F474079

General Info

Members Datasets Scaffolds Average Seq Length
670 241 1340 217

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10023544|Ga0105248_100235443
Length 262
Sequence MTEENTTQETVADVEAPEVVKSEAGDNAPAAARASVDGAAPDEPVDEAALNEEASRELAALLAEEESATAMDAETPSDDEAISAPRSDADRSAIIEALIFVSEEPLSTKILADVLKLDKAVVEESLSKLAAEFNARQGGLQLREVAGGWQFATRAEFHEHVRAFLKTRPSAKLSIASLETLAVIAYRQPITVPEILEIRGVQSPSSIKTLLDKKLIVAKGRKETVGRPMMYGTSKEFLLQFGLKDLTELPSVEDFHDLSGGS

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
208 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
213 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
214 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
215 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
216 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
217 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
218 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
219 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
220 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
221 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
222 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
223 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
224 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
227 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
228 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.24
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 19.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10023544 3300009177 Bacteria 6841
2 CNAas_1000335 3300000532 Bacteria 4494
3 JGI24751J29686_10000124 3300002459 Bacteria 38798
4 JGI25406J46586_10005742 3300003203 Bacteria 5735
5 JGI25406J46586_10057381 3300003203 Bacteria 1273
6 rootH2_10184911 3300003320 Bacteria 1596
7 Ga0065714_10064699 3300005288 Bacteria 22868
8 Ga0065704_10096161 3300005289 Bacteria 2455
9 Ga0065704_10401307 3300005289 Bacteria 751
10 Ga0065712_10000190 3300005290 Bacteria 22861
11 Ga0065712_10002216 3300005290 Bacteria 7608
12 Ga0065712_10022549 3300005290 Bacteria 1822
13 Ga0065712_10075121 3300005290 Unclassified 3908
14 Ga0065712_10078661 3300005290 Bacteria 3315
15 Ga0065715_10018468 3300005293 Unclassified 1728
16 Ga0065715_10090104 3300005293 Bacteria 7661
17 Ga0065715_10100443 3300005293 Bacteria 3301
18 Ga0065715_10115784 3300005293 Unclassified 2403
19 Ga0065715_10166106 3300005293 Bacteria 1580
20 Ga0065715_10169198 3300005293 Bacteria 1561
21 Ga0065715_10328980 3300005293 Unclassified 971
22 Ga0065707_10003373 3300005295 Bacteria 7309
23 Ga0065707_10011748 3300005295 Bacteria 2684
24 Ga0070676_10072629 3300005328 Bacteria 2069
25 Ga0070690_100000655 3300005330 Bacteria 17679
26 Ga0070690_100041221 3300005330 Bacteria 2922
27 Ga0070690_100083747 3300005330 Unclassified 2090
28 Ga0070690_100556867 3300005330 Bacteria 865
29 Ga0070670_100006837 3300005331 Bacteria 9666
30 Ga0070670_100034607 3300005331 Bacteria 4347
31 Ga0070670_100076390 3300005331 Bacteria 2878
32 Ga0068869_100005926 3300005334 Bacteria 7722
33 Ga0068869_100011452 3300005334 Bacteria 5816
34 Ga0068869_100022751 3300005334 Bacteria 4323
35 Ga0068869_100121408 3300005334 Bacteria 1999
36 Ga0068869_100853052 3300005334 Archaea 786
37 Ga0070666_10112543 3300005335 Bacteria 1883
38 Ga0070680_100000904 3300005336 Bacteria 21000
39 Ga0070680_100050493 3300005336 Bacteria 3393
40 Ga0070680_100463248 3300005336 Unclassified 1083
41 Ga0070680_100548884 3300005336 Unclassified 990
42 Ga0070682_100000247 3300005337 Bacteria 39158
43 Ga0070682_100016945 3300005337 Bacteria 4241
44 Ga0068868_100024317 3300005338 Bacteria 4595
45 Ga0068868_100108101 3300005338 Unclassified 2257
46 Ga0070660_100332727 3300005339 Bacteria 1249
47 Ga0070689_100001242 3300005340 Bacteria 16238
48 Ga0070689_100032190 3300005340 Bacteria 3987
49 Ga0070689_100034352 3300005340 Unclassified 3868
50 Ga0070687_100027785 3300005343 Bacteria 2737
51 Ga0070687_100029357 3300005343 Bacteria 2677
52 Ga0070687_100558465 3300005343 Unclassified 780
53 Ga0070661_100195443 3300005344 Bacteria 1544
54 Ga0070661_100258428 3300005344 Unclassified 1346
55 Ga0070692_10022205 3300005345 Bacteria 3097
56 Ga0070692_10080788 3300005345 Bacteria 1750
57 Ga0070692_10111594 3300005345 Bacteria 1513
58 Ga0070692_10158261 3300005345 Unclassified 1296
59 Ga0070692_10161242 3300005345 Bacteria 1285
60 Ga0070692_10432965 3300005345 Unclassified 838
61 Ga0070668_100216640 3300005347 Bacteria 1577
62 Ga0070669_100008192 3300005353 Bacteria 7465
63 Ga0070669_100026565 3300005353 Bacteria 4165
64 Ga0070669_100026747 3300005353 Bacteria 4151
65 Ga0070669_100040352 3300005353 Bacteria 3393
66 Ga0070669_100159870 3300005353 Bacteria 1750
67 Ga0070669_100473790 3300005353 Bacteria 1035
68 Ga0070675_100119413 3300005354 Bacteria 2239
69 Ga0070675_100410277 3300005354 Bacteria 1210
70 Ga0070671_100142698 3300005355 Bacteria 2021
71 Ga0070671_100168100 3300005355 Bacteria 1854
72 Ga0070674_100013739 3300005356 Bacteria 5011
73 Ga0070674_100169252 3300005356 Bacteria 1664
74 Ga0070673_100096399 3300005364 Bacteria 2427
75 Ga0070673_100206012 3300005364 Bacteria 1696
76 Ga0070673_100271671 3300005364 Bacteria 1484
77 Ga0070673_100276830 3300005364 Bacteria 1470
78 Ga0070688_100207155 3300005365 Bacteria 1375
79 Ga0070667_100034578 3300005367 Unclassified 4229
80 Ga0070701_10002799 3300005438 Bacteria 6782
81 Ga0070701_10007700 3300005438 Bacteria 4620
82 Ga0070701_10077350 3300005438 Unclassified 1793
83 Ga0070705_100056982 3300005440 Unclassified 2303
84 Ga0070705_100203403 3300005440 Bacteria 1360
85 Ga0070705_100225286 3300005440 Bacteria 1301
86 Ga0070705_100552966 3300005440 Bacteria 883
87 Ga0070700_100017169 3300005441 Bacteria 4133
88 Ga0070700_100125062 3300005441 Bacteria 1728
89 Ga0070700_100144381 3300005441 Unclassified 1621
90 Ga0070700_100337359 3300005441 Unclassified 1113
91 Ga0070694_100003260 3300005444 Bacteria 9690
92 Ga0070694_100005870 3300005444 Bacteria 7448
93 Ga0070694_100024584 3300005444 Bacteria 3889
94 Ga0070694_100060655 3300005444 Bacteria 2580
95 Ga0070694_100075275 3300005444 Bacteria 2335
96 Ga0070694_100075973 3300005444 Bacteria 2325
97 Ga0070694_100086133 3300005444 Bacteria 2195
98 Ga0070694_100087365 3300005444 Unclassified 2181
99 Ga0070694_100131261 3300005444 Bacteria 1810
100 Ga0070694_100149931 3300005444 Unclassified 1702
101 Ga0070694_100227478 3300005444 Bacteria 1402
102 Ga0070694_100656345 3300005444 Unclassified 849
103 Ga0070708_100013004 3300005445 Bacteria 6802
104 Ga0070708_100064970 3300005445 Bacteria 3271
