 3300031456 | Bacteria | 1596 |
| 554 | Ga0307408_100016229 | 3300031548 | Bacteria | 4967 |
| 555 | Ga0316576_10002379 | 3300031727 | Bacteria | 10699 |
| 556 | Ga0307405_10096808 | 3300031731 | Bacteria | 1969 |
| 557 | Ga0307405_10902743 | 3300031731 | Unclassified | 747 |
| 558 | Ga0307413_10558983 | 3300031824 | Bacteria | 929 |
| 559 | Ga0307413_10805747 | 3300031824 | Bacteria | 790 |
| 560 | Ga0307406_10001746 | 3300031901 | Bacteria | 11913 |
| 561 | Ga0307406_10101260 | 3300031901 | Bacteria | 1963 |
| 562 | Ga0307406_10157995 | 3300031901 | Bacteria | 1626 |
| 563 | Ga0307412_10238975 | 3300031911 | Bacteria | 1404 |
| 564 | Ga0307412_10253067 | 3300031911 | Bacteria | 1369 |
| 565 | Ga0307414_10040337 | 3300032004 | Bacteria | 3152 |
| 566 | Ga0307414_10046276 | 3300032004 | Bacteria | 2985 |
| 567 | Ga0307414_10138848 | 3300032004 | Bacteria | 1899 |
| 568 | Ga0307414_11683813 | 3300032004 | Bacteria | 591 |
| 569 | Ga0307411_10717449 | 3300032005 | Bacteria | 873 |
| 570 | Ga0373928_0209141 | 3300035084 | Unclassified | 566 |
| 571 | Ga0373945_0573170 | 3300035116 | Unclassified | 508 |
| 572 | Ga0373956_0300887 | 3300035119 | Bacteria | 764 |
| 573 | Ga0373955_0644667 | 3300035172 | Bacteria | 649 |
| 574 | Ga0373931_0084133 | 3300035691 | Bacteria | 1761 |
| 575 | Ga0373931_0905685 | 3300035691 | Unclassified | 593 |
| 576 | Ga0373933_0065213 | 3300035724 | Bacteria | 2205 |
| 577 | Ga0373937_0268844 | 3300036401 | Bacteria | 1609 |
| 578 | Ga0316584_0045361 | 3300036712 | Bacteria | 3281 |
| 579 | Ga0373925_0526797 | 3300037068 | Bacteria | 971 |
| 580 | Ga0395900_0000439 | 3300037418 | Bacteria | 59811 |
| 581 | Ga0395900_0003253 | 3300037418 | Bacteria | 17593 |
| 582 | Ga0395898_0005858 | 3300037466 | Bacteria | 13218 |
| 583 | Ga0395901_0041616 | 3300038443 | Bacteria | 4763 |
| 584 | Ga0436365_0043459 | 3300039437 | Bacteria | 2669 |
| 585 | Ga0439436_0005922 | 3300041404 | Bacteria | 3749 |
| 586 | Ga0439447_003163 | 3300041407 | Bacteria | 5865 |
| 587 | Ga0439466_0072802 | 3300041411 | Bacteria | 1092 |
| 588 | Ga0439465_0001078 | 3300041413 | Bacteria | 8729 |
| 589 | Ga0451791_0513229 | 3300041451 | Bacteria | 1641 |
| 590 | Ga0451791_1604906 | 3300041451 | Bacteria | 1519 |
| 591 | Ga0451793_1463101 | 3300041452 | Bacteria | 640 |
| 592 | Ga0451797_0751603 | 3300041453 | Bacteria | 1014 |
| 593 | Ga0451795_0235484 | 3300041456 | Bacteria | 967 |
| 594 | Ga0451800_0681495 | 3300041459 | Bacteria | 672 |
| 595 | Ga0451807_0106323 | 3300041486 | Bacteria | 627 |
| 596 | Ga0451837_1152633 | 3300041494 | Bacteria | 621 |
| 597 | Ga0451837_1688733 | 3300041494 | Bacteria | 1317 |
| 598 | Ga0451839_1393893 | 3300041496 | Unclassified | 500 |
| 599 | Ga0451841_0210267 | 3300041498 | Bacteria | 916 |
| 600 | Ga0451841_0364395 | 3300041498 | Bacteria | 1007 |
| 601 | Ga0451843_0478485 | 3300041509 | Bacteria | 1443 |
| 602 | Ga0451843_1333241 | 3300041509 | Bacteria | 2026 |
| 603 | Ga0451843_1594455 | 3300041509 | Unclassified | 687 |
| 604 | Ga0451855_1849199 | 3300041511 | Bacteria | 760 |
| 605 | Ga0451853_3160813 | 3300041512 | Bacteria | 504 |
| 606 | Ga0439433_0030552 | 3300041999 | Bacteria | 1232 |
| 607 | Ga0439432_076248 | 3300042006 | Bacteria | 1018 |
| 608 | Ga0439449_0070066 | 3300042007 | Bacteria | 1292 |
| 609 | Ga0439449_0137246 | 3300042007 | Bacteria | 909 |
| 610 | Ga0439446_0152929 | 3300042156 | Bacteria | 760 |
| 611 | Ga0439446_0280128 | 3300042156 | Unclassified | 581 |
| 612 | Ga0451577_0025346 | 3300042876 | Bacteria | 5381 |
| 613 | Ga0453683_1027986 | 3300044673 | Unclassified | 548 |
| 614 | Ga0495616_0063888 | 3300046513 | Bacteria | 1798 |
| 615 | Ga0495643_0085181 | 3300046522 | Bacteria | 1639 |
| 616 | Ga0495663_0011527 | 3300046525 | Bacteria | 2459 |
| 617 | Ga0495656_0006617 | 3300046615 | Bacteria | 4068 |
| 618 | Ga0495668_0000625 | 3300046616 | Bacteria | 42737 |
| 619 | Ga0495647_0411525 | 3300046681 | Unclassified | 622 |
| 620 | Ga0495636_0005345 | 3300047318 | Bacteria | 5046 |
| 621 | Ga0495636_0302337 | 3300047318 | Bacteria | 749 |
| 622 | Ga0496101_0484415 | 3300048904 | Bacteria | 977 |
| 623 | Ga0496102_0035311 | 3300048905 | Bacteria | 4500 |
| 624 | Ga0496102_1065864 | 3300048905 | Bacteria | 728 |
| 625 | Ga0496103_0174255 | 3300048906 | Bacteria | 1382 |
| 626 | Ga0496104_1125273 | 3300048907 | Bacteria | 689 |
| 627 | Ga0496106_0175677 | 3300048909 | Bacteria | 1699 |
| 628 | Ga0496108_0502573 | 3300048911 | Bacteria | 1059 |
| 629 | Ga0496109_0096664 | 3300048912 | Bacteria | 2737 |
| 630 | Ga0496109_0711845 | 3300048912 | Bacteria | 942 |
| 631 | Ga0496109_1878381 | 3300048912 | Unclassified | 531 |
| 632 | Ga0496110_0966418 | 3300048913 | Bacteria | 759 |
| 633 | Ga0496112_0216305 | 3300048915 | Bacteria | 1873 |
| 634 | Ga0496114_0207161 | 3300048917 | Bacteria | 1719 |
| 635 | Ga0496115_0631634 | 3300048918 | Bacteria | 848 |
| 636 | Ga0496121_0011637 | 3300048924 | Bacteria | 9729 |
| 637 | Ga0496122_0025177 | 3300048925 | Bacteria | 5178 |
| 638 | Ga0496123_0004944 | 3300048926 | Bacteria | 13665 |
| 639 | Ga0496126_0232656 | 3300048929 | Bacteria | 1543 |
| 640 | Ga0501034_1668579 | 3300049571 | Bacteria | 510 |
| 641 | Ga0501037_0067506 | 3300049573 | Bacteria | 2604 |
| 642 | Ga0501047_0046204 | 3300049581 | Bacteria | 4208 |
| 643 | Ga0501068_0275321 | 3300049584 | Unclassified | 1075 |
| 644 | Ga0501069_0061599 | 3300049585 | Bacteria | 2095 |
| 645 | Ga0501070_0014516 | 3300049586 | Bacteria | 6627 |
| 646 | Ga0501070_0345811 | 3300049586 | Bacteria | 1207 |
| 647 | Ga0501070_1384070 | 3300049586 | Bacteria | 535 |
| 648 | Ga0501071_0000973 | 3300049587 | Bacteria | 15658 |
| 649 | Ga0501071_0591566 | 3300049587 | Unclassified | 853 |
| 650 | Ga0501073_0001354 | 3300049589 | Bacteria | 18080 |
| 651 | Ga0501074_0006572 | 3300049590 | Bacteria | 8406 |
| 652 | Ga0501076_0256294 | 3300049592 | Bacteria | 1432 |
| 653 | Ga0501080_0079514 | 3300049742 | Bacteria | 3048 |
| 654 | Ga0501275_000722 | 3300049772 | Bacteria | 3607 |
| 655 | Ga0501276_018049 | 3300049773 | Bacteria | 654 |
| 656 | Ga0501035_0272430 | 3300049822 | Bacteria | 1432 |
| 657 | Ga0501044_0039950 | 3300049823 | Bacteria | 4892 |
| 658 | Ga0501044_1273312 | 3300049823 | Bacteria | 602 |
| 659 | Ga0501045_0260855 | 3300049824 | Bacteria | 1290 |
| 660 | nmdc:mga05p37_2122318_c1 | 3300050507 | Unclassified | 525 |
| 661 | nmdc:mga0qj67_629425_c1 | 3300050509 | Bacteria | 857 |
| 662 | nmdc:mga0n895_39828_c1 | 3300050512 | Bacteria | 4563 |
| 663 | nmdc:mga0n895_608740_c1 | 3300050512 | Bacteria | 1094 |
| 664 | nmdc:mga0rr50_116561_c1 | 3300050513 | Bacteria | 2121 |
| 665 | nmdc:mga0a205_17083_c1 | 3300050515 | Bacteria | 6794 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10035462 | Ga0105240_100354623 | 85 |
| 2 | 3300013104 | Ga0157370_11036315 | Ga0157370_110363151 | 85 |
| 3 | 3300048925 | Ga0496122_0025177 | Ga0496122_0025177_733_1050 | 94 |
| 4 | 3300048926 | Ga0496123_0004944 | Ga0496123_0004944_1957_2274 | 94 |