105 Ga0070708_100176631 3300005445 Bacteria 1996
106 Ga0070708_100500882 3300005445 Bacteria 1146
107 Ga0070662_100040431 3300005457 Bacteria 3320
108 Ga0070662_100087905 3300005457 Bacteria 2328
109 Ga0070662_100228942 3300005457 Bacteria 1486
110 Ga0070662_100257754 3300005457 Bacteria 1404
111 Ga0070662_100331807 3300005457 Bacteria 1243
112 Ga0070662_100440725 3300005457 Bacteria 1080
113 Ga0070681_10000208 3300005458 Bacteria 45856
114 Ga0070681_10070705 3300005458 Bacteria 3455
115 Ga0068867_100112300 3300005459 Bacteria 2095
116 Ga0068867_100169788 3300005459 Unclassified 1727
117 Ga0068867_100356639 3300005459 Bacteria 1222
118 Ga0068867_100447396 3300005459 Bacteria 1100
119 Ga0070685_10038660 3300005466 Bacteria 2707
120 Ga0070685_10245829 3300005466 Unclassified 1183
121 Ga0070706_100000300 3300005467 Bacteria 60347
122 Ga0070706_100001750 3300005467 Bacteria 22542
123 Ga0070706_100007845 3300005467 Bacteria 9979
124 Ga0070706_100037101 3300005467 Bacteria 4503
125 Ga0070706_100083567 3300005467 Bacteria 2958
126 Ga0070706_100124535 3300005467 Bacteria 2403
127 Ga0070706_100220221 3300005467 Bacteria 1772
128 Ga0070707_100019078 3300005468 Bacteria 6458
129 Ga0070707_100024885 3300005468 Bacteria 5674
130 Ga0070707_100038121 3300005468 Bacteria 4589
131 Ga0070707_100108966 3300005468 Bacteria 2686
132 Ga0070707_100192097 3300005468 Bacteria 1991
133 Ga0070698_100000186 3300005471 Bacteria 59002
134 Ga0070698_100006468 3300005471 Bacteria 12708
135 Ga0070698_100011452 3300005471 Bacteria 9411
136 Ga0070698_100018907 3300005471 Bacteria 7248
137 Ga0070698_100042134 3300005471 Bacteria 4683
138 Ga0070698_100135501 3300005471 Bacteria 2416
139 Ga0070698_100615223 3300005471 Unclassified 1027
140 Ga0070699_100004335 3300005518 Bacteria 12552
141 Ga0070699_100012184 3300005518 Bacteria 7421
142 Ga0070699_100021335 3300005518 Bacteria 5587
143 Ga0070699_100033485 3300005518 Bacteria 4439
144 Ga0070679_100000234 3300005530 Bacteria 45861
145 Ga0070684_100760160 3300005535 Bacteria 905
146 Ga0070697_100000462 3300005536 Bacteria 31136
147 Ga0070697_100000629 3300005536 Bacteria 26760
148 Ga0070697_100002946 3300005536 Bacteria 13103
149 Ga0070697_100066294 3300005536 Unclassified 2952
150 Ga0070697_100395101 3300005536 Bacteria 1199
151 Ga0070697_100421541 3300005536 Bacteria 1160
152 Ga0068853_100071985 3300005539 Bacteria 3012
153 Ga0070672_100003144 3300005543 Bacteria 10667
154 Ga0070672_100140323 3300005543 Bacteria 1993
155 Ga0070672_100283172 3300005543 Unclassified 1402
156 Ga0070686_100012069 3300005544 Bacteria 4914
157 Ga0070686_100170706 3300005544 Bacteria 1538
158 Ga0070695_100018213 3300005545 Bacteria 4264
159 Ga0070695_100094092 3300005545 Bacteria 2006
160 Ga0070695_100135317 3300005545 Unclassified 1703
161 Ga0070695_100217603 3300005545 Bacteria 1374
162 Ga0070696_100025694 3300005546 Bacteria 4005
163 Ga0070696_100031729 3300005546 Bacteria 3623
164 Ga0070696_100163797 3300005546 Unclassified 1640
165 Ga0070696_100242662 3300005546 Unclassified 1360
166 Ga0070696_100309250 3300005546 Unclassified 1213
167 Ga0070696_100317955 3300005546 Bacteria 1197
168 Ga0070696_100358208 3300005546 Bacteria 1131
169 Ga0070693_100079653 3300005547 Bacteria 1950
170 Ga0070693_100260340 3300005547 Bacteria 1153
171 Ga0070693_100370880 3300005547 Unclassified 985
172 Ga0070665_100007580 3300005548 Bacteria 11036
173 Ga0070704_100022782 3300005549 Bacteria 4080
174 Ga0070704_100142612 3300005549 Bacteria 1873
175 Ga0070704_100581967 3300005549 Bacteria 982
176 Ga0070704_100621009 3300005549 Unclassified 952
177 Ga0068855_100932223 3300005563 Unclassified 916
178 Ga0070664_100124502 3300005564 Bacteria 2260
179 Ga0070664_100124769 3300005564 Bacteria 2257
180 Ga0070664_100354423 3300005564 Unclassified 1335
181 Ga0068857_100073751 3300005577 Unclassified 3041
182 Ga0068857_100488059 3300005577 Bacteria 1155
183 Ga0068857_100881102 3300005577 Unclassified 858
184 Ga0068854_100364219 3300005578 Bacteria 1187
185 Ga0068856_100011385 3300005614 Bacteria 8630
186 Ga0070702_100062060 3300005615 Bacteria 2178
187 Ga0070702_100096703 3300005615 Bacteria 1803
188 Ga0070702_100246959 3300005615 Bacteria 1207
189 Ga0068852_100085742 3300005616 Bacteria 2806
190 Ga0068859_100003869 3300005617 Bacteria 15295
191 Ga0068859_100010356 3300005617 Bacteria 9379
192 Ga0068859_100089100 3300005617 Bacteria 3135
193 Ga0068859_100143625 3300005617 Unclassified 2460
194 Ga0068859_100199661 3300005617 Bacteria 2084
195 Ga0068859_100247021 3300005617 Bacteria 1874
196 Ga0068859_100344183 3300005617 Bacteria 1585
197 Ga0068859_100348243 3300005617 Bacteria 1576
198 Ga0068859_100419486 3300005617 Unclassified 1434
199 Ga0068859_100964790 3300005617 Bacteria 935
200 Ga0068859_101111208 3300005617 Bacteria 870
201 Ga0068864_100007663 3300005618 Bacteria 8892
202 Ga0068864_100009621 3300005618 Bacteria 7973
203 Ga0068864_100057945 3300005618 Bacteria 3347
204 Ga0068864_100344265 3300005618 Bacteria 1405
205 Ga0068864_100450530 3300005618 Bacteria 1231
206 Ga0068864_100866566 3300005618 Unclassified 890
207 Ga0068866_10003780 3300005718 Bacteria 6207
208 Ga0068866_10007897 3300005718 Bacteria 4466
209 Ga0068861_100021833 3300005719 Bacteria 4604
210 Ga0068861_100251909 3300005719 Bacteria 1507
211 Ga0068851_10003965 3300005834 Bacteria 6629
212 Ga0068870_10399424 3300005840 Unclassified 894
213 Ga0068863_100023704 3300005841 Bacteria 5857
214 Ga0068863_100088998 3300005841 Unclassified 2926
215 Ga0068863_100213608 3300005841 Bacteria 1858
216 Ga0068863_100264823 3300005841 Bacteria 1662
217 Ga0068863_100286377 3300005841 Bacteria 1597
218 Ga0068863_100548647 3300005841 Bacteria 1141
219 Ga0068858_100008061 3300005842 Bacteria 10147
220 Ga0068858_100025337 3300005842 Bacteria 5520
221 Ga0068858_100026001 3300005842 Bacteria 5444
222 Ga0068858_100062983 3300005842 Unclassified 3430
223 Ga0068858_100204656 3300005842 Unclassified 1867
224 Ga0068858_100260931 3300005842 Bacteria 1647
225 Ga0068858_100338517 3300005842 Bacteria 1440
226 Ga0068858_100375926 3300005842 Bacteria 1363
227 Ga0068858_100487058 3300005842 Bacteria 1191
228 Ga0068860_100004176 3300005843 Bacteria 14803
229 Ga0068860_100035815 3300005843 Bacteria 4758
230 Ga0068860_100110677 3300005843 Bacteria 2625
231 Ga0068860_100178975 3300005843 Bacteria 2050
232 Ga0068860_100193148 3300005843 Bacteria 1970
233 Ga0068860_100222994 3300005843 Unclassified 1831
234 Ga0068860_100429404 3300005843 Bacteria 1311
235 Ga0068862_100007677 3300005844 Bacteria 8927