| 5 | 3300005327 | Ga0070658_10721862 | Ga0070658_107218621 | 95 |
| 6 | 3300005328 | Ga0070676_10001328 | Ga0070676_100013287 | 95 |
| 7 | 3300005331 | Ga0070670_100102268 | Ga0070670_1001022683 | 95 |
| 8 | 3300005333 | Ga0070677_10001696 | Ga0070677_100016967 | 95 |
| 9 | 3300005335 | Ga0070666_10024731 | Ga0070666_100247313 | 95 |
| 10 | 3300005338 | Ga0068868_100008085 | Ga0068868_1000080855 | 95 |
| 11 | 3300005340 | Ga0070689_100999200 | Ga0070689_1009992001 | 95 |
| 12 | 3300005347 | Ga0070668_100001020 | Ga0070668_1000010205 | 95 |
| 13 | 3300005353 | Ga0070669_100039196 | Ga0070669_1000391963 | 95 |
| 14 | 3300005354 | Ga0070675_100006444 | Ga0070675_10000644411 | 95 |
| 15 | 3300005355 | Ga0070671_100009918 | Ga0070671_1000099185 | 95 |
| 16 | 3300005356 | Ga0070674_100014257 | Ga0070674_1000142575 | 95 |
| 17 | 3300005364 | Ga0070673_100009480 | Ga0070673_1000094806 | 95 |
| 18 | 3300005367 | Ga0070667_100001177 | Ga0070667_10000117714 | 95 |
| 19 | 3300005455 | Ga0070663_100006160 | Ga0070663_1000061602 | 95 |
| 20 | 3300005456 | Ga0070678_100033420 | Ga0070678_1000334201 | 95 |
| 21 | 3300005459 | Ga0068867_100066199 | Ga0068867_1000661993 | 95 |
| 22 | 3300005466 | Ga0070685_10074633 | Ga0070685_100746332 | 95 |
| 23 | 3300005539 | Ga0068853_100026450 | Ga0068853_1000264502 | 95 |
| 24 | 3300005543 | Ga0070672_100005073 | Ga0070672_1000050736 | 95 |
| 25 | 3300005548 | Ga0070665_100027210 | Ga0070665_1000272106 | 95 |
| 26 | 3300005616 | Ga0068852_100001467 | Ga0068852_10000146718 | 95 |
| 27 | 3300005617 | Ga0068859_100150214 | Ga0068859_1001502142 | 95 |
| 28 | 3300005618 | Ga0068864_100001880 | Ga0068864_1000018809 | 95 |
| 29 | 3300005719 | Ga0068861_100087413 | Ga0068861_1000874132 | 95 |
| 30 | 3300005834 | Ga0068851_10042739 | Ga0068851_100427392 | 95 |
| 31 | 3300005840 | Ga0068870_10001728 | Ga0068870_100017281 | 95 |
| 32 | 3300005841 | Ga0068863_100004156 | Ga0068863_10000415614 | 95 |
| 33 | 3300005842 | Ga0068858_100025453 | Ga0068858_1000254535 | 95 |
| 34 | 3300005843 | Ga0068860_100009177 | Ga0068860_10000917710 | 95 |
| 35 | 3300005844 | Ga0068862_102129901 | Ga0068862_1021299011 | 95 |
| 36 | 3300006358 | Ga0068871_100008125 | Ga0068871_1000081256 | 95 |
| 37 | 3300006881 | Ga0068865_100004385 | Ga0068865_1000043854 | 95 |
| 38 | 3300006931 | Ga0097620_100150211 | Ga0097620_1001502112 | 95 |
| 39 | 3300009098 | Ga0105245_11819394 | Ga0105245_118193941 | 95 |
| 40 | 3300013306 | Ga0163162_10072772 | Ga0163162_100727722 | 95 |
| 41 | 3300013308 | Ga0157375_10260369 | Ga0157375_102603691 | 95 |
| 42 | 3300014968 | Ga0157379_12412239 | Ga0157379_124122391 | 95 |
| 43 | 3300014969 | Ga0157376_10054301 | Ga0157376_100543014 | 95 |
| 44 | 3300017792 | Ga0163161_10101972 | Ga0163161_101019722 | 95 |
| 45 | 3300025315 | Ga0207697_10162692 | Ga0207697_101626921 | 95 |
| 46 | 3300025321 | Ga0207656_10078173 | Ga0207656_100781732 | 95 |
| 47 | 3300025893 | Ga0207682_10000299 | Ga0207682_100002996 | 95 |
| 48 | 3300025901 | Ga0207688_10515534 | Ga0207688_105155342 | 95 |
| 49 | 3300025903 | Ga0207680_10193719 | Ga0207680_101937192 | 95 |
| 50 | 3300025907 | Ga0207645_10001423 | Ga0207645_1000142319 | 95 |
| 51 | 3300025908 | Ga0207643_10306605 | Ga0207643_103066052 | 95 |
| 52 | 3300025925 | Ga0207650_10204497 | Ga0207650_102044971 | 95 |
| 53 | 3300025926 | Ga0207659_10020422 | Ga0207659_100204222 | 95 |
| 54 | 3300025927 | Ga0207687_11165409 | Ga0207687_111654091 | 95 |
| 55 | 3300025931 | Ga0207644_10027550 | Ga0207644_100275502 | 95 |
| 56 | 3300025933 | Ga0207706_10137643 | Ga0207706_101376432 | 95 |
| 57 | 3300025937 | Ga0207669_10007022 | Ga0207669_100070225 | 95 |
| 58 | 3300025938 | Ga0207704_10355351 | Ga0207704_103553512 | 95 |
| 59 | 3300025940 | Ga0207691_10000016 | Ga0207691_1000001651 | 95 |
| 60 | 3300025942 | Ga0207689_10025878 | Ga0207689_100258783 | 95 |
| 61 | 3300025960 | Ga0207651_10011379 | Ga0207651_100113793 | 95 |
| 62 | 3300025972 | Ga0207668_10030335 | Ga0207668_100303352 | 95 |
| 63 | 3300025986 | Ga0207658_10022594 | Ga0207658_100225942 | 95 |
| 64 | 3300026023 | Ga0207677_10021067 | Ga0207677_100210675 | 95 |
| 65 | 3300026035 | Ga0207703_10082844 | Ga0207703_100828442 | 95 |
| 66 | 3300026041 | Ga0207639_10025923 | Ga0207639_100259232 | 95 |
| 67 | 3300026067 | Ga0207678_10067389 | Ga0207678_100673894 | 95 |
| 68 | 3300026088 | Ga0207641_10021701 | Ga0207641_100217015 | 95 |
| 69 | 3300026089 | Ga0207648_10003215 | Ga0207648_100032155 | 95 |
| 70 | 3300026095 | Ga0207676_10028606 | Ga0207676_100286062 | 95 |
| 71 | 3300026118 | Ga0207675_100184112 | Ga0207675_1001841122 | 95 |
| 72 | 3300026121 | Ga0207683_10000057 | Ga0207683_1000005758 | 95 |
| 73 | 3300026142 | Ga0207698_10018386 | Ga0207698_100183863 | 95 |
| 74 | 3300028379 | Ga0268266_10003576 | Ga0268266_100035766 | 95 |
| 75 | 3300028380 | Ga0268265_11873837 | Ga0268265_118738372 | 95 |
| 76 | 3300028381 | Ga0268264_10074750 | Ga0268264_100747502 | 95 |
| 77 | 3300032005 | Ga0307411_10717449 | Ga0307411_107174492 | 98 |
| 78 | 3300006844 | Ga0075428_100770751 | Ga0075428_1007707512 | 99 |
| 79 | 3300005616 | Ga0068852_101187854 | Ga0068852_1011878541 | 100 |
| 80 | 3300026142 | Ga0207698_11818103 | Ga0207698_118181032 | 100 |
| 81 | 3300049587 | Ga0501071_0591566 | Ga0501071_0591566_239_601 | 100 |
| 82 | 3300003763 | Ga0055529_1006361 | Ga0055529_10063613 | 101 |
| 83 | 3300005337 | Ga0070682_100296212 | Ga0070682_1002962122 | 101 |
| 84 | 3300005455 | Ga0070663_100190604 | Ga0070663_1001906043 | 101 |
| 85 | 3300005563 | Ga0068855_100067920 | Ga0068855_1000679202 | 101 |
| 86 | 3300009545 | Ga0105237_10000487 | Ga0105237_1000048713 | 101 |
| 87 | 3300009551 | Ga0105238_10070080 | Ga0105238_100700803 | 101 |
| 88 | 3300020070 | Ga0206356_11766869 | Ga0206356_117668692 | 101 |
| 89 | 3300025250 | Ga0209026_1000281 | Ga0209026_100028118 | 101 |
| 90 | 3300025256 | Ga0209759_1005553 | Ga0209759_10055533 | 101 |
| 91 | 3300025256 | Ga0209759_1012586 | Ga0209759_10125863 | 101 |
| 92 | 3300025272 | Ga0209455_1000465 | Ga0209455_100046513 | 101 |
| 93 | 3300025904 | Ga0207647_10043861 | Ga0207647_100438613 | 101 |
| 94 | 3300025913 | Ga0207695_10013067 | Ga0207695_100130679 | 101 |
| 95 | 3300025914 | Ga0207671_10000374 | Ga0207671_1000037437 | 101 |
| 96 | 3300025949 | Ga0207667_10063574 | Ga0207667_100635742 | 101 |
| 97 | 3300026067 | Ga0207678_10004226 | Ga0207678_1000422612 | 101 |
| 98 | 3300026116 | Ga0207674_10699498 | Ga0207674_106994982 | 101 |
| 99 | 3300027252 | Ga0209973_1011521 | Ga0209973_10115212 | 101 |
| 100 | 3300027424 | Ga0209984_1002123 | Ga0209984_10021232 | 101 |
| 101 | 3300027552 | Ga0209982_1002754 | Ga0209982_10027542 | 101 |
| 102 | 3300027665 | Ga0209983_1024080 | Ga0209983_10240802 | 101 |
| 103 | 3300027682 | Ga0209971_1063343 | Ga0209971_10633432 | 101 |
| 104 | 3300027876 | Ga0209974_10024792 | Ga0209974_100247923 | 101 |
| 105 | 3300031824 | Ga0307413_10558983 | Ga0307413_105589831 | 101 |
| 106 | 3300032004 | Ga0307414_10040337 | Ga0307414_100403373 | 101 |