236 Ga0068862_100028867 3300005844 Bacteria 4673
237 Ga0068862_100131151 3300005844 Bacteria 2217
238 Ga0081539_10000990 3300005985 Bacteria 52811
239 Ga0081539_10003482 3300005985 Bacteria 19228
240 Ga0070715_10000058 3300006163 Bacteria 40861
241 Ga0070716_100000022 3300006173 Bacteria 77227
242 Ga0070716_100303182 3300006173 Unclassified 1112
243 Ga0070712_100506835 3300006175 Unclassified 1012
244 Ga0097621_100002413 3300006237 Bacteria 12792
245 Ga0097621_100075367 3300006237 Bacteria 2796
246 Ga0068871_100003267 3300006358 Bacteria 11121
247 Ga0068871_100003839 3300006358 Bacteria 10355
248 Ga0068871_100024273 3300006358 Bacteria 4699
249 Ga0068871_100113036 3300006358 Unclassified 2286
250 Ga0068871_100220886 3300006358 Bacteria 1642
251 Ga0075428_100433239 3300006844 Bacteria 1409
252 Ga0075428_100855104 3300006844 Bacteria 966
253 Ga0075430_100002421 3300006846 Bacteria 15540
254 Ga0075430_100043450 3300006846 Bacteria 3798
255 Ga0075431_100106446 3300006847 Bacteria 2893
256 Ga0075431_100167356 3300006847 Unclassified 2259
257 Ga0075431_101110694 3300006847 Bacteria 755
258 Ga0075433_10025677 3300006852 Unclassified 4981
259 Ga0075433_10075934 3300006852 Bacteria 2958
260 Ga0075433_10077014 3300006852 Bacteria 2937
261 Ga0075433_10129921 3300006852 Bacteria 2238
262 Ga0075433_10140509 3300006852 Bacteria 2146
263 Ga0075433_10153305 3300006852 Bacteria 2050
264 Ga0075434_100031119 3300006871 Bacteria 5260
265 Ga0075434_100101667 3300006871 Bacteria 2881
266 Ga0075429_100034935 3300006880 Bacteria 4369
267 Ga0075429_100107197 3300006880 Bacteria 2441
268 Ga0075429_100318953 3300006880 Unclassified 1360
269 Ga0075429_100771815 3300006880 Unclassified 842
270 Ga0068865_100342238 3300006881 Bacteria 1209
271 Ga0075436_100034866 3300006914 Bacteria 3471
272 Ga0075436_100258078 3300006914 Bacteria 1242
273 Ga0097620_100003869 3300006931 Bacteria 15295
274 Ga0097620_100010357 3300006931 Bacteria 9379
275 Ga0097620_100089099 3300006931 Bacteria 3135
276 Ga0097620_100143622 3300006931 Unclassified 2460
277 Ga0097620_100199654 3300006931 Bacteria 2084
278 Ga0097620_100247018 3300006931 Unclassified 1874
279 Ga0097620_100344193 3300006931 Bacteria 1585
280 Ga0097620_100348234 3300006931 Bacteria 1576
281 Ga0097620_100419471 3300006931 Unclassified 1434
282 Ga0097620_100964719 3300006931 Bacteria 935
283 Ga0097620_101111202 3300006931 Bacteria 870
284 Ga0075435_100012254 3300007076 Bacteria 6343
285 Ga0075435_100229650 3300007076 Bacteria 1577
286 Ga0105250_10068243 3300009092 Bacteria 1435
287 Ga0105240_10082588 3300009093 Unclassified 3945
288 Ga0111539_10004928 3300009094 Bacteria 17367
289 Ga0111539_10025068 3300009094 Bacteria 7310
290 Ga0111539_10035573 3300009094 Bacteria 6029
291 Ga0111539_10416977 3300009094 Unclassified 1564
292 Ga0111539_11296360 3300009094 Bacteria 845
293 Ga0105245_10064990 3300009098 Unclassified 3298
294 Ga0105245_11217924 3300009098 Unclassified 801
295 Ga0105245_11356961 3300009098 Unclassified 760
296 Ga0105247_10006097 3300009101 Bacteria 7493
297 Ga0105247_10021990 3300009101 Unclassified 3838
298 Ga0105247_10112879 3300009101 Unclassified 1751
299 Ga0114129_10000991 3300009147 Bacteria 37136
300 Ga0114129_10015308 3300009147 Bacteria 10913
301 Ga0114129_10065635 3300009147 Bacteria 5065
302 Ga0114129_10264209 3300009147 Bacteria 2305
303 Ga0114129_10382498 3300009147 Bacteria 1858
304 Ga0114129_10442835 3300009147 Bacteria 1705
305 Ga0114129_10495057 3300009147 Bacteria 1597
306 Ga0105243_10003457 3300009148 Bacteria 12770
307 Ga0105243_10014883 3300009148 Bacteria 5887
308 Ga0105243_10097505 3300009148 Unclassified 2433
309 Ga0105243_10213344 3300009148 Bacteria 1701
310 Ga0105243_10374177 3300009148 Bacteria 1315
311 Ga0105243_10407545 3300009148 Bacteria 1265
312 Ga0105243_10869708 3300009148 Unclassified 894
313 Ga0105241_10027849 3300009174 Bacteria 4208
314 Ga0105241_10028740 3300009174 Unclassified 4143
315 Ga0105241_10038295 3300009174 Bacteria 3614
316 Ga0105241_10063970 3300009174 Bacteria 2840
317 Ga0105241_10065108 3300009174 Bacteria 2816
318 Ga0105241_10178454 3300009174 Bacteria 1760
319 Ga0105241_10387075 3300009174 Bacteria 1223
320 Ga0105241_10648699 3300009174 Bacteria 958
321 Ga0105242_10006868 3300009176 Bacteria 8778
322 Ga0105242_10435063 3300009176 Unclassified 1233
323 Ga0105242_10618321 3300009176 Bacteria 1049
324 Ga0105242_10720447 3300009176 Bacteria 978
325 Ga0105248_10013406 3300009177 Bacteria 9022
326 Ga0105248_10082843 3300009177 Unclassified 3608
327 Ga0105248_10338061 3300009177 Bacteria 1695
328 Ga0105248_10426269 3300009177 Bacteria 1494
329 Ga0105248_10438545 3300009177 Bacteria 1471
330 Ga0105248_10872620 3300009177 Bacteria 1016
331 Ga0105237_10001358 3300009545 Bacteria 32392
332 Ga0105237_10434808 3300009545 Bacteria 1318
333 Ga0105238_10030819 3300009551 Bacteria 5458
334 Ga0105238_10043727 3300009551 Bacteria 4531
335 Ga0105249_10000270 3300009553 Bacteria 54601
336 Ga0105249_10001715 3300009553 Bacteria 19167
337 Ga0105249_10013942 3300009553 Bacteria 7105
338 Ga0105249_10035895 3300009553 Bacteria 4496
339 Ga0105249_10057376 3300009553 Bacteria 3567
340 Ga0105249_10062938 3300009553 Bacteria 3407
341 Ga0105249_10333918 3300009553 Bacteria 1530
342 Ga0105249_10354814 3300009553 Bacteria 1486
343 Ga0105239_10095919 3300010375 Unclassified 3276
344 Ga0105239_10117526 3300010375 Bacteria 2951
345 Ga0105239_10502194 3300010375 Bacteria 1379
346 Ga0105239_10877164 3300010375 Bacteria 1029
347 Ga0105246_10154710 3300011119 Bacteria 1740
348 Ga0157373_10002696 3300013100 Bacteria 13459
349 Ga0157373_10130510 3300013100 Bacteria 1767
350 Ga0157374_10008775 3300013296 Bacteria 8650
351 Ga0157374_10182733 3300013296 Bacteria 2049
352 Ga0157378_10023335 3300013297 Bacteria 5444
353 Ga0157378_10030695 3300013297 Bacteria 4746
354 Ga0157378_10031392 3300013297 Bacteria 4693
355 Ga0157378_10054660 3300013297 Bacteria 3555
356 Ga0157378_10307040 3300013297 Bacteria 1537
357 Ga0163162_10000006 3300013306 Bacteria 410012
358 Ga0163162_10000886 3300013306 Bacteria 27859
359 Ga0163162_10004640 3300013306 Bacteria 13247
360 Ga0163162_10070596 3300013306 Bacteria 3544
361 Ga0163162_10101987 3300013306 Bacteria 2962
362 Ga0163162_10324889 3300013306 Bacteria 1671
363 Ga0163162_10336463 3300013306 Bacteria 1642
364 Ga0163162_10389346 3300013306 Bacteria 1527
365 Ga0157372_10123881 3300013307 Bacteria 2971
366 Ga0157372_10160250 3300013307 Bacteria 2600
367 Ga0157372_10470383 3300013307 Bacteria 1465
368 Ga0157375_10013610 3300013308 Bacteria 7249