| 107 | 3300032004 | Ga0307414_11683813 | Ga0307414_116838132 | 101 |
| 108 | 3300005546 | Ga0070696_100326072 | Ga0070696_1003260722 | 102 |
| 109 | 3300005614 | Ga0068856_100000158 | Ga0068856_10000015810 | 102 |
| 110 | 3300009093 | Ga0105240_10323247 | Ga0105240_103232472 | 102 |
| 111 | 3300013105 | Ga0157369_10009417 | Ga0157369_100094176 | 102 |
| 112 | 3300013307 | Ga0157372_11181710 | Ga0157372_111817102 | 102 |
| 113 | 3300022467 | Ga0224712_10179286 | Ga0224712_101792862 | 102 |
| 114 | 3300026078 | Ga0207702_10000167 | Ga0207702_1000016717 | 102 |
| 115 | 3300012475 | Ga0157317_1003088 | Ga0157317_10030881 | 103 |
| 116 | 3300006846 | Ga0075430_100722336 | Ga0075430_1007223361 | 104 |
| 117 | 3300037466 | Ga0395898_0005858 | Ga0395898_0005858_12057_12425 | 104 |
| 118 | 3300038443 | Ga0395901_0041616 | Ga0395901_0041616_1566_1934 | 104 |
| 119 | 3300042006 | Ga0439432_076248 | Ga0439432_076248_232_600 | 104 |
| 120 | 3300042007 | Ga0439449_0070066 | Ga0439449_0070066_717_1085 | 104 |
| 121 | 3300050509 | nmdc:mga0qj67_629425_c1 | nmdc:mga0qj67_629425_c1_439_819 | 104 |
| 122 | 3300005435 | Ga0070714_100763834 | Ga0070714_1007638342 | 105 |
| 123 | 3300005467 | Ga0070706_100147469 | Ga0070706_1001474693 | 105 |
| 124 | 3300005985 | Ga0081539_10037553 | Ga0081539_100375533 | 105 |
| 125 | 3300006871 | Ga0075434_100697476 | Ga0075434_1006974762 | 105 |
| 126 | 3300020069 | Ga0197907_10520165 | Ga0197907_105201652 | 105 |
| 127 | 3300025910 | Ga0207684_10099567 | Ga0207684_100995673 | 105 |
| 128 | 3300025922 | Ga0207646_10790555 | Ga0207646_107905552 | 105 |
| 129 | 3300050512 | nmdc:mga0n895_608740_c1 | nmdc:mga0n895_608740_c1_512_907 | 105 |
| 130 | 3300005367 | Ga0070667_100197493 | Ga0070667_1001974932 | 106 |
| 131 | 3300005617 | Ga0068859_100365691 | Ga0068859_1003656911 | 106 |
| 132 | 3300005842 | Ga0068858_100081716 | Ga0068858_1000817164 | 106 |
| 133 | 3300005842 | Ga0068858_101413991 | Ga0068858_1014139912 | 106 |
| 134 | 3300006844 | Ga0075428_100377095 | Ga0075428_1003770952 | 106 |
| 135 | 3300006931 | Ga0097620_100365666 | Ga0097620_1003656661 | 106 |
| 136 | 3300009098 | Ga0105245_10772752 | Ga0105245_107727522 | 106 |
| 137 | 3300009147 | Ga0114129_10381143 | Ga0114129_103811433 | 106 |
| 138 | 3300009177 | Ga0105248_10264347 | Ga0105248_102643472 | 106 |
| 139 | 3300009177 | Ga0105248_10349748 | Ga0105248_103497483 | 106 |
| 140 | 3300009553 | Ga0105249_10330255 | Ga0105249_103302552 | 106 |
| 141 | 3300013306 | Ga0163162_10051655 | Ga0163162_100516553 | 106 |
| 142 | 3300014968 | Ga0157379_10015311 | Ga0157379_100153113 | 106 |
| 143 | 3300025907 | Ga0207645_10393304 | Ga0207645_103933042 | 106 |
| 144 | 3300025927 | Ga0207687_10932431 | Ga0207687_109324312 | 106 |
| 145 | 3300025941 | Ga0207711_10114480 | Ga0207711_101144803 | 106 |
| 146 | 3300025986 | Ga0207658_11537611 | Ga0207658_115376111 | 106 |
| 147 | 3300026035 | Ga0207703_10886051 | Ga0207703_108860512 | 106 |
| 148 | 3300026035 | Ga0207703_11093359 | Ga0207703_110933592 | 106 |
| 149 | 3300031901 | Ga0307406_10157995 | Ga0307406_101579952 | 106 |
| 150 | 3300042156 | Ga0439446_0280128 | Ga0439446_0280128_137_523 | 106 |
| 151 | 3300005549 | Ga0070704_101543238 | Ga0070704_1015432382 | 107 |
| 152 | 3300035084 | Ga0373928_0209141 | Ga0373928_0209141_87_437 | 107 |
| 153 | 3300035691 | Ga0373931_0905685 | Ga0373931_0905685_209_559 | 107 |
| 154 | 3300048904 | Ga0496101_0484415 | Ga0496101_0484415_360_731 | 107 |
| 155 | 3300005331 | Ga0070670_100552812 | Ga0070670_1005528122 | 108 |
| 156 | 3300025939 | Ga0207665_10438044 | Ga0207665_104380441 | 108 |
| 157 | 3300037068 | Ga0373925_0526797 | Ga0373925_0526797_439_816 | 108 |
| 158 | 3300042876 | Ga0451577_0025346 | Ga0451577_0025346_1626_1979 | 108 |
| 159 | 3300048918 | Ga0496115_0631634 | Ga0496115_0631634_358_708 | 108 |
| 160 | 3300049772 | Ga0501275_000722 | Ga0501275_000722_577_930 | 108 |
| 161 | 3300049773 | Ga0501276_018049 | Ga0501276_018049_20_373 | 108 |
| 162 | 3300005333 | Ga0070677_10289372 | Ga0070677_102893722 | 109 |
| 163 | 3300005459 | Ga0068867_102273998 | Ga0068867_1022739981 | 109 |
| 164 | iso_pu_bacteria | 2643221593 | 2643976040 | 109 |
| 165 | iso_pu_bacteria | 2941489479 | 2941492920 | 109 |
| 166 | iso_pu_bacteria | 2995948881 | 2995952242 | 109 |
| 167 | 3300005335 | Ga0070666_10090274 | Ga0070666_100902742 | 110 |
| 168 | 3300005347 | Ga0070668_100031162 | Ga0070668_1000311625 | 110 |
| 169 | 3300005455 | Ga0070663_100553421 | Ga0070663_1005534211 | 110 |
| 170 | 3300005466 | Ga0070685_10003326 | Ga0070685_100033262 | 110 |
| 171 | 3300005616 | Ga0068852_100174413 | Ga0068852_1001744132 | 110 |
| 172 | 3300006028 | Ga0070717_10875988 | Ga0070717_108759881 | 110 |
| 173 | 3300009093 | Ga0105240_10001066 | Ga0105240_1000106612 | 110 |
| 174 | 3300009545 | Ga0105237_10030239 | Ga0105237_100302396 | 110 |
| 175 | 3300009551 | Ga0105238_10009941 | Ga0105238_100099418 | 110 |
| 176 | 3300013307 | Ga0157372_11080464 | Ga0157372_110804642 | 110 |
| 177 | 3300014968 | Ga0157379_11152369 | Ga0157379_111523692 | 110 |
| 178 | 3300025972 | Ga0207668_10009432 | Ga0207668_100094323 | 110 |
| 179 | 3300046681 | Ga0495647_0411525 | Ga0495647_0411525_128_508 | 110 |
| 180 | 3300049586 | Ga0501070_0345811 | Ga0501070_0345811_527_880 | 110 |
| 181 | 3300049586 | Ga0501070_1384070 | Ga0501070_1384070_23_376 | 110 |
| 182 | iso_pu_bacteria | 2524614729 | 2525555676 | 110 |
| 183 | iso_pu_bacteria | 2627854209 | 2630650690 | 110 |
| 184 | 3300005327 | Ga0070658_10389076 | Ga0070658_103890762 | 111 |
| 185 | 3300005328 | Ga0070676_10760030 | Ga0070676_107600302 | 111 |
| 186 | 3300005331 | Ga0070670_100035734 | Ga0070670_1000357345 | 111 |
| 187 | 3300005334 | Ga0068869_100228667 | Ga0068869_1002286672 | 111 |
| 188 | 3300005335 | Ga0070666_10038412 | Ga0070666_100384123 | 111 |
| 189 | 3300005335 | Ga0070666_10580334 | Ga0070666_105803341 | 111 |
| 190 | 3300005336 | Ga0070680_100227352 | Ga0070680_1002273522 | 111 |
| 191 | 3300005338 | Ga0068868_101745456 | Ga0068868_1017454561 | 111 |
| 192 | 3300005344 | Ga0070661_100084763 | Ga0070661_1000847633 | 111 |
| 193 | 3300005355 | Ga0070671_100178741 | Ga0070671_1001787413 | 111 |
| 194 | 3300005367 | Ga0070667_100011659 | Ga0070667_1000116592 | 111 |
| 195 | 3300005367 | Ga0070667_100305166 | Ga0070667_1003051663 | 111 |
| 196 | 3300005367 | Ga0070667_100843577 | Ga0070667_1008435771 | 111 |
| 197 | 3300005455 | Ga0070663_100054769 | Ga0070663_1000547692 | 111 |
| 198 | 3300005457 | Ga0070662_100003406 | Ga0070662_1000034069 | 111 |
| 199 | 3300005458 | Ga0070681_10002030 | Ga0070681_100020306 | 111 |
| 200 | 3300005539 | Ga0068853_100972993 | Ga0068853_1009729931 | 111 |
| 201 | 3300005543 | Ga0070672_100506535 | Ga0070672_1005065352 | 111 |
| 202 | 3300005548 | Ga0070665_100009116 | Ga0070665_1000091169 | 111 |
| 203 | 3300005563 | Ga0068855_100232099 | Ga0068855_1002320993 | 111 |
| 204 | 3300005564 | Ga0070664_100959540 | Ga0070664_1009595402 | 111 |
| 205 | 3300005577 | Ga0068857_100325944 | Ga0068857_1003259442 | 111 |