369 Ga0157375_10289838 3300013308 Bacteria 1800
370 Ga0157375_10708008 3300013308 Bacteria 1160
371 Ga0157375_10807103 3300013308 Bacteria 1087
372 Ga0157375_11199909 3300013308 Bacteria 890
373 Ga0163163_10001023 3300014325 Bacteria 23694
374 Ga0163163_10015100 3300014325 Bacteria 7126
375 Ga0163163_10018325 3300014325 Bacteria 6551
376 Ga0163163_10023667 3300014325 Bacteria 5832
377 Ga0163163_10073520 3300014325 Bacteria 3410
378 Ga0163163_10088216 3300014325 Bacteria 3113
379 Ga0163163_10115811 3300014325 Bacteria 2711
380 Ga0163163_10266366 3300014325 Bacteria 1765
381 Ga0163163_10294535 3300014325 Bacteria 1675
382 Ga0163163_11295901 3300014325 Unclassified 791
383 Ga0157380_10004621 3300014326 Bacteria 9565
384 Ga0157380_10009247 3300014326 Bacteria 7054
385 Ga0157380_10010004 3300014326 Bacteria 6808
386 Ga0157380_10166650 3300014326 Unclassified 1921
387 Ga0157380_11555955 3300014326 Bacteria 716
388 Ga0157377_10010317 3300014745 Bacteria 4618
389 Ga0157379_10040315 3300014968 Bacteria 4167
390 Ga0157379_10043022 3300014968 Bacteria 4033
391 Ga0157376_10010288 3300014969 Bacteria 6833
392 Ga0157376_10154280 3300014969 Unclassified 2074
393 Ga0157376_10666229 3300014969 Unclassified 1043
394 Ga0182007_10021250 3300015262 Bacteria 2307
395 Ga0163161_10033049 3300017792 Bacteria 3697
396 Ga0163161_10286012 3300017792 Bacteria 1295
397 Ga0207697_10009169 3300025315 Bacteria 4282
398 Ga0207653_10001441 3300025885 Bacteria 7715
399 Ga0207653_10133249 3300025885 Bacteria 903
400 Ga0207642_10018713 3300025899 Bacteria 2665
401 Ga0207710_10000612 3300025900 Bacteria 20901
402 Ga0207710_10184417 3300025900 Bacteria 1025
403 Ga0207710_10239958 3300025900 Unclassified 904
404 Ga0207710_10291490 3300025900 Unclassified 823
405 Ga0207647_10012882 3300025904 Bacteria 5810
406 Ga0207647_10042705 3300025904 Bacteria 2842
407 Ga0207643_10377114 3300025908 Unclassified 894
408 Ga0207684_10000367 3300025910 Bacteria 60978
409 Ga0207684_10002519 3300025910 Bacteria 18424
410 Ga0207684_10013044 3300025910 Bacteria 7194
411 Ga0207684_10014215 3300025910 Bacteria 6870
412 Ga0207684_10032421 3300025910 Bacteria 4443
413 Ga0207684_10185043 3300025910 Bacteria 1796
414 Ga0207654_10019734 3300025911 Unclassified 3564
415 Ga0207654_10076887 3300025911 Bacteria 1999
416 Ga0207654_10166844 3300025911 Bacteria 1426
417 Ga0207707_10000031 3300025912 Bacteria 159505
418 Ga0207707_10081637 3300025912 Bacteria 2822
419 Ga0207707_10105404 3300025912 Bacteria 2464
420 Ga0207695_10219939 3300025913 Bacteria 1807
421 Ga0207671_10002677 3300025914 Bacteria 18681
422 Ga0207660_10003912 3300025917 Bacteria 9706
423 Ga0207660_10302508 3300025917 Bacteria 1274
424 Ga0207660_10454062 3300025917 Bacteria 1037
425 Ga0207662_10000812 3300025918 Bacteria 14365
426 Ga0207649_10058680 3300025920 Bacteria 2411
427 Ga0207652_10000063 3300025921 Bacteria 113213
428 Ga0207652_10007007 3300025921 Bacteria 9086
429 Ga0207646_10036401 3300025922 Bacteria 4443
430 Ga0207646_10056822 3300025922 Bacteria 3497
431 Ga0207646_10112080 3300025922 Unclassified 2448
432 Ga0207646_10467655 3300025922 Unclassified 1137
433 Ga0207681_10021975 3300025923 Bacteria 4063
434 Ga0207681_10033280 3300025923 Bacteria 3378
435 Ga0207681_10035562 3300025923 Unclassified 3283
436 Ga0207681_10355200 3300025923 Bacteria 1174
437 Ga0207681_10520760 3300025923 Unclassified 976
438 Ga0207694_10004212 3300025924 Bacteria 11255
439 Ga0207694_10024837 3300025924 Bacteria 4551
440 Ga0207650_10000022 3300025925 Bacteria 318878
441 Ga0207650_10028520 3300025925 Bacteria 4004
442 Ga0207650_10056379 3300025925 Bacteria 2919
443 Ga0207650_10229120 3300025925 Unclassified 1498
444 Ga0207659_10257711 3300025926 Unclassified 1418
445 Ga0207687_10375405 3300025927 Bacteria 1164
446 Ga0207644_10045714 3300025931 Bacteria 3116
447 Ga0207644_10118665 3300025931 Bacteria 2010
448 Ga0207690_10345163 3300025932 Bacteria 1176
449 Ga0207690_10377382 3300025932 Unclassified 1126
450 Ga0207706_10103386 3300025933 Bacteria 2506
451 Ga0207706_10292417 3300025933 Bacteria 1420
452 Ga0207706_10563932 3300025933 Unclassified 980
453 Ga0207686_10000896 3300025934 Bacteria 17983
454 Ga0207686_10036362 3300025934 Bacteria 2964
455 Ga0207686_10569892 3300025934 Unclassified 887
456 Ga0207709_10003946 3300025935 Bacteria 8656
457 Ga0207709_10071774 3300025935 Bacteria 2200
458 Ga0207709_10089479 3300025935 Bacteria 2007
459 Ga0207709_10092693 3300025935 Bacteria 1978
460 Ga0207709_10184180 3300025935 Bacteria 1477
461 Ga0207709_10418646 3300025935 Bacteria 1028
462 Ga0207709_10557308 3300025935 Bacteria 902
463 Ga0207670_10001276 3300025936 Bacteria 13298
464 Ga0207669_10047502 3300025937 Bacteria 2544
465 Ga0207669_10125458 3300025937 Bacteria 1753
466 Ga0207704_10389539 3300025938 Bacteria 1096
467 Ga0207665_10000037 3300025939 Bacteria 86011
468 Ga0207665_10124339 3300025939 Bacteria 1825
469 Ga0207665_10141105 3300025939 Bacteria 1718
470 Ga0207691_10005451 3300025940 Bacteria 12285
471 Ga0207691_10209765 3300025940 Bacteria 1693
472 Ga0207711_10008398 3300025941 Bacteria 8639
473 Ga0207711_10073436 3300025941 Bacteria 2972
474 Ga0207711_10145489 3300025941 Unclassified 2135
475 Ga0207711_10164419 3300025941 Bacteria 2011
476 Ga0207711_10266037 3300025941 Bacteria 1577
477 Ga0207711_10597575 3300025941 Bacteria 1030
478 Ga0207689_10003658 3300025942 Bacteria 14026
479 Ga0207689_10049346 3300025942 Bacteria 3472
480 Ga0207689_10080505 3300025942 Bacteria 2677
481 Ga0207689_10108970 3300025942 Bacteria 2276
482 Ga0207689_10214153 3300025942 Bacteria 1592
483 Ga0207679_10247165 3300025945 Unclassified 1514
484 Ga0207651_10068012 3300025960 Bacteria 2509
485 Ga0207651_10173945 3300025960 Bacteria 1701
486 Ga0207651_10221085 3300025960 Bacteria 1531
487 Ga0207651_10307774 3300025960 Bacteria 1320
488 Ga0207712_10000427 3300025961 Bacteria 35976
489 Ga0207712_10006337 3300025961 Bacteria 7465
490 Ga0207712_10011656 3300025961 Bacteria 5602
491 Ga0207668_10164091 3300025972 Bacteria 1734
492 Ga0207640_10052574 3300025981 Bacteria 2654
493 Ga0207640_10146647 3300025981 Bacteria 1728
494 Ga0207640_10199055 3300025981 Bacteria 1517
495 Ga0207658_10046057 3300025986 Unclassified 3183
496 Ga0207677_10011656 3300026023 Bacteria 5018
497 Ga0207703_10092591 3300026035 Bacteria 2544
498 Ga0207703_11029549 3300026035 Unclassified 790
499 Ga0207639_10080979 3300026041 Bacteria 2570
500 Ga0207678_10683838 3300026067 Unclassified 902
501 Ga0207708_10000475 3300026075 Bacteria 31007