| 206 | 3300005578 | Ga0068854_100006573 | Ga0068854_1000065735 | 111 |
| 207 | 3300005616 | Ga0068852_100114003 | Ga0068852_1001140034 | 111 |
| 208 | 3300005617 | Ga0068859_100047278 | Ga0068859_1000472781 | 111 |
| 209 | 3300005618 | Ga0068864_100016674 | Ga0068864_1000166744 | 111 |
| 210 | 3300005834 | Ga0068851_10000626 | Ga0068851_100006264 | 111 |
| 211 | 3300005842 | Ga0068858_100030229 | Ga0068858_1000302295 | 111 |
| 212 | 3300005844 | Ga0068862_100422531 | Ga0068862_1004225312 | 111 |
| 213 | 3300006847 | Ga0075431_100623903 | Ga0075431_1006239032 | 111 |
| 214 | 3300006881 | Ga0068865_100064563 | Ga0068865_1000645634 | 111 |
| 215 | 3300006931 | Ga0097620_100047278 | Ga0097620_1000472781 | 111 |
| 216 | 3300009093 | Ga0105240_10673222 | Ga0105240_106732222 | 111 |
| 217 | 3300009098 | Ga0105245_10157482 | Ga0105245_101574822 | 111 |
| 218 | 3300009098 | Ga0105245_13259275 | Ga0105245_132592751 | 111 |
| 219 | 3300009174 | Ga0105241_10019053 | Ga0105241_100190532 | 111 |
| 220 | 3300009545 | Ga0105237_11688290 | Ga0105237_116882901 | 111 |
| 221 | 3300009551 | Ga0105238_10098350 | Ga0105238_100983503 | 111 |
| 222 | 3300010375 | Ga0105239_10183050 | Ga0105239_101830502 | 111 |
| 223 | 3300010375 | Ga0105239_11692414 | Ga0105239_116924142 | 111 |
| 224 | 3300011119 | Ga0105246_10128605 | Ga0105246_101286052 | 111 |
| 225 | 3300013105 | Ga0157369_10222272 | Ga0157369_102222721 | 111 |
| 226 | 3300013296 | Ga0157374_10029373 | Ga0157374_100293732 | 111 |
| 227 | 3300013297 | Ga0157378_10045984 | Ga0157378_100459844 | 111 |
| 228 | 3300013306 | Ga0163162_10178520 | Ga0163162_101785203 | 111 |
| 229 | 3300014325 | Ga0163163_10243111 | Ga0163163_102431112 | 111 |
| 230 | 3300014497 | Ga0182008_10259483 | Ga0182008_102594832 | 111 |
| 231 | 3300014968 | Ga0157379_10443109 | Ga0157379_104431092 | 111 |
| 232 | 3300014968 | Ga0157379_12586060 | Ga0157379_125860602 | 111 |
| 233 | 3300014969 | Ga0157376_10054232 | Ga0157376_100542325 | 111 |
| 234 | 3300025321 | Ga0207656_10016671 | Ga0207656_100166715 | 111 |
| 235 | 3300025903 | Ga0207680_10019316 | Ga0207680_100193164 | 111 |
| 236 | 3300025904 | Ga0207647_10000157 | Ga0207647_1000015752 | 111 |
| 237 | 3300025911 | Ga0207654_10049702 | Ga0207654_100497022 | 111 |
| 238 | 3300025912 | Ga0207707_10000018 | Ga0207707_10000018109 | 111 |
| 239 | 3300025913 | Ga0207695_10091521 | Ga0207695_100915215 | 111 |
| 240 | 3300025913 | Ga0207695_10110526 | Ga0207695_101105263 | 111 |
| 241 | 3300025914 | Ga0207671_10082488 | Ga0207671_100824883 | 111 |
| 242 | 3300025920 | Ga0207649_10349068 | Ga0207649_103490682 | 111 |
| 243 | 3300025924 | Ga0207694_10039101 | Ga0207694_100391015 | 111 |
| 244 | 3300025925 | Ga0207650_10077220 | Ga0207650_100772203 | 111 |
| 245 | 3300025925 | Ga0207650_10608520 | Ga0207650_106085201 | 111 |
| 246 | 3300025927 | Ga0207687_10527170 | Ga0207687_105271701 | 111 |
| 247 | 3300025931 | Ga0207644_10435158 | Ga0207644_104351582 | 111 |
| 248 | 3300025933 | Ga0207706_10004507 | Ga0207706_100045074 | 111 |
| 249 | 3300025938 | Ga0207704_10036864 | Ga0207704_100368642 | 111 |
| 250 | 3300025942 | Ga0207689_10218767 | Ga0207689_102187672 | 111 |
| 251 | 3300025942 | Ga0207689_10951373 | Ga0207689_109513731 | 111 |
| 252 | 3300025949 | Ga0207667_10183999 | Ga0207667_101839992 | 111 |
| 253 | 3300025961 | Ga0207712_10000197 | Ga0207712_1000019728 | 111 |
| 254 | 3300025972 | Ga0207668_12013296 | Ga0207668_120132961 | 111 |
| 255 | 3300025981 | Ga0207640_10004947 | Ga0207640_100049476 | 111 |
| 256 | 3300025986 | Ga0207658_10219610 | Ga0207658_102196103 | 111 |
| 257 | 3300025986 | Ga0207658_10685626 | Ga0207658_106856261 | 111 |
| 258 | 3300026023 | Ga0207677_10189469 | Ga0207677_101894692 | 111 |
| 259 | 3300026035 | Ga0207703_10040161 | Ga0207703_100401612 | 111 |
| 260 | 3300026041 | Ga0207639_10000446 | Ga0207639_1000044610 | 111 |
| 261 | 3300026067 | Ga0207678_10001892 | Ga0207678_100018928 | 111 |
| 262 | 3300026078 | Ga0207702_10175999 | Ga0207702_101759993 | 111 |
| 263 | 3300026116 | Ga0207674_10350045 | Ga0207674_103500453 | 111 |
| 264 | 3300026142 | Ga0207698_10733936 | Ga0207698_107339362 | 111 |
| 265 | 3300028379 | Ga0268266_10000006 | Ga0268266_1000000659 | 111 |
| 266 | 3300028381 | Ga0268264_11592312 | Ga0268264_115923122 | 111 |
| 267 | 3300031731 | Ga0307405_10902743 | Ga0307405_109027432 | 111 |
| 268 | 3300031911 | Ga0307412_10238975 | Ga0307412_102389752 | 111 |
| 269 | 3300035691 | Ga0373931_0084133 | Ga0373931_0084133_1002_1397 | 111 |
| 270 | 3300048907 | Ga0496104_1125273 | Ga0496104_1125273_197_592 | 111 |
| 271 | 3300048912 | Ga0496109_0711845 | Ga0496109_0711845_76_441 | 111 |
| 272 | 3300048912 | Ga0496109_1878381 | Ga0496109_1878381_134_496 | 111 |
| 273 | 3300048915 | Ga0496112_0216305 | Ga0496112_0216305_466_828 | 111 |
| 274 | 3300048917 | Ga0496114_0207161 | Ga0496114_0207161_815_1210 | 111 |
| 275 | 3300003794 | Ga0055531_10020826 | Ga0055531_100208262 | 112 |
| 276 | 3300005327 | Ga0070658_10197520 | Ga0070658_101975203 | 112 |
| 277 | 3300005530 | Ga0070679_100382832 | Ga0070679_1003828321 | 112 |
| 278 | 3300005577 | Ga0068857_101317239 | Ga0068857_1013172391 | 112 |
| 279 | 3300005578 | Ga0068854_100276652 | Ga0068854_1002766522 | 112 |
| 280 | 3300005617 | Ga0068859_100049000 | Ga0068859_1000490003 | 112 |
| 281 | 3300005841 | Ga0068863_100261300 | Ga0068863_1002613002 | 112 |
| 282 | 3300005843 | Ga0068860_101290623 | Ga0068860_1012906232 | 112 |
| 283 | 3300006237 | Ga0097621_100287792 | Ga0097621_1002877922 | 112 |
| 284 | 3300006237 | Ga0097621_100609324 | Ga0097621_1006093242 | 112 |
| 285 | 3300006358 | Ga0068871_100373085 | Ga0068871_1003730852 | 112 |
| 286 | 3300006931 | Ga0097620_100049000 | Ga0097620_1000490003 | 112 |
| 287 | 3300009098 | Ga0105245_11232190 | Ga0105245_112321901 | 112 |
| 288 | 3300009177 | Ga0105248_10653594 | Ga0105248_106535942 | 112 |
| 289 | 3300009551 | Ga0105238_10044849 | Ga0105238_100448495 | 112 |
| 290 | 3300011119 | Ga0105246_12417959 | Ga0105246_124179591 | 112 |
| 291 | 3300013104 | Ga0157370_10047891 | Ga0157370_100478913 | 112 |
| 292 | 3300013297 | Ga0157378_10828810 | Ga0157378_108288102 | 112 |
| 293 | 3300017792 | Ga0163161_11662717 | Ga0163161_116627172 | 112 |
| 294 | 3300025294 | Ga0209025_1029411 | Ga0209025_10294112 | 112 |
| 295 | 3300025304 | Ga0209257_1000263 | Ga0209257_100026331 | 112 |
| 296 | 3300025924 | Ga0207694_10011157 | Ga0207694_100111572 | 112 |
| 297 | 3300025941 | Ga0207711_10724561 | Ga0207711_107245612 | 112 |
| 298 | 3300025981 | Ga0207640_10971458 | Ga0207640_109714581 | 112 |
| 299 | 3300026088 | Ga0207641_10195580 | Ga0207641_101955803 | 112 |
| 300 | 3300028794 | Ga0307515_10525391 | Ga0307515_105253911 | 112 |
| 301 | 3300031456 | Ga0307513_10083926 | Ga0307513_100839262 | 112 |
| 302 | 3300031456 | Ga0307513_10244622 | Ga0307513_102446221 | 112 |
| 303 | 3300031727 | Ga0316576_10002379 | Ga0316576_100023797 | 112 |
| 304 | 3300031824 | Ga0307413_10805747 | Ga0307413_108057472 | 112 |