502 Ga0207708_10011065 3300026075 Bacteria 6709
503 Ga0207708_10019347 3300026075 Bacteria 5131
504 Ga0207708_10061303 3300026075 Unclassified 2872
505 Ga0207708_10070831 3300026075 Bacteria 2670
506 Ga0207708_10091419 3300026075 Bacteria 2347
507 Ga0207708_10129267 3300026075 Unclassified 1974
508 Ga0207708_10372814 3300026075 Bacteria 1175
509 Ga0207702_10066529 3300026078 Bacteria 3089
510 Ga0207641_10035508 3300026088 Bacteria 4153
511 Ga0207641_10382880 3300026088 Bacteria 1347
512 Ga0207648_10003674 3300026089 Bacteria 16053
513 Ga0207648_10017003 3300026089 Bacteria 6629
514 Ga0207648_10084569 3300026089 Bacteria 2767
515 Ga0207648_10188564 3300026089 Unclassified 1827
516 Ga0207648_10249848 3300026089 Bacteria 1581
517 Ga0207648_10358418 3300026089 Bacteria 1316
518 Ga0207676_10002189 3300026095 Bacteria 14090
519 Ga0207676_10011223 3300026095 Bacteria 6399
520 Ga0207676_10022952 3300026095 Bacteria 4595
521 Ga0207676_10136795 3300026095 Unclassified 2091
522 Ga0207676_10246062 3300026095 Bacteria 1607
523 Ga0207676_10249160 3300026095 Bacteria 1598
524 Ga0207676_10256978 3300026095 Bacteria 1575
525 Ga0207676_10638121 3300026095 Unclassified 1027
526 Ga0207676_10862725 3300026095 Unclassified 886
527 Ga0207674_10002619 3300026116 Bacteria 22514
528 Ga0207674_10038296 3300026116 Bacteria 4978
529 Ga0207674_10128152 3300026116 Unclassified 2502
530 Ga0207674_10203627 3300026116 Bacteria 1928
531 Ga0207674_10216296 3300026116 Bacteria 1864
532 Ga0207674_10405352 3300026116 Unclassified 1318
533 Ga0207675_100002337 3300026118 Bacteria 18795
534 Ga0207675_100006763 3300026118 Bacteria 10845
535 Ga0207675_100231535 3300026118 Bacteria 1783
536 Ga0207675_100241386 3300026118 Bacteria 1746
537 Ga0207675_100331902 3300026118 Bacteria 1487
538 Ga0207675_100347027 3300026118 Bacteria 1454
539 Ga0207683_10012581 3300026121 Bacteria 7220
540 Ga0207683_10079345 3300026121 Unclassified 2910
541 Ga0207698_10440148 3300026142 Bacteria 1256
542 Ga0209588_1062563 3300027671 Unclassified 1203
543 Ga0207428_10002811 3300027907 Bacteria 17298
544 Ga0207428_10060297 3300027907 Bacteria 3006
545 Ga0207428_10259851 3300027907 Bacteria 1293
546 Ga0268266_10051215 3300028379 Bacteria 3544
547 Ga0268265_10025103 3300028380 Unclassified 4225
548 Ga0268265_10459308 3300028380 Bacteria 1191
549 Ga0268265_10502451 3300028380 Unclassified 1143
550 Ga0268265_10704721 3300028380 Unclassified 976
551 Ga0268264_10083244 3300028381 Unclassified 2740
552 Ga0268264_10123810 3300028381 Bacteria 2282
553 Ga0268264_10126012 3300028381 Bacteria 2263
554 Ga0268264_10174546 3300028381 Bacteria 1947
555 Ga0268264_10204288 3300028381 Bacteria 1809
556 Ga0268264_10272259 3300028381 Bacteria 1582
557 Ga0268264_10489912 3300028381 Bacteria 1197
558 Ga0268264_10661991 3300028381 Bacteria 1034
559 Ga0307408_100139362 3300031548 Bacteria 1902
560 Ga0307408_100291978 3300031548 Bacteria 1362
561 Ga0307405_10009384 3300031731 Bacteria 5014
562 Ga0307405_10079546 3300031731 Bacteria 2137
563 Ga0307413_10174329 3300031824 Bacteria 1526
564 Ga0307410_10010691 3300031852 Bacteria 5215
565 Ga0307406_10018133 3300031901 Unclassified 4107
566 Ga0307406_10050799 3300031901 Bacteria 2631
567 Ga0307406_10167468 3300031901 Bacteria 1587
568 Ga0307407_10084102 3300031903 Bacteria 1932
569 Ga0307409_100048440 3300031995 Bacteria 3234
570 Ga0307409_100514470 3300031995 Bacteria 1168
571 Ga0307409_100607156 3300031995 Bacteria 1082
572 Ga0307416_100112568 3300032002 Bacteria 2402
573 Ga0307416_100315147 3300032002 Bacteria 1563
574 Ga0307416_100721472 3300032002 Bacteria 1087
575 Ga0307414_10007011 3300032004 Bacteria 6314
576 Ga0307415_100022869 3300032126 Bacteria 3868
577 Ga0307415_100165315 3300032126 Bacteria 1720
578 Ga0307415_100470970 3300032126 Bacteria 1091
579 Ga0373951_0017968 3300035091 Bacteria 1603
580 Ga0373923_0068110 3300035111 Bacteria 1524
581 Ga0373962_0013414 3300035242 Bacteria 2076
582 Ga0395900_0204001 3300037418 Bacteria 1999
583 Ga0395900_0300114 3300037418 Bacteria 1593
584 Ga0395898_0168195 3300037466 Bacteria 2096
585 Ga0395901_0079420 3300038443 Bacteria 3426
586 Ga0395901_0083356 3300038443 Bacteria 3342
587 Ga0242420_000462 3300038996 Unclassified 4599
588 Ga0439448_0016056 3300042005 Unclassified 2275
589 Ga0439434_0001281 3300042435 Bacteria 7238
590 Ga0453683_0561219 3300044673 Unclassified 743
591 Ga0495598_0001416 3300046537 Bacteria 4749
592 Ga0495621_0001089 3300046539 Bacteria 6974
593 Ga0495658_0171942 3300046683 Unclassified 1341
594 Ga0495636_0153007 3300047318 Bacteria 1036
595 Ga0496102_0085058 3300048905 Bacteria 2920
596 Ga0496103_0053641 3300048906 Bacteria 2499
597 Ga0496104_0086322 3300048907 Bacteria 2996
598 Ga0496104_0443480 3300048907 Bacteria 1210
599 Ga0496106_0429051 3300048909 Bacteria 1062
600 Ga0496107_0572854 3300048910 Unclassified 835
601 Ga0496108_0116239 3300048911 Bacteria 2291
602 Ga0496108_0405905 3300048911 Bacteria 1190
603 Ga0496109_0323881 3300048912 Unclassified 1455
604 Ga0496110_0169968 3300048913 Bacteria 1978
605 Ga0496112_0346386 3300048915 Unclassified 1429
606 Ga0496112_0446721 3300048915 Bacteria 1231
607 Ga0496112_0455523 3300048915 Unclassified 1217
608 Ga0496112_0907321 3300048915 Unclassified 803
609 Ga0496113_0215651 3300048916 Bacteria 1529
610 Ga0501291_015850 3300049514 Unclassified 1144
611 Ga0501292_013370 3300049515 Bacteria 1262
612 Ga0501299_007172 3300049522 Bacteria 1770
613 Ga0501038_0001729 3300049574 Bacteria 20311
614 Ga0501046_0670974 3300049580 Unclassified 732
615 Ga0501198_002605 3300049649 Bacteria 2435
616 Ga0501202_014784 3300049652 Bacteria 1496
617 Ga0501207_027589 3300049654 Unclassified 941
618 Ga0501217_012073 3300049661 Bacteria 1919
619 Ga0501217_019368 3300049661 Bacteria 1589
620 Ga0501224_012220 3300049664 Bacteria 1264
621 Ga0501227_025808 3300049665 Unclassified 1381
622 Ga0501228_010082 3300049666 Unclassified 933
623 Ga0501230_003063 3300049667 Bacteria 2187
624 Ga0501233_030735 3300049668 Bacteria 1212
625 Ga0501235_009013 3300049669 Bacteria 2178
626 Ga0501235_009645 3300049669 Bacteria 2109
627 Ga0501235_011194 3300049669 Bacteria 1965
628 Ga0501235_027355 3300049669 Bacteria 1279
629 Ga0501240_001415 3300049673 Bacteria 2330
630 Ga0501246_003977 3300049676 Unclassified 1207
631 Ga0501257_042047 3300049686 Unclassified 1124
632 Ga0501225_0015887 3300049705 Bacteria 2092
633 Ga0501229_020953 3300049706 Unclassified 866
634 Ga0501273_001699 3300049770 Bacteria 2145
635 Ga0501283_001299 3300049779 Bacteria 3278
636 Ga0501045_0553342 3300049824 Bacteria 853