| 305 | 3300032004 | Ga0307414_10046276 | Ga0307414_100462763 | 112 |
| 306 | 3300032004 | Ga0307414_10138848 | Ga0307414_101388481 | 112 |
| 307 | 3300036712 | Ga0316584_0045361 | Ga0316584_0045361_288_653 | 112 |
| 308 | 3300037418 | Ga0395900_0003253 | Ga0395900_0003253_16782_17153 | 112 |
| 309 | 3300041413 | Ga0439465_0001078 | Ga0439465_0001078_2831_3205 | 112 |
| 310 | 3300041451 | Ga0451791_0513229 | Ga0451791_0513229_686_1063 | 112 |
| 311 | 3300041451 | Ga0451791_1604906 | Ga0451791_1604906_1077_1457 | 112 |
| 312 | 3300041452 | Ga0451793_1463101 | Ga0451793_1463101_67_444 | 112 |
| 313 | 3300041453 | Ga0451797_0751603 | Ga0451797_0751603_374_754 | 112 |
| 314 | 3300041456 | Ga0451795_0235484 | Ga0451795_0235484_468_845 | 112 |
| 315 | 3300041459 | Ga0451800_0681495 | Ga0451800_0681495_50_430 | 112 |
| 316 | 3300041486 | Ga0451807_0106323 | Ga0451807_0106323_127_501 | 112 |
| 317 | 3300041494 | Ga0451837_1152633 | Ga0451837_1152633_86_466 | 112 |
| 318 | 3300041494 | Ga0451837_1688733 | Ga0451837_1688733_908_1282 | 112 |
| 319 | 3300041496 | Ga0451839_1393893 | Ga0451839_1393893_19_396 | 112 |
| 320 | 3300041498 | Ga0451841_0210267 | Ga0451841_0210267_417_797 | 112 |
| 321 | 3300041509 | Ga0451843_0478485 | Ga0451843_0478485_625_1005 | 112 |
| 322 | 3300041509 | Ga0451843_1333241 | Ga0451843_1333241_1120_1494 | 112 |
| 323 | 3300041509 | Ga0451843_1594455 | Ga0451843_1594455_121_498 | 112 |
| 324 | 3300041511 | Ga0451855_1849199 | Ga0451855_1849199_101_475 | 112 |
| 325 | 3300041512 | Ga0451853_3160813 | Ga0451853_3160813_10_387 | 112 |
| 326 | 3300041999 | Ga0439433_0030552 | Ga0439433_0030552_683_1057 | 112 |
| 327 | 3300042007 | Ga0439449_0137246 | Ga0439449_0137246_249_623 | 112 |
| 328 | 3300042156 | Ga0439446_0152929 | Ga0439446_0152929_160_534 | 112 |
| 329 | 3300046513 | Ga0495616_0063888 | Ga0495616_0063888_1410_1784 | 112 |
| 330 | 3300046522 | Ga0495643_0085181 | Ga0495643_0085181_759_1133 | 112 |
| 331 | 3300046525 | Ga0495663_0011527 | Ga0495663_0011527_1333_1707 | 112 |
| 332 | 3300049571 | Ga0501034_1668579 | Ga0501034_1668579_38_400 | 112 |
| 333 | 3300049573 | Ga0501037_0067506 | Ga0501037_0067506_354_716 | 112 |
| 334 | 3300049581 | Ga0501047_0046204 | Ga0501047_0046204_2077_2439 | 112 |
| 335 | 3300049585 | Ga0501069_0061599 | Ga0501069_0061599_1085_1447 | 112 |
| 336 | 3300049586 | Ga0501070_0014516 | Ga0501070_0014516_662_1024 | 112 |
| 337 | 3300049587 | Ga0501071_0000973 | Ga0501071_0000973_13780_14142 | 112 |
| 338 | 3300049589 | Ga0501073_0001354 | Ga0501073_0001354_3370_3732 | 112 |
| 339 | 3300049590 | Ga0501074_0006572 | Ga0501074_0006572_5147_5509 | 112 |
| 340 | 3300049592 | Ga0501076_0256294 | Ga0501076_0256294_460_822 | 112 |
| 341 | 3300049742 | Ga0501080_0079514 | Ga0501080_0079514_2498_2860 | 112 |
| 342 | 3300049822 | Ga0501035_0272430 | Ga0501035_0272430_516_878 | 112 |
| 343 | 3300049823 | Ga0501044_0039950 | Ga0501044_0039950_1304_1666 | 112 |
| 344 | 3300002774 | JGI25150J39212_1025385 | JGI25150J39212_10253852 | 113 |
| 345 | 3300003187 | JGI25151J46595_10000059 | JGI25151J46595_1000005957 | 113 |
| 346 | 3300003316 | rootH1_10141190 | rootH1_101411902 | 113 |
| 347 | 3300003323 | rootH1_10258062 | rootH1_102580622 | 113 |
| 348 | 3300003771 | Ga0055526_1000039 | Ga0055526_10000396 | 113 |
| 349 | 3300003773 | Ga0055537_1000970 | Ga0055537_10009706 | 113 |
| 350 | 3300003775 | Ga0055524_1000067 | Ga0055524_1000067125 | 113 |
| 351 | 3300003784 | Ga0055534_1000025 | Ga0055534_1000025125 | 113 |
| 352 | 3300003790 | Ga0055528_1000024 | Ga0055528_1000024125 | 113 |
| 353 | 3300005335 | Ga0070666_10111070 | Ga0070666_101110703 | 113 |
| 354 | 3300005338 | Ga0068868_100981508 | Ga0068868_1009815081 | 113 |
| 355 | 3300005345 | Ga0070692_10372560 | Ga0070692_103725602 | 113 |
| 356 | 3300005539 | Ga0068853_100161865 | Ga0068853_1001618654 | 113 |
| 357 | 3300005547 | Ga0070693_100000485 | Ga0070693_10000048519 | 113 |
| 358 | 3300005616 | Ga0068852_100895626 | Ga0068852_1008956262 | 113 |
| 359 | 3300006237 | Ga0097621_101130457 | Ga0097621_1011304572 | 113 |
| 360 | 3300009101 | Ga0105247_10080002 | Ga0105247_100800023 | 113 |
| 361 | 3300013297 | Ga0157378_10000033 | Ga0157378_100000333 | 113 |
| 362 | 3300014969 | Ga0157376_12183153 | Ga0157376_121831531 | 113 |
| 363 | 3300015689 | Ga0183360_10001 | Ga0183360_100011005 | 113 |
| 364 | 3300025245 | Ga0207425_1035183 | Ga0207425_10351832 | 113 |
| 365 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005122 | 113 |
| 366 | 3300025263 | Ga0209565_1012074 | Ga0209565_10120741 | 113 |
| 367 | 3300025273 | Ga0209673_1000027 | Ga0209673_1000027123 | 113 |
| 368 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004122 | 113 |
| 369 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005263 | 113 |
| 370 | 3300025295 | Ga0209564_1000050 | Ga0209564_1000050123 | 113 |
| 371 | 3300025297 | Ga0209758_1019657 | Ga0209758_10196574 | 113 |
| 372 | 3300025299 | Ga0209256_1000031 | Ga0209256_1000031123 | 113 |
| 373 | 3300025321 | Ga0207656_10130747 | Ga0207656_101307472 | 113 |
| 374 | 3300025938 | Ga0207704_10169944 | Ga0207704_101699442 | 113 |
| 375 | 3300026023 | Ga0207677_10667186 | Ga0207677_106671862 | 113 |
| 376 | 3300026088 | Ga0207641_10810171 | Ga0207641_108101712 | 113 |
| 377 | 3300031548 | Ga0307408_100016229 | Ga0307408_1000162295 | 113 |
| 378 | 3300031901 | Ga0307406_10001746 | Ga0307406_100017466 | 113 |
| 379 | 3300031911 | Ga0307412_10253067 | Ga0307412_102530671 | 113 |
| 380 | 3300035119 | Ga0373956_0300887 | Ga0373956_0300887_174_542 | 113 |
| 381 | 3300035172 | Ga0373955_0644667 | Ga0373955_0644667_38_406 | 113 |
| 382 | 3300035724 | Ga0373933_0065213 | Ga0373933_0065213_438_806 | 113 |
| 383 | 3300036401 | Ga0373937_0268844 | Ga0373937_0268844_513_881 | 113 |
| 384 | 3300039437 | Ga0436365_0043459 | Ga0436365_0043459_160_531 | 113 |
| 385 | 3300041404 | Ga0439436_0005922 | Ga0439436_0005922_2525_2899 | 113 |
| 386 | 3300041407 | Ga0439447_003163 | Ga0439447_003163_1636_2010 | 113 |
| 387 | 3300041411 | Ga0439466_0072802 | Ga0439466_0072802_301_675 | 113 |
| 388 | 3300046616 | Ga0495668_0000625 | Ga0495668_0000625_6248_6622 | 113 |
| 389 | 3300048924 | Ga0496121_0011637 | Ga0496121_0011637_5016_5390 | 113 |
| 390 | 3300049584 | Ga0501068_0275321 | Ga0501068_0275321_689_1063 | 113 |
| 391 | 3300003794 | Ga0055531_10034350 | Ga0055531_100343502 | 114 |
| 392 | 3300005328 | Ga0070676_10305975 | Ga0070676_103059752 | 114 |
| 393 | 3300005330 | Ga0070690_100078817 | Ga0070690_1000788172 | 114 |
| 394 | 3300005330 | Ga0070690_100316531 | Ga0070690_1003165312 | 114 |
| 395 | 3300005331 | Ga0070670_100008428 | Ga0070670_1000084282 | 114 |
| 396 | 3300005333 | Ga0070677_10118220 | Ga0070677_101182202 | 114 |
| 397 | 3300005334 | Ga0068869_100003702 | Ga0068869_1000037022 | 114 |
| 398 | 3300005334 | Ga0068869_100958741 | Ga0068869_1009587411 | 114 |
| 399 | 3300005335 | Ga0070666_10144975 | Ga0070666_101449752 | 114 |
| 400 | 3300005338 | Ga0068868_100242723 | Ga0068868_1002427232 | 114 |
| 401 | 3300005340 | Ga0070689_100236243 | Ga0070689_1002362433 | 114 |
| 402 | 3300005344 | Ga0070661_100426498 | Ga0070661_1004264982 | 114 |
| 403 | 3300005347 | Ga0070668_100007024 | Ga0070668_1000070245 | 114 |
| 404 | 3300005347 | Ga0070668_100086196 | Ga0070668_1000861962 | 114 |
| 405 | 3300005347 | Ga0070668_100595168 | Ga0070668_1005951682 | 114 |
| 406 | 3300005347 | Ga0070668_101005321 | Ga0070668_1010053211 | 114 |
| 407 | 3300005353 | Ga0070669_100189753 | Ga0070669_1001897532 | 114 |
| 408 | 3300005353 | Ga0070669_100911823 | Ga0070669_1009118232 | 114 |
| 409 | 3300005355 | Ga0070671_100004584 | Ga0070671_1000045846 | 114 |
| 410 | 3300005364 | Ga0070673_100011769 | Ga0070673_1000117695 | 114 |
| 411 | 3300005364 | Ga0070673_100031389 | Ga0070673_1000313894 | 114 |
| 412 | 3300005364 | Ga0070673_102321733 | Ga0070673_1023217331 | 114 |
| 413 | 3300005366 | Ga0070659_100429201 | Ga0070659_1004292011 | 114 |
| 414 | 3300005367 | Ga0070667_100201635 | Ga0070667_1002016353 | 114 |
| 415 | 3300005367 | Ga0070667_100616589 | Ga0070667_1006165892 | 114 |
| 416 | 3300005367 | Ga0070667_102130715 | Ga0070667_1021307152 | 114 |
| 417 | 3300005438 | Ga0070701_10594484 | Ga0070701_105944842 | 114 |
| 418 | 3300005441 | Ga0070700_100487716 | Ga0070700_1004877162 | 114 |
| 419 | 3300005457 | Ga0070662_100316559 | Ga0070662_1003165592 | 114 |
| 420 | 3300005459 | Ga0068867_100019601 | Ga0068867_1000196013 | 114 |
| 421 | 3300005459 | Ga0068867_100227492 | Ga0068867_1002274922 | 114 |
| 422 | 3300005466 | Ga0070685_10746981 | Ga0070685_107469811 | 114 |
| 423 | 3300005467 | Ga0070706_100108047 | Ga0070706_1001080473 | 114 |
| 424 | 3300005518 | Ga0070699_100568316 | Ga0070699_1005683162 | 114 |
| 425 | 3300005518 | Ga0070699_101012419 | Ga0070699_1010124191 | 114 |
| 426 | 3300005536 | Ga0070697_100050758 | Ga0070697_1000507581 | 114 |
| 427 | 3300005536 | Ga0070697_100084333 | Ga0070697_1000843332 | 114 |
| 428 | 3300005543 | Ga0070672_100327375 | Ga0070672_1003273751 | 114 |
| 429 | 3300005543 | Ga0070672_100741073 | Ga0070672_1007410732 | 114 |
| 430 | 3300005545 | Ga0070695_101012913 | Ga0070695_1010129131 | 114 |
| 431 | 3300005563 | Ga0068855_100156491 | Ga0068855_1001564912 | 114 |
| 432 | 3300005563 | Ga0068855_100448569 | Ga0068855_1004485692 | 114 |
| 433 | 3300005564 | Ga0070664_100297366 | Ga0070664_1002973662 | 114 |
| 434 | 3300005577 | Ga0068857_100072694 | Ga0068857_1000726942 | 114 |
| 435 | 3300005578 | Ga0068854_102014696 | Ga0068854_1020146962 | 114 |
| 436 | 3300005616 | Ga0068852_100177058 | Ga0068852_1001770582 | 114 |
| 437 | 3300005616 | Ga0068852_101319905 | Ga0068852_1013199052 | 114 |
| 438 | 3300005617 | Ga0068859_100003068 | Ga0068859_1000030689 | 114 |
| 439 | 3300005617 | Ga0068859_100175520 | Ga0068859_1001755203 | 114 |
| 440 | 3300005617 | Ga0068859_100990812 | Ga0068859_1009908122 | 114 |
| 441 | 3300005618 | Ga0068864_100013312 | Ga0068864_1000133126 | 114 |
| 442 | 3300005719 | Ga0068861_100004164 | Ga0068861_1000041643 | 114 |
| 443 | 3300005719 | Ga0068861_100737640 | Ga0068861_1007376402 | 114 |
| 444 | 3300005719 | Ga0068861_102678237 | Ga0068861_1026782372 | 114 |
| 445 | 3300005841 | Ga0068863_100010149 | Ga0068863_1000101492 | 114 |
| 446 | 3300005841 | Ga0068863_100241591 | Ga0068863_1002415912 | 114 |
| 447 | 3300005841 | Ga0068863_100858141 | Ga0068863_1008581412 | 114 |
| 448 | 3300005842 | Ga0068858_100010172 | Ga0068858_1000101722 | 114 |
| 449 | 3300005842 | Ga0068858_100199035 | Ga0068858_1001990352 | 114 |
| 450 | 3300005842 | Ga0068858_100295430 | Ga0068858_1002954302 | 114 |
| 451 | 3300005843 | Ga0068860_101134403 | Ga0068860_1011344032 | 114 |
| 452 | 3300005844 | Ga0068862_100243607 | Ga0068862_1002436073 | 114 |
| 453 | 3300005844 | Ga0068862_101363684 | Ga0068862_1013636841 | 114 |
| 454 | 3300006173 | Ga0070716_100241286 | Ga0070716_1002412863 | 114 |
| 455 | 3300006237 | Ga0097621_100127563 | Ga0097621_1001275633 | 114 |
| 456 | 3300006237 | Ga0097621_100548367 | Ga0097621_1005483672 | 114 |
| 457 | 3300006358 | Ga0068871_101237401 | Ga0068871_1012374011 | 114 |
| 458 | 3300006852 | Ga0075433_10005479 | Ga0075433_100054799 | 114 |
| 459 | 3300006871 | Ga0075434_100035645 | Ga0075434_1000356452 | 114 |
| 460 | 3300006871 | Ga0075434_100493857 | Ga0075434_1004938572 | 114 |
| 461 | 3300006931 | Ga0097620_100003068 | Ga0097620_10000306812 | 114 |
| 462 | 3300006931 | Ga0097620_100175519 | Ga0097620_1001755192 | 114 |
| 463 | 3300006931 | Ga0097620_100990869 | Ga0097620_1009908692 | 114 |
| 464 | 3300007076 | Ga0075435_100055957 | Ga0075435_1000559572 | 114 |
| 465 | 3300009093 | Ga0105240_12731157 | Ga0105240_127311571 | 114 |
| 466 | 3300009147 | Ga0114129_12319367 | Ga0114129_123193671 | 114 |
| 467 | 3300009174 | Ga0105241_11976234 | Ga0105241_119762342 | 114 |
| 468 | 3300009177 | Ga0105248_10010111 | Ga0105248_100101119 | 114 |
| 469 | 3300009177 | Ga0105248_10048578 | Ga0105248_100485785 | 114 |
| 470 | 3300009553 | Ga0105249_10153983 | Ga0105249_101539832 | 114 |
| 471 | 3300010375 | Ga0105239_11627828 | Ga0105239_116278282 | 114 |
| 472 | 3300013102 | Ga0157371_10951074 | Ga0157371_109510742 | 114 |
| 473 | 3300013297 | Ga0157378_10011995 | Ga0157378_100119959 | 114 |
| 474 | 3300013297 | Ga0157378_11373149 | Ga0157378_113731492 | 114 |
| 475 | 3300013306 | Ga0163162_10095595 | Ga0163162_100955953 | 114 |
| 476 | 3300013306 | Ga0163162_10217872 | Ga0163162_102178723 | 114 |
| 477 | 3300013308 | Ga0157375_10244877 | Ga0157375_102448772 | 114 |
| 478 | 3300013308 | Ga0157375_10654026 | Ga0157375_106540262 | 114 |
| 479 | 3300013308 | Ga0157375_11199895 | Ga0157375_111998952 | 114 |
| 480 | 3300014325 | Ga0163163_10006992 | Ga0163163_100069929 | 114 |
| 481 | 3300014325 | Ga0163163_10771994 | Ga0163163_107719942 | 114 |
| 482 | 3300014326 | Ga0157380_11012657 | Ga0157380_110126572 | 114 |
| 483 | 3300014326 | Ga0157380_11186419 | Ga0157380_111864192 | 114 |
| 484 | 3300014968 | Ga0157379_10005585 | Ga0157379_100055854 | 114 |
| 485 | 3300025304 | Ga0209257_1000645 | Ga0209257_10006452 | 114 |
| 486 | 3300025903 | Ga0207680_10256724 | Ga0207680_102567242 | 114 |
| 487 | 3300025907 | Ga0207645_10020545 | Ga0207645_100205455 | 114 |
| 488 | 3300025907 | Ga0207645_10250888 | Ga0207645_102508882 | 114 |
| 489 | 3300025910 | Ga0207684_10283987 | Ga0207684_102839872 | 114 |
| 490 | 3300025914 | Ga0207671_11541317 | Ga0207671_115413171 | 114 |
| 491 | 3300025923 | Ga0207681_10202988 | Ga0207681_102029882 | 114 |
| 492 | 3300025923 | Ga0207681_10497716 | Ga0207681_104977162 | 114 |
| 493 | 3300025925 | Ga0207650_10255395 | Ga0207650_102553952 | 114 |
| 494 | 3300025931 | Ga0207644_10018576 | Ga0207644_100185763 | 114 |
| 495 | 3300025932 | Ga0207690_10834033 | Ga0207690_108340332 | 114 |
| 496 | 3300025933 | Ga0207706_10512192 | Ga0207706_105121922 | 114 |
| 497 | 3300025936 | Ga0207670_10211281 | Ga0207670_102112812 | 114 |
| 498 | 3300025941 | Ga0207711_10029362 | Ga0207711_100293625 | 114 |
| 499 | 3300025942 | Ga0207689_10003539 | Ga0207689_100035399 | 114 |