637 Ga0501226_005363 3300049853 Bacteria 1463
638 nmdc:mga05p37_126490_c1 3300050507 Bacteria 3138
639 nmdc:mga05p37_22616_c1 3300050507 Bacteria 7623
640 nmdc:mga05p37_392036_c1 3300050507 Bacteria 1624
641 nmdc:mga05p37_412964_c1 3300050507 Bacteria 1573
642 nmdc:mga05p37_50905_c1 3300050507 Bacteria 5093
643 nmdc:mga05p37_71543_c1 3300050507 Bacteria 4266
644 nmdc:mga05p37_72899_c1 3300050507 Unclassified 4226
645 nmdc:mga05p37_945873_c1 3300050507 Unclassified 923
646 nmdc:mga09592_322336_c1 3300050508 Bacteria 1338
647 nmdc:mga09592_399195_c1 3300050508 Bacteria 1188
648 nmdc:mga0qj67_141918_c1 3300050509 Bacteria 1948
649 nmdc:mga0qj67_96650_c1 3300050509 Bacteria 2378
650 nmdc:mga06r32_1051533_c1 3300050510 Bacteria 765
651 nmdc:mga06r32_143477_c1 3300050510 Bacteria 2365
652 nmdc:mga08y16_303666_c1 3300050511 Unclassified 1645
653 nmdc:mga08y16_39284_c1 3300050511 Bacteria 4966
654 nmdc:mga08y16_756222_c1 3300050511 Bacteria 968
655 nmdc:mga08y16_82524_c1 3300050511 Bacteria 3351
656 nmdc:mga0n895_138145_c1 3300050512 Bacteria 2464
657 nmdc:mga0n895_198792_c1 3300050512 Bacteria 2036
658 nmdc:mga0n895_286204_c1 3300050512 Unclassified 1671
659 nmdc:mga0n895_33722_c1 3300050512 Unclassified 4921
660 nmdc:mga0n895_44747_c1 3300050512 Bacteria 4317
661 nmdc:mga0rr50_118967_c1 3300050513 Unclassified 2100
662 nmdc:mga0rr50_324460_c1 3300050513 Unclassified 1291
663 nmdc:mga0a205_140966_c1 3300050515 Bacteria 2311
664 nmdc:mga0a205_16606_c1 3300050515 Bacteria 6894
665 nmdc:mga0a205_198018_c1 3300050515 Bacteria 1900
666 nmdc:mga0a205_244876_c1 3300050515 Unclassified 1673
667 nmdc:mga0a205_882390_c1 3300050515 Unclassified 741
668 Ga0501084_0462978 3300054114 Unclassified 1072
669 Ga0501082_0356929 3300060353 Bacteria 1275
670 Ga0530510_0011461 3300061734 Bacteria 6220
671 Ga0105248_10023544
672 CNAas_1000335
673 JGI24751J29686_10000124
674 JGI25406J46586_10005742
675 JGI25406J46586_10057381
676 rootH2_10184911
677 Ga0065714_10064699
678 Ga0065704_10096161
679 Ga0065704_10401307
680 Ga0065712_10000190
681 Ga0065712_10002216
682 Ga0065712_10022549
683 Ga0065712_10075121
684 Ga0065712_10078661
685 Ga0065715_10018468
686 Ga0065715_10090104
687 Ga0065715_10100443
688 Ga0065715_10115784
689 Ga0065715_10166106
690 Ga0065715_10169198
691 Ga0065715_10328980
692 Ga0065707_10003373
693 Ga0065707_10011748
694 Ga0070676_10072629
695 Ga0070690_100000655
696 Ga0070690_100041221
697 Ga0070690_100083747
698 Ga0070690_100556867
699 Ga0070670_100006837
700 Ga0070670_100034607
701 Ga0070670_100076390
702 Ga0068869_100005926
703 Ga0068869_100011452
704 Ga0068869_100022751
705 Ga0068869_100121408
706 Ga0068869_100853052
707 Ga0070666_10112543
708 Ga0070680_100000904
709 Ga0070680_100050493
710 Ga0070680_100463248
711 Ga0070680_100548884
712 Ga0070682_100000247
713 Ga0070682_100016945
714 Ga0068868_100024317
715 Ga0068868_100108101
716 Ga0070660_100332727
717 Ga0070689_100001242
718 Ga0070689_100032190
719 Ga0070689_100034352
720 Ga0070687_100027785
721 Ga0070687_100029357
722 Ga0070687_100558465
723 Ga0070661_100195443
724 Ga0070661_100258428
725 Ga0070692_10022205
726 Ga0070692_10080788
727 Ga0070692_10111594
728 Ga0070692_10158261
729 Ga0070692_10161242
730 Ga0070692_10432965
731 Ga0070668_100216640
732 Ga0070669_100008192
733 Ga0070669_100026565
734 Ga0070669_100026747
735 Ga0070669_100040352
736 Ga0070669_100159870
737 Ga0070669_100473790
738 Ga0070675_100119413
739 Ga0070675_100410277
740 Ga0070671_100142698
741 Ga0070671_100168100
742 Ga0070674_100013739
743 Ga0070674_100169252
744 Ga0070673_100096399
745 Ga0070673_100206012
746 Ga0070673_100271671
747 Ga0070673_100276830
748 Ga0070688_100207155
749 Ga0070667_100034578
750 Ga0070701_10002799
751 Ga0070701_10007700
752 Ga0070701_10077350
753 Ga0070705_100056982
754 Ga0070705_100203403
755 Ga0070705_100225286
756 Ga0070705_100552966
757 Ga0070700_100017169
758 Ga0070700_100125062
759 Ga0070700_100144381
760 Ga0070700_100337359
761 Ga0070694_100003260
762 Ga0070694_100005870
763 Ga0070694_100024584
764 Ga0070694_100060655
765 Ga0070694_100075275
766 Ga0070694_100075973
767 Ga0070694_100086133
768 Ga0070694_100087365
769 Ga0070694_100131261
770 Ga0070694_100149931
771 Ga0070694_100227478
772 Ga0070694_100656345
773 Ga0070708_100013004
774 Ga0070708_100064970
775 Ga0070708_100176631
776 Ga0070708_100500882
777 Ga0070662_100040431
778 Ga0070662_100087905
779 Ga0070662_100228942
780 Ga0070662_100257754
781 Ga0070662_100331807
782 Ga0070662_100440725
783 Ga0070681_10000208
784 Ga0070681_10070705
785 Ga0068867_100112300
786 Ga0068867_100169788
787 Ga0068867_100356639
788 Ga0068867_100447396
789 Ga0070685_10038660
790 Ga0070685_10245829
791 Ga0070706_100000300
792 Ga0070706_100001750
793 Ga0070706_100007845
794 Ga0070706_100037101
795 Ga0070706_100083567
796 Ga0070706_100124535
797 Ga0070706_100220221
798 Ga0070707_100019078
799 Ga0070707_100024885
800 Ga0070707_100038121
801 Ga0070707_100108966
802 Ga0070707_100192097
803 Ga0070698_100000186
804 Ga0070698_100006468
805 Ga0070698_100011452
806 Ga0070698_100018907
807 Ga0070698_100042134
808 Ga0070698_100135501
809 Ga0070698_100615223
810 Ga0070699_100004335
811 Ga0070699_100012184
812 Ga0070699_100021335
813 Ga0070699_100033485
814 Ga0070679_100000234
815 Ga0070684_100760160
816 Ga0070697_100000462
817 Ga0070697_100000629
818 Ga0070697_100002946
819 Ga0070697_100066294
820 Ga0070697_100395101
821 Ga0070697_100421541
822 Ga0068853_100071985
823 Ga0070672_100003144
824 Ga0070672_100140323
825 Ga0070672_100283172
826 Ga0070686_100012069
827 Ga0070686_100170706
828 Ga0070695_100018213
829 Ga0070695_100094092
830 Ga0070695_100135317
831 Ga0070695_100217603
832 Ga0070696_100025694
833 Ga0070696_100031729
834 Ga0070696_100163797
835 Ga0070696_100242662
836 Ga0070696_100309250
837 Ga0070696_100317955
838 Ga0070696_100358208
839 Ga0070693_100079653
840 Ga0070693_100260340
841 Ga0070693_100370880
842 Ga0070665_100007580
843 Ga0070704_100022782
844 Ga0070704_100142612
845 Ga0070704_100581967
846 Ga0070704_100621009
847 Ga0068855_100932223
848 Ga0070664_100124502
849 Ga0070664_100124769
850 Ga0070664_100354423
851 Ga0068857_100073751
852 Ga0068857_100488059
853 Ga0068857_100881102
854 Ga0068854_100364219
855 Ga0068856_100011385
856 Ga0070702_100062060
857 Ga0070702_100096703
858 Ga0070702_100246959
859 Ga0068852_100085742
860 Ga0068859_100003869
861 Ga0068859_100010356
862 Ga0068859_100089100
863 Ga0068859_100143625
864 Ga0068859_100199661
865 Ga0068859_100247021
866 Ga0068859_100344183
867 Ga0068859_100348243
868 Ga0068859_100419486
869 Ga0068859_100964790
870 Ga0068859_101111208
871 Ga0068864_100007663
872 Ga0068864_100009621
873 Ga0068864_100057945
874 Ga0068864_100344265
875 Ga0068864_100450530
876 Ga0068864_100866566
877 Ga0068866_10003780
878 Ga0068866_10007897
879 Ga0068861_100021833
880 Ga0068861_100251909
881 Ga0068851_10003965
882 Ga0068870_10399424
883 Ga0068863_100023704
884 Ga0068863_100088998
885 Ga0068863_100213608
886 Ga0068863_100264823
887 Ga0068863_100286377
888 Ga0068863_100548647
889 Ga0068858_100008061
890 Ga0068858_100025337
891 Ga0068858_100026001
892 Ga0068858_100062983
893 Ga0068858_100204656
894 Ga0068858_100260931
895 Ga0068858_100338517
896 Ga0068858_100375926
897 Ga0068858_100487058
898 Ga0068860_100004176
899 Ga0068860_100035815
900 Ga0068860_100110677
901 Ga0068860_100178975
902 Ga0068860_100193148
903 Ga0068860_100222994
904 Ga0068860_100429404
905 Ga0068862_100007677
906 Ga0068862_100028867
907 Ga0068862_100131151
908 Ga0081539_10000990
909 Ga0081539_10003482
910 Ga0070715_10000058
911 Ga0070716_100000022
912 Ga0070716_100303182
913 Ga0070712_100506835
914 Ga0097621_100002413
915 Ga0097621_100075367
916 Ga0068871_100003267
917 Ga0068871_100003839
918 Ga0068871_100024273
919 Ga0068871_100113036
920 Ga0068871_100220886
921 Ga0075428_100433239
922 Ga0075428_100855104
923 Ga0075430_100002421
924 Ga0075430_100043450
925 Ga0075431_100106446
926 Ga0075431_100167356
927 Ga0075431_101110694
928 Ga0075433_10025677
929 Ga0075433_10075934
930 Ga0075433_10077014
931 Ga0075433_10129921
932 Ga0075433_10140509
933 Ga0075433_10153305
934 Ga0075434_100031119
935 Ga0075434_100101667
936 Ga0075429_100034935
937 Ga0075429_100107197
938 Ga0075429_100318953
939 Ga0075429_100771815
940 Ga0068865_100342238
941 Ga0075436_100034866
942 Ga0075436_100258078
943 Ga0097620_100003869
944 Ga0097620_100010357
945 Ga0097620_100089099
946 Ga0097620_100143622
947 Ga0097620_100199654
948 Ga0097620_100247018
949 Ga0097620_100344193
950 Ga0097620_100348234
951 Ga0097620_100419471
952 Ga0097620_100964719
953 Ga0097620_101111202
954 Ga0075435_100012254
955 Ga0075435_100229650
956 Ga0105250_10068243
957 Ga0105240_10082588
958 Ga0111539_10004928
959 Ga0111539_10025068
960 Ga0111539_10035573
961 Ga0111539_10416977
962 Ga0111539_11296360
963 Ga0105245_10064990
964 Ga0105245_11217924
965 Ga0105245_11356961
966 Ga0105247_10006097
967 Ga0105247_10021990
968 Ga0105247_10112879
969 Ga0114129_10000991
970 Ga0114129_10015308
971 Ga0114129_10065635
972 Ga0114129_10264209
973 Ga0114129_10382498
974 Ga0114129_10442835
975 Ga0114129_10495057
976 Ga0105243_10003457
977 Ga0105243_10014883
978 Ga0105243_10097505
979 Ga0105243_10213344
980 Ga0105243_10374177
981 Ga0105243_10407545
982 Ga0105243_10869708
983 Ga0105241_10027849
984 Ga0105241_10028740
985 Ga0105241_10038295
986 Ga0105241_10063970
987 Ga0105241_10065108
988 Ga0105241_10178454
989 Ga0105241_10387075
990 Ga0105241_10648699
991 Ga0105242_10006868
992 Ga0105242_10435063
993 Ga0105242_10618321
994 Ga0105242_10720447
995 Ga0105248_10013406
996 Ga0105248_10082843
997 Ga0105248_10338061
998 Ga0105248_10426269
999 Ga0105248_10438545
1000 Ga0105248_10872620
1001 Ga0105237_10001358
1002 Ga0105237_10434808
1003 Ga0105238_10030819
1004 Ga0105238_10043727
1005 Ga0105249_10000270
1006 Ga0105249_10001715
1007 Ga0105249_10013942
1008 Ga0105249_10035895
1009 Ga0105249_10057376
1010 Ga0105249_10062938
1011 Ga0105249_10333918
1012 Ga0105249_10354814
1013 Ga0105239_10095919
1014 Ga0105239_10117526
1015 Ga0105239_10502194
1016 Ga0105239_10877164
1017 Ga0105246_10154710
1018 Ga0157373_10002696
1019 Ga0157373_10130510
1020 Ga0157374_10008775
1021 Ga0157374_10182733
1022 Ga0157378_10023335
1023 Ga0157378_10030695
1024 Ga0157378_10031392
1025 Ga0157378_10054660
1026 Ga0157378_10307040
1027 Ga0163162_10000006
1028 Ga0163162_10000886
1029 Ga0163162_10004640
1030 Ga0163162_10070596
1031 Ga0163162_10101987
1032 Ga0163162_10324889
1033 Ga0163162_10336463
1034 Ga0163162_10389346
1035 Ga0157372_10123881
1036 Ga0157372_10160250
1037 Ga0157372_10470383
1038 Ga0157375_10013610
1039 Ga0157375_10289838
1040 Ga0157375_10708008
1041 Ga0157375_10807103
1042 Ga0157375_11199909
1043 Ga0163163_10001023
1044 Ga0163163_10015100
1045 Ga0163163_10018325
1046 Ga0163163_10023667
1047 Ga0163163_10073520
1048 Ga0163163_10088216
1049 Ga0163163_10115811
1050 Ga0163163_10266366
1051 Ga0163163_10294535
1052 Ga0163163_11295901
1053 Ga0157380_10004621
1054 Ga0157380_10009247
1055 Ga0157380_10010004
1056 Ga0157380_10166650
1057 Ga0157380_11555955
1058 Ga0157377_10010317
1059 Ga0157379_10040315
1060 Ga0157379_10043022
1061 Ga0157376_10010288
1062 Ga0157376_10154280
1063 Ga0157376_10666229
1064 Ga0182007_10021250
1065 Ga0163161_10033049
1066 Ga0163161_10286012
1067 Ga0207697_10009169
1068 Ga0207653_10001441
1069 Ga0207653_10133249
1070 Ga0207642_10018713
1071 Ga0207710_10000612
1072 Ga0207710_10184417
1073 Ga0207710_10239958
1074 Ga0207710_10291490
1075 Ga0207647_10012882
1076 Ga0207647_10042705
1077 Ga0207643_10377114
1078 Ga0207684_10000367
1079 Ga0207684_10002519
1080 Ga0207684_10013044
1081 Ga0207684_10014215
1082 Ga0207684_10032421
1083 Ga0207684_10185043
1084 Ga0207654_10019734
1085 Ga0207654_10076887
1086 Ga0207654_10166844
1087 Ga0207707_10000031
1088 Ga0207707_10081637
1089 Ga0207707_10105404
1090 Ga0207695_10219939
1091 Ga0207671_10002677
1092 Ga0207660_10003912
1093 Ga0207660_10302508
1094 Ga0207660_10454062
1095 Ga0207662_10000812
1096 Ga0207649_10058680
1097 Ga0207652_10000063
1098 Ga0207652_10007007
1099 Ga0207646_10036401
1100 Ga0207646_10056822
1101 Ga0207646_10112080
1102 Ga0207646_10467655
1103 Ga0207681_10021975
1104 Ga0207681_10033280
1105 Ga0207681_10035562
1106 Ga0207681_10355200
1107 Ga0207681_10520760
1108 Ga0207694_10004212
1109 Ga0207694_10024837
1110 Ga0207650_10000022
1111 Ga0207650_10028520
1112 Ga0207650_10056379
1113 Ga0207650_10229120
1114 Ga0207659_10257711
1115 Ga0207687_10375405
1116 Ga0207644_10045714
1117 Ga0207644_10118665
1118 Ga0207690_10345163
1119 Ga0207690_10377382
1120 Ga0207706_10103386
1121 Ga0207706_10292417
1122 Ga0207706_10563932
1123 Ga0207686_10000896
1124 Ga0207686_10036362
1125 Ga0207686_10569892
1126 Ga0207709_10003946
1127 Ga0207709_10071774
1128 Ga0207709_10089479
1129 Ga0207709_10092693
1130 Ga0207709_10184180
1131 Ga0207709_10418646
1132 Ga0207709_10557308
1133 Ga0207670_10001276
1134 Ga0207669_10047502
1135 Ga0207669_10125458
1136 Ga0207704_10389539
1137 Ga0207665_10000037
1138 Ga0207665_10124339
1139 Ga0207665_10141105
1140 Ga0207691_10005451
1141 Ga0207691_10209765
1142 Ga0207711_10008398
1143 Ga0207711_10073436
1144 Ga0207711_10145489
1145 Ga0207711_10164419
1146 Ga0207711_10266037
1147 Ga0207711_10597575
1148 Ga0207689_10003658
1149 Ga0207689_10049346
1150 Ga0207689_10080505
1151 Ga0207689_10108970
1152 Ga0207689_10214153
1153 Ga0207679_10247165
1154 Ga0207651_10068012
1155 Ga0207651_10173945
1156 Ga0207651_10221085
1157 Ga0207651_10307774
1158 Ga0207712_10000427
1159 Ga0207712_10006337
1160 Ga0207712_10011656
1161 Ga0207668_10164091
1162 Ga0207640_10052574
1163 Ga0207640_10146647
1164 Ga0207640_10199055
1165 Ga0207658_10046057
1166 Ga0207677_10011656
1167 Ga0207703_10092591
1168 Ga0207703_11029549
1169 Ga0207639_10080979
1170 Ga0207678_10683838
1171 Ga0207708_10000475
1172 Ga0207708_10011065
1173 Ga0207708_10019347
1174 Ga0207708_10061303
1175 Ga0207708_10070831
1176 Ga0207708_10091419
1177 Ga0207708_10129267
1178 Ga0207708_10372814
1179 Ga0207702_10066529
1180 Ga0207641_10035508
1181 Ga0207641_10382880
1182 Ga0207648_10003674
1183 Ga0207648_10017003
1184 Ga0207648_10084569
1185 Ga0207648_10188564
1186 Ga0207648_10249848
1187 Ga0207648_10358418
1188 Ga0207676_10002189
1189 Ga0207676_10011223
1190 Ga0207676_10022952
1191 Ga0207676_10136795
1192 Ga0207676_10246062
1193 Ga0207676_10249160
1194 Ga0207676_10256978
1195 Ga0207676_10638121
1196 Ga0207676_10862725
1197 Ga0207674_10002619
1198 Ga0207674_10038296
1199 Ga0207674_10128152
1200 Ga0207674_10203627
1201 Ga0207674_10216296
1202 Ga0207674_10405352
1203 Ga0207675_100002337
1204 Ga0207675_100006763
1205 Ga0207675_100231535
1206 Ga0207675_100241386
1207 Ga0207675_100331902
1208 Ga0207675_100347027
1209 Ga0207683_10012581
1210 Ga0207683_10079345
1211 Ga0207698_10440148
1212 Ga0209588_1062563
1213 Ga0207428_10002811
1214 Ga0207428_10060297
1215 Ga0207428_10259851
1216 Ga0268266_10051215
1217 Ga0268265_10025103
1218 Ga0268265_10459308
1219 Ga0268265_10502451
1220 Ga0268265_10704721
1221 Ga0268264_10083244
1222 Ga0268264_10123810
1223 Ga0268264_10126012
1224 Ga0268264_10174546
1225 Ga0268264_10204288
1226 Ga0268264_10272259
1227 Ga0268264_10489912
1228 Ga0268264_10661991
1229 Ga0307408_100139362
1230 Ga0307408_100291978
1231 Ga0307405_10009384
1232 Ga0307405_10079546
1233 Ga0307413_10174329
1234 Ga0307410_10010691
1235 Ga0307406_10018133
1236 Ga0307406_10050799
1237 Ga0307406_10167468
1238 Ga0307407_10084102
1239 Ga0307409_100048440
1240 Ga0307409_100514470
1241 Ga0307409_100607156
1242 Ga0307416_100112568
1243 Ga0307416_100315147
1244 Ga0307416_100721472
1245 Ga0307414_10007011
1246 Ga0307415_100022869
1247 Ga0307415_100165315
1248 Ga0307415_100470970
1249 Ga0373951_0017968
1250 Ga0373923_0068110
1251 Ga0373962_0013414
1252 Ga0395900_0204001
1253 Ga0395900_0300114
1254 Ga0395898_0168195
1255 Ga0395901_0079420
1256 Ga0395901_0083356
1257 Ga0242420_000462
1258 Ga0439448_0016056
1259 Ga0439434_0001281
1260 Ga0453683_0561219
1261 Ga0495598_0001416
1262 Ga0495621_0001089
1263 Ga0495658_0171942
1264 Ga0495636_0153007
1265 Ga0496102_0085058
1266 Ga0496103_0053641
1267 Ga0496104_0086322
1268 Ga0496104_0443480
1269 Ga0496106_0429051
1270 Ga0496107_0572854
1271 Ga0496108_0116239
1272 Ga0496108_0405905
1273 Ga0496109_0323881
1274 Ga0496110_0169968
1275 Ga0496112_0346386
1276 Ga0496112_0446721
1277 Ga0496112_0455523
1278 Ga0496112_0907321
1279 Ga0496113_0215651
1280 Ga0501291_015850
1281 Ga0501292_013370
1282 Ga0501299_007172
1283 Ga0501038_0001729
1284 Ga0501046_0670974
1285 Ga0501198_002605
1286 Ga0501202_014784
1287 Ga0501207_027589
1288 Ga0501217_012073
1289 Ga0501217_019368
1290 Ga0501224_012220
1291 Ga0501227_025808
1292 Ga0501228_010082
1293 Ga0501230_003063
1294 Ga0501233_030735
1295 Ga0501235_009013
1296 Ga0501235_009645
1297 Ga0501235_011194
1298 Ga0501235_027355
1299 Ga0501240_001415
1300 Ga0501246_003977
1301 Ga0501257_042047
1302 Ga0501225_0015887
1303 Ga0501229_020953
1304 Ga0501273_001699
1305 Ga0501283_001299
1306 Ga0501045_0553342
1307 Ga0501226_005363
1308 nmdc:mga05p37_126490_c1
1309 nmdc:mga05p37_22616_c1
1310 nmdc:mga05p37_392036_c1
1311 nmdc:mga05p37_412964_c1
1312 nmdc:mga05p37_50905_c1
1313 nmdc:mga05p37_71543_c1
1314 nmdc:mga05p37_72899_c1
1315 nmdc:mga05p37_945873_c1
1316 nmdc:mga09592_322336_c1
1317 nmdc:mga09592_399195_c1
1318 nmdc:mga0qj67_141918_c1
1319 nmdc:mga0qj67_96650_c1
1320 nmdc:mga06r32_1051533_c1
1321 nmdc:mga06r32_143477_c1
1322 nmdc:mga08y16_303666_c1
1323 nmdc:mga08y16_39284_c1
1324 nmdc:mga08y16_756222_c1
1325 nmdc:mga08y16_82524_c1
1326 nmdc:mga0n895_138145_c1
1327 nmdc:mga0n895_198792_c1
1328 nmdc:mga0n895_286204_c1
1329 nmdc:mga0n895_33722_c1
1330 nmdc:mga0n895_44747_c1
1331 nmdc:mga0rr50_118967_c1
1332 nmdc:mga0rr50_324460_c1
1333 nmdc:mga0a205_140966_c1
1334 nmdc:mga0a205_16606_c1
1335 nmdc:mga0a205_198018_c1
1336 nmdc:mga0a205_244876_c1
1337 nmdc:mga0a205_882390_c1
1338 Ga0501084_0462978
1339 Ga0501082_0356929
1340 Ga0530510_0011461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04079

SMC_ScpB

Segregation and condensation complex subunit ScpB

93

252

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6k-assembly2.cif.gz_E crystal structure of dimer of scpb n-terminal domain complexed with scpa peptide 0.8906 33 108
3w6k-assembly2.cif.gz_F crystal structure of dimer of scpb n-terminal domain complexed with scpa peptide 0.885 36 110
3w6k-assembly2.cif.gz_E crystal structure of dimer of scpb n-terminal domain complexed with scpa peptide 0.831 33 108
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.8246 33 94
7cv2-assembly1.cif.gz_A crystal structure of b. halodurans niar in niacin-bound form 0.8161 32 98
ID Description Score Start End Superfamily
4a12C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9119 31 73 1.10.10.10
2z99A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9081 31 111 1.10.10.10
4a0yA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8978 29 73 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8928 30 94 1.10.10.10
3w6kB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8905 36 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X8Z6V0-F1-model_v4 SMC-Scp complex subunit ScpB 0.899 30 118 GO:0005737
GO:0051301
GO:0051304
AF-A0A7X8Z6V0-F1-model_v4 SMC-Scp complex subunit ScpB 0.8804 30 118 GO:0005737
GO:0051301
GO:0051304
AF-A0A838U6Q3-F1-model_v4 SMC-Scp complex subunit ScpB 0.8516 21 118 GO:0005737
GO:0051301
GO:0051304
AF-A0A838U6Q3-F1-model_v4 SMC-Scp complex subunit ScpB 0.8282 21 118 GO:0005737
GO:0051301
GO:0051304
AF-A0A3C1H0S8-F1-model_v4 SMC-Scp complex subunit ScpB 0.8093 30 118 GO:0005737
GO:0051301
GO:0051304

Map