| 500 | 3300025942 | Ga0207689_10360605 | Ga0207689_103606052 | 114 |
| 501 | 3300025949 | Ga0207667_10300789 | Ga0207667_103007892 | 114 |
| 502 | 3300025949 | Ga0207667_11681093 | Ga0207667_116810932 | 114 |
| 503 | 3300025960 | Ga0207651_10185054 | Ga0207651_101850543 | 114 |
| 504 | 3300025961 | Ga0207712_10093749 | Ga0207712_100937492 | 114 |
| 505 | 3300025972 | Ga0207668_10053138 | Ga0207668_100531382 | 114 |
| 506 | 3300025972 | Ga0207668_10329700 | Ga0207668_103297001 | 114 |
| 507 | 3300025972 | Ga0207668_10693820 | Ga0207668_106938202 | 114 |
| 508 | 3300025986 | Ga0207658_10181013 | Ga0207658_101810132 | 114 |
| 509 | 3300025986 | Ga0207658_10476646 | Ga0207658_104766462 | 114 |
| 510 | 3300026035 | Ga0207703_10436988 | Ga0207703_104369882 | 114 |
| 511 | 3300026035 | Ga0207703_11241707 | Ga0207703_112417072 | 114 |
| 512 | 3300026041 | Ga0207639_11210947 | Ga0207639_112109472 | 114 |
| 513 | 3300026088 | Ga0207641_10016203 | Ga0207641_100162034 | 114 |
| 514 | 3300026088 | Ga0207641_10218331 | Ga0207641_102183312 | 114 |
| 515 | 3300026089 | Ga0207648_10008770 | Ga0207648_100087709 | 114 |
| 516 | 3300026089 | Ga0207648_10481243 | Ga0207648_104812431 | 114 |
| 517 | 3300026095 | Ga0207676_10012675 | Ga0207676_100126752 | 114 |
| 518 | 3300026116 | Ga0207674_10030180 | Ga0207674_100301806 | 114 |
| 519 | 3300026118 | Ga0207675_100007990 | Ga0207675_1000079903 | 114 |
| 520 | 3300026118 | Ga0207675_100052782 | Ga0207675_1000527822 | 114 |
| 521 | 3300028379 | Ga0268266_10515650 | Ga0268266_105156502 | 114 |
| 522 | 3300028380 | Ga0268265_10116638 | Ga0268265_101166383 | 114 |
| 523 | 3300028380 | Ga0268265_12065845 | Ga0268265_120658452 | 114 |
| 524 | 3300028381 | Ga0268264_10395170 | Ga0268264_103951701 | 114 |
| 525 | 3300028381 | Ga0268264_11178153 | Ga0268264_111781531 | 114 |
| 526 | 3300035116 | Ga0373945_0573170 | Ga0373945_0573170_62_433 | 114 |
| 527 | 3300044673 | Ga0453683_1027986 | Ga0453683_1027986_62_433 | 114 |
| 528 | 3300047318 | Ga0495636_0302337 | Ga0495636_0302337_100_471 | 114 |
| 529 | 3300048905 | Ga0496102_0035311 | Ga0496102_0035311_1663_2037 | 114 |
| 530 | 3300048905 | Ga0496102_1065864 | Ga0496102_1065864_48_419 | 114 |
| 531 | 3300048906 | Ga0496103_0174255 | Ga0496103_0174255_303_674 | 114 |
| 532 | 3300048909 | Ga0496106_0175677 | Ga0496106_0175677_1299_1670 | 114 |
| 533 | 3300048911 | Ga0496108_0502573 | Ga0496108_0502573_606_980 | 114 |
| 534 | 3300048912 | Ga0496109_0096664 | Ga0496109_0096664_147_518 | 114 |
| 535 | 3300048913 | Ga0496110_0966418 | Ga0496110_0966418_117_488 | 114 |
| 536 | 3300048929 | Ga0496126_0232656 | Ga0496126_0232656_411_788 | 114 |
| 537 | 3300050507 | nmdc:mga05p37_2122318_c1 | nmdc:mga05p37_2122318_c1_98_469 | 114 |
| 538 | 3300050512 | nmdc:mga0n895_39828_c1 | nmdc:mga0n895_39828_c1_3695_4066 | 114 |
| 539 | 3300050513 | nmdc:mga0rr50_116561_c1 | nmdc:mga0rr50_116561_c1_658_1029 | 114 |
| 540 | 3300050515 | nmdc:mga0a205_17083_c1 | nmdc:mga0a205_17083_c1_2080_2451 | 114 |
| 541 | 3300005328 | Ga0070676_10208852 | Ga0070676_102088522 | 115 |
| 542 | 3300005331 | Ga0070670_100257470 | Ga0070670_1002574702 | 115 |
| 543 | 3300005334 | Ga0068869_101131478 | Ga0068869_1011314781 | 115 |
| 544 | 3300005343 | Ga0070687_101464844 | Ga0070687_1014648441 | 115 |
| 545 | 3300005347 | Ga0070668_100126686 | Ga0070668_1001266863 | 115 |
| 546 | 3300005353 | Ga0070669_100577299 | Ga0070669_1005772992 | 115 |
| 547 | 3300005364 | Ga0070673_100278762 | Ga0070673_1002787622 | 115 |
| 548 | 3300005563 | Ga0068855_100024004 | Ga0068855_1000240045 | 115 |
| 549 | 3300005617 | Ga0068859_101222105 | Ga0068859_1012221052 | 115 |
| 550 | 3300005618 | Ga0068864_101726923 | Ga0068864_1017269231 | 115 |
| 551 | 3300005841 | Ga0068863_100067477 | Ga0068863_1000674773 | 115 |
| 552 | 3300005841 | Ga0068863_100187981 | Ga0068863_1001879812 | 115 |
| 553 | 3300005843 | Ga0068860_100229107 | Ga0068860_1002291073 | 115 |
| 554 | 3300005844 | Ga0068862_100392611 | Ga0068862_1003926112 | 115 |
| 555 | 3300006237 | Ga0097621_101997225 | Ga0097621_1019972252 | 115 |
| 556 | 3300006358 | Ga0068871_101195234 | Ga0068871_1011952342 | 115 |
| 557 | 3300006931 | Ga0097620_101222151 | Ga0097620_1012221512 | 115 |
| 558 | 3300009094 | Ga0111539_12463489 | Ga0111539_124634891 | 115 |
| 559 | 3300013308 | Ga0157375_10602218 | Ga0157375_106022182 | 115 |
| 560 | 3300025925 | Ga0207650_10485098 | Ga0207650_104850981 | 115 |
| 561 | 3300025940 | Ga0207691_10146131 | Ga0207691_101461313 | 115 |
| 562 | 3300025942 | Ga0207689_10723281 | Ga0207689_107232812 | 115 |
| 563 | 3300025949 | Ga0207667_10106036 | Ga0207667_101060364 | 115 |
| 564 | 3300025960 | Ga0207651_10323798 | Ga0207651_103237982 | 115 |
| 565 | 3300026095 | Ga0207676_10312254 | Ga0207676_103122543 | 115 |
| 566 | 3300028380 | Ga0268265_10087070 | Ga0268265_100870702 | 115 |
| 567 | 3300028381 | Ga0268264_10290925 | Ga0268264_102909253 | 115 |
| 568 | 3300037418 | Ga0395900_0000439 | Ga0395900_0000439_26623_26982 | 115 |
| 569 | 3300049823 | Ga0501044_1273312 | Ga0501044_1273312_147_506 | 115 |
| 570 | 3300005327 | Ga0070658_10185011 | Ga0070658_101850112 | 116 |
| 571 | 3300005328 | Ga0070676_10002764 | Ga0070676_100027649 | 116 |
| 572 | 3300005330 | Ga0070690_100226220 | Ga0070690_1002262201 | 116 |
| 573 | 3300005334 | Ga0068869_100144345 | Ga0068869_1001443452 | 116 |
| 574 | 3300005335 | Ga0070666_10439698 | Ga0070666_104396982 | 116 |
| 575 | 3300005338 | Ga0068868_100085591 | Ga0068868_1000855912 | 116 |
| 576 | 3300005347 | Ga0070668_100009853 | Ga0070668_1000098536 | 116 |
| 577 | 3300005353 | Ga0070669_100027849 | Ga0070669_1000278492 | 116 |
| 578 | 3300005355 | Ga0070671_100729798 | Ga0070671_1007297982 | 116 |
| 579 | 3300005355 | Ga0070671_100994493 | Ga0070671_1009944932 | 116 |
| 580 | 3300005356 | Ga0070674_100221420 | Ga0070674_1002214201 | 116 |
| 581 | 3300005364 | Ga0070673_100024978 | Ga0070673_1000249783 | 116 |
| 582 | 3300005455 | Ga0070663_100284310 | Ga0070663_1002843102 | 116 |
| 583 | 3300005543 | Ga0070672_100003844 | Ga0070672_1000038448 | 116 |
| 584 | 3300005548 | Ga0070665_100036651 | Ga0070665_1000366517 | 116 |
| 585 | 3300005617 | Ga0068859_100105870 | Ga0068859_1001058703 | 116 |
| 586 | 3300005840 | Ga0068870_10019799 | Ga0068870_100197994 | 116 |
| 587 | 3300005843 | Ga0068860_101102990 | Ga0068860_1011029902 | 116 |
| 588 | 3300005844 | Ga0068862_100450488 | Ga0068862_1004504882 | 116 |
| 589 | 3300006358 | Ga0068871_101300818 | Ga0068871_1013008182 | 116 |
| 590 | 3300006881 | Ga0068865_100196696 | Ga0068865_1001966962 | 116 |
| 591 | 3300006931 | Ga0097620_100105874 | Ga0097620_1001058743 | 116 |
| 592 | 3300009093 | Ga0105240_10871965 | Ga0105240_108719652 | 116 |
| 593 | 3300009551 | Ga0105238_10144595 | Ga0105238_101445953 | 116 |
| 594 | 3300011119 | Ga0105246_10299425 | Ga0105246_102994252 | 116 |
| 595 | 3300013296 | Ga0157374_10380858 | Ga0157374_103808583 | 116 |
| 596 | 3300025315 | Ga0207697_10145710 | Ga0207697_101457101 | 116 |
| 597 | 3300025907 | Ga0207645_10090476 | Ga0207645_100904763 | 116 |
| 598 | 3300025908 | Ga0207643_10019292 | Ga0207643_100192924 | 116 |
| 599 | 3300025909 | Ga0207705_10113978 | Ga0207705_101139782 | 116 |
| 600 | 3300025923 | Ga0207681_10273319 | Ga0207681_102733192 | 116 |
| 601 | 3300025924 | Ga0207694_10218021 | Ga0207694_102180211 | 116 |
| 602 | 3300025925 | Ga0207650_10039577 | Ga0207650_100395774 | 116 |
| 603 | 3300025926 | Ga0207659_10890078 | Ga0207659_108900782 | 116 |
| 604 | 3300025937 | Ga0207669_10115575 | Ga0207669_101155753 | 116 |
| 605 | 3300025938 | Ga0207704_10142373 | Ga0207704_101423732 | 116 |
| 606 | 3300025940 | Ga0207691_10008755 | Ga0207691_100087553 | 116 |
| 607 | 3300025942 | Ga0207689_10031723 | Ga0207689_100317231 | 116 |
| 608 | 3300025960 | Ga0207651_10037484 | Ga0207651_100374843 | 116 |
| 609 | 3300025972 | Ga0207668_10012378 | Ga0207668_100123782 | 116 |
| 610 | 3300026023 | Ga0207677_11190633 | Ga0207677_111906332 | 116 |
| 611 | 3300026067 | Ga0207678_11442678 | Ga0207678_114426782 | 116 |
| 612 | 3300026078 | Ga0207702_10249895 | Ga0207702_102498953 | 116 |
| 613 | 3300026089 | Ga0207648_10046725 | Ga0207648_100467254 | 116 |
| 614 | 3300026121 | Ga0207683_10047376 | Ga0207683_100473767 | 116 |
| 615 | 3300028380 | Ga0268265_10415830 | Ga0268265_104158302 | 116 |
| 616 | 3300028381 | Ga0268264_11428742 | Ga0268264_114287422 | 116 |
| 617 | 3300041498 | Ga0451841_0364395 | Ga0451841_0364395_494_862 | 116 |
| 618 | 3300005338 | Ga0068868_100063280 | Ga0068868_1000632803 | 117 |
| 619 | 3300005347 | Ga0070668_100497955 | Ga0070668_1004979551 | 117 |
| 620 | 3300005355 | Ga0070671_100005816 | Ga0070671_1000058167 | 117 |
| 621 | 3300005440 | Ga0070705_100132254 | Ga0070705_1001322543 | 117 |
| 622 | 3300005459 | Ga0068867_100211391 | Ga0068867_1002113912 | 117 |
| 623 | 3300005844 | Ga0068862_100562815 | Ga0068862_1005628153 | 117 |
| 624 | 3300006237 | Ga0097621_100956602 | Ga0097621_1009566022 | 117 |
| 625 | 3300009101 | Ga0105247_10808752 | Ga0105247_108087521 | 117 |
| 626 | 3300013297 | Ga0157378_10022574 | Ga0157378_100225746 | 117 |
| 627 | 3300013306 | Ga0163162_10104702 | Ga0163162_101047022 | 117 |
| 628 | 3300014325 | Ga0163163_10041419 | Ga0163163_100414195 | 117 |
| 629 | 3300014326 | Ga0157380_10213542 | Ga0157380_102135422 | 117 |
| 630 | 3300017792 | Ga0163161_11909107 | Ga0163161_119091072 | 117 |
| 631 | 3300025903 | Ga0207680_10161290 | Ga0207680_101612901 | 117 |
| 632 | 3300025907 | Ga0207645_10619758 | Ga0207645_106197582 | 117 |
| 633 | 3300025931 | Ga0207644_10107214 | Ga0207644_101072143 | 117 |
| 634 | 3300025972 | Ga0207668_10344710 | Ga0207668_103447102 | 117 |
| 635 | 3300025972 | Ga0207668_10618915 | Ga0207668_106189152 | 117 |
| 636 | 3300026023 | Ga0207677_10151160 | Ga0207677_101511602 | 117 |
| 637 | 3300031731 | Ga0307405_10096808 | Ga0307405_100968083 | 117 |
| 638 | 3300031901 | Ga0307406_10101260 | Ga0307406_101012603 | 117 |
| 639 | 3300046615 | Ga0495656_0006617 | Ga0495656_0006617_1843_2214 | 117 |
| 640 | 3300047318 | Ga0495636_0005345 | Ga0495636_0005345_4481_4852 | 117 |
| 641 | 3300049824 | Ga0501045_0260855 | Ga0501045_0260855_182_553 | 117 |
| 642 | 3300005330 | Ga0070690_100256499 | Ga0070690_1002564992 | 118 |
| 643 | 3300005344 | Ga0070661_100171394 | Ga0070661_1001713942 | 118 |
| 644 | 3300005355 | Ga0070671_100371048 | Ga0070671_1003710482 | 118 |
| 645 | 3300005841 | Ga0068863_100005809 | Ga0068863_1000058099 | 118 |
| 646 | 3300005842 | Ga0068858_100018432 | Ga0068858_1000184324 | 118 |
| 647 | 3300005843 | Ga0068860_100016950 | Ga0068860_1000169502 | 118 |
| 648 | 3300006358 | Ga0068871_100115364 | Ga0068871_1001153643 | 118 |
| 649 | 3300009098 | Ga0105245_10412452 | Ga0105245_104124522 | 118 |
| 650 | 3300009177 | Ga0105248_10810777 | Ga0105248_108107771 | 118 |
| 651 | 3300009553 | Ga0105249_10216348 | Ga0105249_102163483 | 118 |
| 652 | 3300010375 | Ga0105239_10017865 | Ga0105239_100178652 | 118 |
| 653 | 3300011119 | Ga0105246_11961239 | Ga0105246_119612392 | 118 |
| 654 | 3300013296 | Ga0157374_10611992 | Ga0157374_106119922 | 118 |
| 655 | 3300014325 | Ga0163163_10000117 | Ga0163163_1000011753 | 118 |
| 656 | 3300014325 | Ga0163163_10005924 | Ga0163163_100059249 | 118 |
| 657 | 3300014968 | Ga0157379_10002783 | Ga0157379_100027832 | 118 |
| 658 | 3300025920 | Ga0207649_10260924 | Ga0207649_102609241 | 118 |
| 659 | 3300025927 | Ga0207687_10299892 | Ga0207687_102998922 | 118 |
| 660 | 3300025941 | Ga0207711_11290281 | Ga0207711_112902811 | 118 |
| 661 | 3300025961 | Ga0207712_10168580 | Ga0207712_101685803 | 118 |
| 662 | 3300025986 | Ga0207658_11543487 | Ga0207658_115434871 | 118 |
| 663 | 3300026088 | Ga0207641_10207363 | Ga0207641_102073632 | 118 |
| 664 | 3300026088 | Ga0207641_10352228 | Ga0207641_103522282 | 118 |
| 665 | 3300026095 | Ga0207676_10025226 | Ga0207676_100252263 | 118 |
| 666 | 3300028381 | Ga0268264_10014295 | Ga0268264_100142957 | 118 |
| 667 | 3300002077 | JGI24744J21845_10028155 | JGI24744J21845_100281551 | 119 |
| 668 | 3300005335 | Ga0070666_10000243 | Ga0070666_1000024325 | 119 |
| 669 | 3300013297 | Ga0157378_10061661 | Ga0157378_100616614 | 119 |
| 670 | 3300025903 | Ga0207680_10000114 | Ga0207680_1000011411 | 119 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mns-assembly1.cif.gz_B | crystal structure of the znf4 of nucleoporin nup358/ranbp2 in complex with ran-gdp | 0.8097 | 13 | 36 |
| 4s1z-assembly1.cif.gz_G | crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin | 0.8049 | 13 | 36 |
| 7mnt-assembly2.cif.gz_D | crystal structure of the znf5 or znf6 of nucleoporin nup358/ranbp2 in complex with ran-gdp | 0.7975 | 13 | 38 |
| 7mnu-assembly1.cif.gz_B | crystal structure of the znf7 of nucleoporin nup358/ranbp2 in complex with ran-gdp | 0.7948 | 13 | 38 |
| 6cfj-assembly1.cif.gz_15 | crystal structure of the thermus thermophilus 70s ribosome in complex with histidyl-cam and bound to mrna and a-, p-, and e-site trnas at 2.8a resolution | 0.7935 | 9 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50414_43_217_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9023 | 69 | 86 | 3.30.420.10 |
| af_Q54UQ6_98_225_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.8374 | 13 | 42 | 1.10.287.110 |
| af_Q57859_1_190_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7661 | 13 | 45 | 1.25.10.10 |
| af_Q9U0J7_91_204_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7308 | 69 | 86 | 3.30.420.40 |
| 3wnoB01 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7055 | 52 | 105 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H2XB56-F1-model_v4 | Uncharacterized protein | 0.8913 | 51 | 118 |
|
| AF-A0A2V6SPW6-F1-model_v4 | DUF35 domain-containing protein | 0.8837 | 9 | 110 |
|
| AF-A0A7X7PVS5-F1-model_v4 | Zinc ribbon domain-containing protein | 0.8747 | 7 | 105 |
|
| AF-A0A4Q2WTT4-F1-model_v4 | Zinc ribbon domain-containing protein | 0.8746 | 6 | 109 |
|
| AF-A0A2K1PZW2-F1-model_v4 | Zinc ribbon domain-containing protein | 0.8675 | 5 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar