F474030

General Info

Members Datasets Scaffolds Average Seq Length
669 298 1338 72

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0621611|Ga0466958_0621611_412_675
Length 87
Sequence MRRAYTEMISRRRKDEWSLPQQLHAGGVRAWHLQCLSLGSVGLCIGLWIRAKTVDQDERGNAERRALFVGLWPPTIWLIGASLERHE

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 11.36
Rhizosphere 83.56
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0621611 3300045836 Bacteria 703
2 JGI24737J22298_10126827 3300001990 Bacteria 754
3 JGI24737J22298_10237343 3300001990 Bacteria 538
4 JGI24745J21846_1017083 3300002073 Bacteria 843
5 JGI24738J21930_10106420 3300002075 Bacteria 602
6 JGI24742J22300_10071322 3300002244 Bacteria 648
7 JGI25407J50210_10183408 3300003373 Unclassified 516
8 Ga0070658_10975043 3300005327 Bacteria 737
9 Ga0070658_11318953 3300005327 Bacteria 627
10 Ga0070676_11159112 3300005328 Bacteria 586
11 Ga0070683_100126932 3300005329 Bacteria 2412
12 Ga0070683_100678048 3300005329 Bacteria 987
13 Ga0070683_100965890 3300005329 Bacteria 818
14 Ga0068869_100059332 3300005334 Bacteria 2801
15 Ga0070682_100042933 3300005337 Bacteria 2794
16 Ga0068868_100004125 3300005338 Bacteria 10152
17 Ga0068868_100086294 3300005338 Bacteria 2523
18 Ga0068868_100189806 3300005338 Bacteria 1709
19 Ga0070660_100367024 3300005339 Bacteria 1187
20 Ga0070689_100042270 3300005340 Bacteria 3499
21 Ga0070689_100159423 3300005340 Bacteria 1823
22 Ga0070691_10381587 3300005341 Bacteria 790
23 Ga0070687_100065682 3300005343 Bacteria 1931
24 Ga0070661_100291986 3300005344 Bacteria 1267
25 Ga0070661_100642889 3300005344 Bacteria 861
26 Ga0070692_10156605 3300005345 Bacteria 1302
27 Ga0070668_100223769 3300005347 Bacteria 1553
28 Ga0070669_100557883 3300005353 Bacteria 956
29 Ga0070675_100021086 3300005354 Bacteria 5203
30 Ga0070671_101129669 3300005355 Bacteria 689
31 Ga0070674_100053305 3300005356 Bacteria 2792
32 Ga0070674_100576359 3300005356 Bacteria 948
33 Ga0070673_100082739 3300005364 Bacteria 2606
34 Ga0070673_100383547 3300005364 Bacteria 1253
35 Ga0070688_100010216 3300005365 Bacteria 5169
36 Ga0070688_100798736 3300005365 Bacteria 738
37 Ga0070659_100017863 3300005366 Bacteria 5343
38 Ga0070659_100160341 3300005366 Bacteria 1839
39 Ga0070659_100487531 3300005366 Bacteria 1049
40 Ga0070659_100658822 3300005366 Bacteria 903
41 Ga0070659_101817592 3300005366 Bacteria 546
42 Ga0070709_10045155 3300005434 Bacteria 2733
43 Ga0070714_100059805 3300005435 Bacteria 3268
44 Ga0070714_100141511 3300005435 Bacteria 2160
45 Ga0070714_100215735 3300005435 Bacteria 1761
46 Ga0070714_100553248 3300005435 Bacteria 1102
47 Ga0070714_101584805 3300005435 Bacteria 640
48 Ga0070714_101811492 3300005435 Bacteria 596
49 Ga0070713_100001626 3300005436 Bacteria 14410
50 Ga0070713_100102663 3300005436 Bacteria 2480
51 Ga0070713_100102997 3300005436 Bacteria 2477
52 Ga0070710_10001097 3300005437 Bacteria 12812
53 Ga0070710_10018087 3300005437 Unclassified 3620
54 Ga0070710_10090576 3300005437 Bacteria 1803
55 Ga0070710_10168156 3300005437 Bacteria 1364
56 Ga0070710_10367797 3300005437 Bacteria 956
57 Ga0070701_10298618 3300005438 Bacteria 989
58 Ga0070701_11051033 3300005438 Bacteria 571
59 Ga0070711_100036574 3300005439 Bacteria 3289
60 Ga0070711_100047148 3300005439 Bacteria 2940
61 Ga0070705_100299882 3300005440 Bacteria 1151
62 Ga0070705_100453649 3300005440 Bacteria 962
63 Ga0070700_100006610 3300005441 Bacteria 6209
64 Ga0070694_100142502 3300005444 Bacteria 1742
65 Ga0070708_100598629 3300005445 Bacteria 1039
66 Ga0070663_100242389 3300005455 Bacteria 1424
67 Ga0070678_100157477 3300005456 Bacteria 1836
68 Ga0070662_100268743 3300005457 Bacteria 1376
69 Ga0070681_11786865 3300005458 Bacteria 542
70 Ga0070681_11802775 3300005458 Bacteria 539
71 Ga0068867_100269430 3300005459 Bacteria 1391
72 Ga0070685_10033625 3300005466 Bacteria 2882
73 Ga0070685_10072944 3300005466 Bacteria 2039
74 Ga0070679_102156908 3300005530 Bacteria 507
75 Ga0070684_100012900 3300005535 Bacteria 6717
76 Ga0068853_100141145 3300005539 Bacteria 2163
77 Ga0070672_100609243 3300005543 Bacteria 952
78 Ga0070686_100032992 3300005544 Bacteria 3178
79 Ga0070695_100026125 3300005545 Bacteria 3610
80 Ga0070696_100078376 3300005546 Bacteria 2336
81 Ga0070696_100843352 3300005546 Bacteria 757
82 Ga0070693_100249043 3300005547 Bacteria 1177
83 Ga0070693_101481165 3300005547 Bacteria 530
84 Ga0070665_100268099 3300005548 Bacteria 1709
85 Ga0070704_100202741 3300005549 Bacteria 1602
86 Ga0068855_100162094 3300005563 Bacteria 2537
87 Ga0070664_100133715 3300005564 Bacteria 2180
88 Ga0070664_101481943 3300005564 Bacteria 642
89 Ga0068857_100234482 3300005577 Bacteria 1679
90 Ga0068857_101953972 3300005577 Bacteria 575
91 Ga0068857_102531117 3300005577 Bacteria 504
92 Ga0068854_100035082 3300005578 Bacteria 3509
93 Ga0068854_100198003 3300005578 Bacteria 1577
94 Ga0068854_100559556 3300005578 Bacteria 971
95 Ga0068854_101693377 3300005578 Bacteria 578
96 Ga0068856_100012939 3300005614 Bacteria 8077
97 Ga0068856_100087219 3300005614 Bacteria 3102
98 Ga0068856_101084067 3300005614 Bacteria 818
99 Ga0068856_101185387 3300005614 Bacteria 780
100 Ga0070702_100013956 3300005615 Bacteria 4068
101 Ga0070702_100019289 3300005615 Bacteria 3554
102 Ga0070702_100101803 3300005615 Bacteria 1763
103 Ga0068852_100009006 3300005616 Bacteria 7387
104 Ga0068864_100016027 3300005618 Bacteria 6235
105 Ga0068861_100158100 3300005719 Bacteria 1867
106 Ga0068851_10410756 3300005834 Bacteria 798
107 Ga0068870_10336907 3300005840 Bacteria 963
108 Ga0068863_100306823 3300005841 Bacteria 1540
109 Ga0068863_100310039 3300005841 Bacteria 1532
110 Ga0068863_101333380 3300005841 Bacteria 725
111 Ga0068860_100070592 3300005843 Bacteria 3321
112 Ga0068860_100209276 3300005843 Bacteria 1892
113 Ga0068862_100029234 3300005844 Bacteria 4643
114 Ga0068862_100160196 3300005844 Bacteria 2008
115 Ga0081538_10080101 3300005981 Bacteria 1744
116 Ga0081538_10120218 3300005981 Bacteria 1264
117 Ga0081540_1000909 3300005983 Bacteria 26706
118 Ga0081539_10284316 3300005985 Bacteria 718
119 Ga0070717_10004102 3300006028 Bacteria 10504
120 Ga0070717_10014601 3300006028 Bacteria 6048
121 Ga0070717_10119170 3300006028 Bacteria 2259
122 Ga0070717_10176860 3300006028 Bacteria 1858
123 Ga0070717_11441576 3300006028 Bacteria 625
124 Ga0070717_12089507 3300006028 Bacteria 510
125 Ga0075432_10078277 3300006058 Bacteria 1196
126 Ga0070715_10072670 3300006163 Bacteria 1540
127 Ga0070716_100028669 3300006173 Bacteria 3001
128 Ga0070712_100004331 3300006175 Bacteria 8744
129 Ga0070712_100010830 3300006175 Bacteria 5766
130 Ga0070712_100018637 3300006175 Bacteria 4512
131 Ga0070712_100943563 3300006175 Bacteria 745
132 Ga0075428_100444646 3300006844 Bacteria 1389
133 Ga0075428_101346999 3300006844 Bacteria 750
134 Ga0075430_100509541 3300006846 Bacteria 993
135 Ga0075431_100020305 3300006847 Bacteria 6785
136 Ga0075433_10191451 3300006852 Bacteria 1820
137 Ga0075434_100201402 3300006871 Bacteria 2011
138 Ga0075434_100538945 3300006871 Bacteria 1187
139 Ga0075429_101707003 3300006880 Bacteria 547
140 Ga0068865_100062295 3300006881 Bacteria 2618
141 Ga0068865_100109958 3300006881 Bacteria 2032
142 Ga0068865_101199864 3300006881 Bacteria 672
143 Ga0075436_100140631 3300006914 Bacteria 1696
144 Ga0075436_100981233 3300006914 Bacteria 634
145 Ga0075435_100151374 3300007076 Bacteria 1951
146 Ga0111539_10142793 3300009094 Bacteria 2803
147 Ga0111539_10414419 3300009094 Bacteria 1569
148 Ga0111539_11384115 3300009094 Bacteria 816
149 Ga0111539_11447587 3300009094 Bacteria 797
150 Ga0111539_12945066 3300009094 Bacteria 550
151 Ga0105245_10001162 3300009098 Bacteria 23826
152 Ga0105245_10064195 3300009098 Bacteria 3318
153 Ga0105245_11995932 3300009098 Bacteria 634
154 Ga0114129_10217896 3300009147 Bacteria 2577
155 Ga0114129_11248222 3300009147 Bacteria 923
156 Ga0105243_10030441 3300009148 Bacteria 4155
157 Ga0105243_10084455 3300009148 Bacteria 2600
158 Ga0105242_12113241 3300009176 Unclassified 607
159 Ga0105248_10358059 3300009177 Bacteria 1643
160 Ga0105248_10881579 3300009177 Bacteria 1010
161 Ga0105237_10495205 3300009545 Bacteria 1229
162 Ga0105237_12173442 3300009545 Bacteria 564
163 Ga0105238_10642716 3300009551 Bacteria 1071
164 Ga0105238_10868534 3300009551 Bacteria 920
165 Ga0105249_10085119 3300009553 Bacteria 2945
166 Ga0105249_10207194 3300009553 Bacteria 1922
167 Ga0105249_10374124 3300009553 Bacteria 1449
168 Ga0105239_10002490 3300010375 Bacteria 23465
169 Ga0105239_10158475 3300010375 Bacteria 2528
170 Ga0105246_10033504 3300011119 Bacteria 3416
171 Ga0105246_10336824 3300011119 Bacteria 1231
172 Ga0157338_1063164 3300012515 Bacteria 561
173 Ga0157371_11460338 3300013102 Bacteria 532
174 Ga0157370_11270073 3300013104 Bacteria 664
175 Ga0157369_10160747 3300013105 Bacteria 2371
176 Ga0157369_12624729 3300013105 Bacteria 509
177 Ga0157374_10029368 3300013296 Bacteria 4978
178 Ga0163162_10567992 3300013306 Bacteria 1262
179 Ga0163162_10571214 3300013306 Bacteria 1258
180 Ga0163162_11713059 3300013306 Bacteria 718
181 Ga0157372_10225056 3300013307 Bacteria 2175
182 Ga0157372_10353294 3300013307 Bacteria 1713
183 Ga0157372_11294693 3300013307 Bacteria 841
184 Ga0157375_10034299 3300013308 Bacteria 4834
185 Ga0157375_10123554 3300013308 Bacteria 2701
186 Ga0157375_10363990 3300013308 Bacteria 1612
187 Ga0157375_13775041 3300013308 Bacteria 503
188 Ga0163163_10064565 3300014325 Bacteria 3633
189 Ga0157380_10053021 3300014326 Bacteria 3214
190 Ga0157380_10104352 3300014326 Bacteria 2367
191 Ga0157380_10220997 3300014326 Bacteria 1695
192 Ga0182008_10427403 3300014497 Bacteria 716
193 Ga0157377_10018408 3300014745 Bacteria 3629
194 Ga0157377_10019441 3300014745 Bacteria 3549
195 Ga0157377_10100199 3300014745 Bacteria 1725
196 Ga0157376_10180821 3300014969 Bacteria 1928
197 Ga0157376_11632306 3300014969 Bacteria 679
198 Ga0163161_10540168 3300017792 Bacteria 954
199 Ga0206356_11400700 3300020070 Bacteria 602
200 Ga0206356_11495981 3300020070 Bacteria 593
201 Ga0206354_11338150 3300020081 Bacteria 644
202 Ga0213873_10003782 3300021358 Bacteria 2765
203 Ga0213873_10035559 3300021358 Unclassified 1261
204 Ga0213873_10211031 3300021358 Bacteria 605
205 Ga0213874_10064988 3300021377 Unclassified 1152
206 Ga0213874_10082119 3300021377 Bacteria 1046
207 Ga0213874_10094647 3300021377 Unclassified 986
208 Ga0213876_10050699 3300021384 Bacteria 2193
209 Ga0213876_10074850 3300021384 Unclassified 1789
210 Ga0213876_10087474 3300021384 Bacteria 1649
211 Ga0213875_10000186 3300021388 Bacteria 63592
212 Ga0213875_10000997 3300021388 Bacteria 20179
213 Ga0213875_10038649 3300021388 Bacteria 2248
214 Ga0224712_10460235 3300022467 Bacteria 611
215 Ga0207656_10262179 3300025321 Bacteria 849
216 Ga0207692_10031269 3300025898 Unclassified 2548
217 Ga0207692_10059133 3300025898 Bacteria 1978
218 Ga0207692_10174296 3300025898 Bacteria 1249
219 Ga0207692_10175480 3300025898 Bacteria 1245
220 Ga0207692_10318371 3300025898 Bacteria 951
221 Ga0207692_11093452 3300025898 Bacteria 528
222 Ga0207688_10005519 3300025901 Bacteria 6878
223 Ga0207688_10017444 3300025901 Bacteria 3901
224 Ga0207647_10716734 3300025904 Bacteria 544
225 Ga0207685_10099382 3300025905 Bacteria 1241
226 Ga0207685_10811813 3300025905 Bacteria 516
227 Ga0207699_10003813 3300025906 Bacteria 7194
228 Ga0207699_10023944 3300025906 Bacteria 3330
229 Ga0207699_10124302 3300025906 Bacteria 1673
230 Ga0207699_10263376 3300025906 Bacteria 1192
231 Ga0207699_10590698 3300025906 Bacteria 808
232 Ga0207699_10620592 3300025906 Bacteria 788
233 Ga0207699_10824805 3300025906 Bacteria 682
234 Ga0207693_10016915 3300025915 Bacteria 5823
235 Ga0207693_10024407 3300025915 Bacteria 4797
236 Ga0207693_10042728 3300025915 Bacteria 3568
237 Ga0207693_10473340 3300025915 Bacteria 978
238 Ga0207693_10659421 3300025915 Bacteria 812
239 Ga0207693_11440446 3300025915 Bacteria 510
240 Ga0207663_10069031 3300025916 Bacteria 2272
241 Ga0207663_10093546 3300025916 Bacteria 2001
242 Ga0207663_10166072 3300025916 Bacteria 1563
243 Ga0207663_11590123 3300025916 Bacteria 526
244 Ga0207662_10074422 3300025918 Bacteria 2061
245 Ga0207657_10072991 3300025919 Bacteria 2901
246 Ga0207649_10191407 3300025920 Bacteria 1439
247 Ga0207649_10667126 3300025920 Bacteria 804
248 Ga0207652_11031207 3300025921 Bacteria 722
249 Ga0207694_11756687 3300025924 Bacteria 521
250 Ga0207687_10010849 3300025927 Bacteria 5956
251 Ga0207687_10066216 3300025927 Bacteria 2568
252 Ga0207700_10004785 3300025928 Bacteria 8032
253 Ga0207700_10085220 3300025928 Bacteria 2479
254 Ga0207700_10121106 3300025928 Unclassified 2122
255 Ga0207700_10488039 3300025928 Bacteria 1089
256 Ga0207700_11486616 3300025928 Bacteria 601
257 Ga0207664_10001310 3300025929 Bacteria 16420
258 Ga0207664_10008528 3300025929 Bacteria 7158
259 Ga0207664_10026238 3300025929 Bacteria 4402
260 Ga0207664_10083219 3300025929 Bacteria 2608
261 Ga0207664_10244011 3300025929 Bacteria 1565
262 Ga0207664_10276292 3300025929 Bacteria 1473
263 Ga0207664_10402074 3300025929 Bacteria 1218
264 Ga0207664_10434410 3300025929 Unclassified 1171
265 Ga0207664_11336483 3300025929 Bacteria 637
266 Ga0207664_11347569 3300025929 Bacteria 634
267 Ga0207664_11862235 3300025929 Bacteria 524
268 Ga0207644_10344535 3300025931 Bacteria 1209
269 Ga0207644_10810507 3300025931 Bacteria 783
270 Ga0207690_10055646 3300025932 Bacteria 2665
271 Ga0207690_10139351 3300025932 Bacteria 1785
272 Ga0207690_10815563 3300025932 Bacteria 771
273 Ga0207690_11531663 3300025932 Bacteria 557
274 Ga0207706_10241025 3300025933 Bacteria 1581
275 Ga0207706_10313344 3300025933 Bacteria 1366
276 Ga0207686_10984758 3300025934 Bacteria 684
277 Ga0207709_10034676 3300025935 Bacteria 2977
278 Ga0207670_10027082 3300025936 Bacteria 3620
279 Ga0207669_10349140 3300025937 Bacteria 1142
280 Ga0207669_10541376 3300025937 Bacteria 938
281 Ga0207704_10042883 3300025938 Bacteria 2667
282 Ga0207704_10054587 3300025938 Bacteria 2437
283 Ga0207704_10233939 3300025938 Bacteria 1368
284 Ga0207665_10006524 3300025939 Bacteria 7738
285 Ga0207665_10039444 3300025939 Bacteria 3148
286 Ga0207691_10327076 3300025940 Bacteria 1314
287 Ga0207711_10796346 3300025941 Bacteria 880
288 Ga0207711_11265068 3300025941 Bacteria 680
289 Ga0207689_11247257 3300025942 Bacteria 625
290 Ga0207689_11827916 3300025942 Unclassified 501
291 Ga0207661_10225805 3300025944 Bacteria 1657
292 Ga0207661_10291092 3300025944 Bacteria 1462
293 Ga0207661_10523113 3300025944 Bacteria 1085
294 Ga0207679_10022979 3300025945 Bacteria 4256
295 Ga0207679_10664084 3300025945 Bacteria 944
296 Ga0207667_10304810 3300025949 Bacteria 1627
297 Ga0207667_11436222 3300025949 Bacteria 662
298 Ga0207712_10011136 3300025961 Bacteria 5725
299 Ga0207712_10590113 3300025961 Bacteria 960
300 Ga0207668_10079117 3300025972 Bacteria 2377
301 Ga0207668_10187124 3300025972 Bacteria 1638
302 Ga0207640_10240989 3300025981 Bacteria 1397
303 Ga0207640_10410762 3300025981 Bacteria 1105
304 Ga0207658_10748710 3300025986 Bacteria 885
305 Ga0207677_10069992 3300026023 Bacteria 2470
306 Ga0207677_10218070 3300026023 Bacteria 1528
307 Ga0207677_10286650 3300026023 Bacteria 1354
308 Ga0207703_12283566 3300026035 Bacteria 517
309 Ga0207639_10089294 3300026041 Bacteria 2462
310 Ga0207678_10426227 3300026067 Bacteria 1151
311 Ga0207678_10779022 3300026067 Bacteria 844
312 Ga0207708_10000257 3300026075 Bacteria 41841
313 Ga0207708_10006737 3300026075 Bacteria 8499
314 Ga0207702_11127726 3300026078 Bacteria 778
315 Ga0207641_10474354 3300026088 Bacteria 1212
316 Ga0207641_11024291 3300026088 Bacteria 823
317 Ga0207648_10024849 3300026089 Bacteria 5343
318 Ga0207676_10032298 3300026095 Bacteria 3944
319 Ga0207676_10279940 3300026095 Bacteria 1514
320 Ga0207676_10382585 3300026095 Bacteria 1310
321 Ga0207674_10146160 3300026116 Bacteria 2323
322 Ga0207674_10537809 3300026116 Bacteria 1129
323 Ga0207675_100013552 3300026118 Bacteria 7608
324 Ga0207675_100288124 3300026118 Bacteria 1597
325 Ga0207683_10004929 3300026121 Bacteria 11484
326 Ga0207698_10044252 3300026142 Bacteria 3343
327 Ga0207698_10303572 3300026142 Bacteria 1487
328 Ga0207428_10265703 3300027907 Bacteria 1277
329 Ga0207428_10362316 3300027907 Bacteria 1066
330 Ga0268265_10200972 3300028380 Bacteria 1729
331 Ga0268265_11724196 3300028380 Bacteria 632
332 Ga0268264_10051841 3300028381 Bacteria 3420
333 Ga0265773_1001040 3300031018 Unclassified 1379
334 Ga0307408_100564852 3300031548 Bacteria 1006
335 Ga0307508_10599750 3300031616 Bacteria 703
336 Ga0307405_10063065 3300031731 Bacteria 2349
337 Ga0307405_11643206 3300031731 Bacteria 568
338 Ga0307413_10202732 3300031824 Bacteria 1434
339 Ga0307410_10089032 3300031852 Bacteria 2186
340 Ga0307406_10010707 3300031901 Bacteria 5180
341 Ga0307406_10521788 3300031901 Bacteria 967
342 Ga0307407_10053232 3300031903 Bacteria 2328
343 Ga0307407_10522467 3300031903 Bacteria 873
344 Ga0307409_100091745 3300031995 Bacteria 2490
345 Ga0307409_102868430 3300031995 Unclassified 509
346 Ga0307416_100689800 3300032002 Bacteria 1109
347 Ga0307414_10151090 3300032004 Bacteria 1832
348 Ga0307411_10160044 3300032005 Bacteria 1685
349 Ga0307411_10513573 3300032005 Bacteria 1015
350 Ga0307415_100024290 3300032126 Bacteria 3780
351 Ga0307415_100460512 3300032126 Bacteria 1102
352 Ga0373926_0000669 3300035083 Bacteria 9398
353 Ga0373926_0235475 3300035083 Bacteria 708
354 Ga0373934_0005922 3300035086 Bacteria 4524
355 Ga0373934_0290879 3300035086 Bacteria 677
356 Ga0373944_0006404 3300035089 Bacteria 3126
357 Ga0373923_0012613 3300035111 Bacteria 3130
358 Ga0373936_0006206 3300035113 Bacteria 4506
359 Ga0373936_0011774 3300035113 Bacteria 3317
360 Ga0373945_0000183 3300035116 Bacteria 16833
361 Ga0373953_0058116 3300035117 Bacteria 1576
362 Ga0373954_0044602 3300035118 Bacteria 2070
363 Ga0373956_0012548 3300035119 Bacteria 3514
364 Ga0373957_0070720 3300035120 Bacteria 1364
365 Ga0373957_0257819 3300035120 Bacteria 734
366 Ga0373943_0003396 3300035170 Bacteria 7245
367 Ga0373943_0089661 3300035170 Bacteria 1591
368 Ga0373943_0530612 3300035170 Bacteria 690
369 Ga0373946_0000342 3300035171 Bacteria 15051
370 Ga0373955_0024710 3300035172 Bacteria 3075
371 Ga0373955_0077311 3300035172 Bacteria 1874
372 Ga0373924_0020662 3300035410 Bacteria 2562
373 Ga0373935_0003699 3300035692 Bacteria 8922
374 Ga0373935_0209089 3300035692 Bacteria 1351
375 Ga0373935_0430759 3300035692 Bacteria 950
376 Ga0373935_1067151 3300035692 Bacteria 601
377 Ga0373927_0044908 3300035695 Bacteria 2858
378 Ga0373927_0592702 3300035695 Bacteria 733
379 Ga0373933_0081679 3300035724 Bacteria 1983
380 Ga0373933_0103634 3300035724 Bacteria 1767
381 Ga0373947_0002494 3300035725 Bacteria 11063
382 Ga0373947_0535475 3300035725 Bacteria 797
383 Ga0373937_0007626 3300036401 Bacteria 9374
384 Ga0373937_0096395 3300036401 Bacteria 2743
385 Ga0373937_1861043 3300036401 Bacteria 548
386 Ga0373925_0007696 3300037068 Bacteria 7847
387 Ga0373925_0046238 3300037068 Bacteria 3236
388 Ga0373925_0267702 3300037068 Bacteria 1374
389 Ga0373925_0358595 3300037068 Bacteria 1185
390 Ga0395899_0464197 3300037312 Bacteria 827
391 Ga0395900_1207558 3300037418 Bacteria 672
392 Ga0436364_0005797 3300037853 Bacteria 4433
393 Ga0436364_0080238 3300037853 Bacteria 106053
394 Ga0436364_0164224 3300037853 Bacteria 527
395 Ga0436364_0277033 3300037853 Bacteria 1044
396 Ga0436364_0601973 3300037853 Bacteria 29284
397 Ga0436364_0742832 3300037853 Bacteria 21397
398 Ga0436364_0909519 3300037853 Bacteria 3519
399 Ga0436364_0976537 3300037853 Bacteria 12851
400 Ga0436364_1040466 3300037853 Bacteria 95595
401 Ga0395901_1104653 3300038443 Bacteria 763
402 Ga0436365_0261533 3300039437 Unclassified 2135
403 Ga0436365_0506212 3300039437 Bacteria 4338
404 Ga0436365_0942116 3300039437 Bacteria 2830
405 Ga0436365_1473063 3300039437 Bacteria 1972
406 Ga0436365_1535432 3300039437 Bacteria 1826
407 Ga0436360_0140758 3300039438 Unclassified 552
408 Ga0436363_0054377 3300039450 Bacteria 2559
409 Ga0436363_0226467 3300039450 Bacteria 533
410 Ga0436363_0804670 3300039450 Bacteria 4041
411 Ga0436363_1070317 3300039450 Bacteria 1147
412 Ga0436363_1678274 3300039450 Bacteria 1337
413 Ga0436362_0182618 3300039453 Unclassified 705
414 Ga0436362_0291930 3300039453 Bacteria 754
415 Ga0436362_0339878 3300039453 Bacteria 2376
416 Ga0436362_0835069 3300039453 Bacteria 1766
417 Ga0436362_0916569 3300039453 Bacteria 1825
418 Ga0436362_1029294 3300039453 Unclassified 1430
419 Ga0451793_1360198 3300041452 Bacteria 586
420 Ga0451853_1627770 3300041512 Bacteria 522
421 Ga0466969_0213819 3300044656 Unclassified 878
422 Ga0466965_0165800 3300044683 Bacteria 1160
423 Ga0466965_0197041 3300044683 Bacteria 1067
424 Ga0466963_0011509 3300044694 Bacteria 5388
425 Ga0466963_0070565 3300044694 Bacteria 2350
426 Ga0466963_0161856 3300044694 Bacteria 1558
427 Ga0466963_0170970 3300044694 Bacteria 1515
428 Ga0466963_0185105 3300044694 Bacteria 1454
429 Ga0466964_0074879 3300044706 Bacteria 1440
430 Ga0466964_0214265 3300044706 Bacteria 932
431 Ga0466971_0010877 3300044719 Bacteria 3980
432 Ga0466968_0632099 3300044735 Bacteria 542
433 Ga0466957_0024250 3300044842 Bacteria 3589
434 Ga0466957_1346245 3300044842 Unclassified 519
435 Ga0466960_0865010 3300044901 Bacteria 550
436 Ga0466960_0865847 3300044901 Bacteria 550
437 Ga0466960_0942271 3300044901 Bacteria 528
438 Ga0466959_0932557 3300045049 Bacteria 579
439 Ga0466959_1164121 3300045049 Bacteria 513
440 Ga0466958_0021562 3300045836 Bacteria 3767
441 Ga0466958_0386710 3300045836 Bacteria 902
442 Ga0466967_0032899 3300045976 Bacteria 4384
443 Ga0466967_0118062 3300045976 Bacteria 2446
444 Ga0466967_0171852 3300045976 Bacteria 2039
445 Ga0466967_0328022 3300045976 Bacteria 1477
446 Ga0466967_0413111 3300045976 Bacteria 1314
447 Ga0466967_0650824 3300045976 Bacteria 1042
448 Ga0466967_0830283 3300045976 Bacteria 918
449 Ga0466967_1526293 3300045976 Bacteria 665
450 Ga0466967_1920897 3300045976 Bacteria 589
451 Ga0466967_1978492 3300045976 Bacteria 579
452 Ga0466967_2018516 3300045976 Bacteria 573
453 Ga0466967_2168547 3300045976 Bacteria 552
454 Ga0466967_2223421 3300045976 Bacteria 544
455 Ga0466967_2350167 3300045976 Bacteria 528
456 Ga0495592_0150062 3300046454 Bacteria 1613
457 Ga0495592_0183525 3300046454 Bacteria 1423
458 Ga0495592_0373716 3300046454 Unclassified 909
459 Ga0495603_0542209 3300046455 Bacteria 666
460 Ga0495603_0662009 3300046455 Bacteria 597
461 Ga0495629_0078111 3300046459 Bacteria 2311
462 Ga0495629_0305071 3300046459 Bacteria 1090
463 Ga0495629_0321818 3300046459 Bacteria 1057
464 Ga0495641_0015755 3300046461 Bacteria 4015
465 Ga0495641_0097755 3300046461 Bacteria 1310
466 Ga0495641_0511159 3300046461 Bacteria 548
467 Ga0495641_0570225 3300046461 Bacteria 517
468 Ga0495651_0017552 3300046462 Bacteria 5541
469 Ga0495651_0021367 3300046462 Bacteria 5030
470 Ga0495651_0179382 3300046462 Bacteria 1500
471 Ga0495653_0001969 3300046463 Bacteria 16170
472 Ga0495653_0040350 3300046463 Bacteria 3648
473 Ga0495582_0033732 3300046473 Bacteria 2815
474 Ga0495582_0120127 3300046473 Bacteria 1481
475 Ga0495582_0861945 3300046473 Unclassified 524
476 Ga0495639_0061090 3300046475 Bacteria 1727
477 Ga0495662_0014298 3300046476 Bacteria 3861
478 Ga0495664_0015345 3300046477 Bacteria 4354
479 Ga0495608_0043177 3300046511 Bacteria 3013
480 Ga0495608_0073216 3300046511 Bacteria 2234
481 Ga0495608_0090733 3300046511 Bacteria 1976
482 Ga0495618_0035497 3300046514 Bacteria 3129
483 Ga0495618_0051824 3300046514 Bacteria 2593
484 Ga0495618_0848836 3300046514 Bacteria 529
485 Ga0495628_0101706 3300046516 Bacteria 2218
486 Ga0495630_0025796 3300046517 Bacteria 4347
487 Ga0495630_0110220 3300046517 Bacteria 2085
488 Ga0495630_0287018 3300046517 Bacteria 1257
489 Ga0495666_0565456 3300046526 Bacteria 507
490 Ga0495652_0015218 3300046529 Bacteria 6888
491 Ga0495652_0047882 3300046529 Bacteria 3666
492 Ga0495652_0136336 3300046529 Bacteria 1936
493 Ga0495652_0514867 3300046529 Bacteria 828
494 Ga0495665_0034814 3300046531 Bacteria 2693
495 Ga0495640_0049591 3300046533 Bacteria 2894
496 Ga0495640_0178492 3300046533 Bacteria 1354
497 Ga0495640_0373083 3300046533 Bacteria 878
498 Ga0495640_0679837 3300046533 Bacteria 618
499 Ga0495586_0348995 3300046535 Bacteria 850
500 Ga0495587_0037446 3300046536 Bacteria 2913
501 Ga0495587_0046421 3300046536 Bacteria 2579
502 Ga0495587_0060083 3300046536 Bacteria 2230
503 Ga0495597_0423350 3300046542 Bacteria 505
504 Ga0495645_0071367 3300046543 Bacteria 2504
505 Ga0495645_0096851 3300046543 Bacteria 2102
506 Ga0495645_0649854 3300046543 Bacteria 644
507 Ga0495667_0019245 3300046559 Bacteria 4608
508 Ga0495667_0083423 3300046559 Bacteria 2075
509 Ga0495667_0097485 3300046559 Unclassified 1904
510 Ga0495667_0238182 3300046559 Unclassified 1159
511 Ga0495634_0021430 3300046642 Bacteria 4568
512 Ga0495634_0021522 3300046642 Bacteria 4556
513 Ga0495634_0399099 3300046642 Bacteria 817
514 Ga0495635_0001793 3300046663 Bacteria 14508
515 Ga0495635_0008009 3300046663 Bacteria 7382
516 Ga0495635_0120642 3300046663 Bacteria 1788
517 Ga0495657_0012679 3300046675 Bacteria 6251
518 Ga0495657_0029077 3300046675 Bacteria 3879
519 Ga0495657_0039133 3300046675 Bacteria 3260
520 Ga0495599_0022129 3300046678 Bacteria 3968
521 Ga0495599_0071393 3300046678 Bacteria 2167
522 Ga0495599_0082560 3300046678 Bacteria 2007
523 Ga0495623_0027934 3300046679 Bacteria 3632
524 Ga0495623_0445954 3300046679 Bacteria 690
525 Ga0495646_0017772 3300046680 Bacteria 4508
526 Ga0495646_0093735 3300046680 Bacteria 1730
527 Ga0495646_0140082 3300046680 Bacteria 1353
528 Ga0495647_0081946 3300046681 Bacteria 1309
529 Ga0495613_0222465 3300046689 Bacteria 1325
530 Ga0495613_1099368 3300046689 Bacteria 507
531 Ga0495624_0002779 3300046690 Bacteria 13138
532 Ga0495624_0728623 3300046690 Bacteria 588
533 Ga0495600_0038299 3300046809 Bacteria 3119
534 Ga0495600_0042130 3300046809 Bacteria 2976
535 Ga0495600_0071090 3300046809 Bacteria 2274
536 Ga0495581_0008731 3300047315 Bacteria 5869
537 Ga0495581_0100780 3300047315 Bacteria 1678
538 Ga0495581_0301569 3300047315 Bacteria 936
539 Ga0495604_0033864 3300047317 Bacteria 4043
540 Ga0495604_0088596 3300047317 Bacteria 2302
541 Ga0495604_0350593 3300047317 Bacteria 981
542 Ga0495674_0016313 3300047319 Bacteria 6927
543 Ga0495674_0031216 3300047319 Bacteria 4841
544 Ga0495674_0046729 3300047319 Bacteria 3842
545 Ga0495674_0399669 3300047319 Bacteria 1109
546 Ga0495674_0435191 3300047319 Bacteria 1055
547 Ga0495676_0027359 3300047321 Bacteria 4890
548 Ga0495676_0191080 3300047321 Bacteria 1428
549 Ga0495676_0477873 3300047321 Bacteria 820
550 Ga0495680_0001267 3300047322 Bacteria 27535
551 Ga0495680_0012859 3300047322 Bacteria 7333
552 Ga0495680_0044464 3300047322 Bacteria 3511
553 Ga0495680_0154341 3300047322 Unclassified 1672
554 Ga0495684_0004023 3300047471 Bacteria 11469
555 Ga0495684_0050366 3300047471 Bacteria 3180
556 Ga0495684_0102159 3300047471 Bacteria 2167
557 Ga0495593_0033202 3300047673 Bacteria 2812
558 Ga0495593_0082999 3300047673 Bacteria 1656
559 Ga0495602_0015445 3300048088 Bacteria 7705
560 Ga0495602_0134685 3300048088 Bacteria 1965
561 Ga0495602_0484254 3300048088 Bacteria 867
562 Ga0496100_0027081 3300048903 Bacteria 3521
563 Ga0496100_0152476 3300048903 Bacteria 1650
564 Ga0496100_0832470 3300048903 Bacteria 723
565 Ga0496100_1548089 3300048903 Unclassified 524
566 Ga0496101_0055365 3300048904 Bacteria 2865
567 Ga0496101_0066212 3300048904 Bacteria 2635
568 Ga0496101_0071053 3300048904 Bacteria 2551
569 Ga0496101_0180375 3300048904 Bacteria 1626
570 Ga0496101_0826590 3300048904 Bacteria 730
571 Ga0496101_1551102 3300048904 Bacteria 515
572 Ga0496102_0011630 3300048905 Bacteria 7596
573 Ga0496102_0048630 3300048905 Bacteria 3856
574 Ga0496102_0061018 3300048905 Bacteria 3450
575 Ga0496102_0252632 3300048905 Bacteria 1662
576 Ga0496102_1395676 3300048905 Bacteria 619
577 Ga0496103_0032184 3300048906 Bacteria 3200
578 Ga0496103_0130584 3300048906 Bacteria 1604
579 Ga0496103_0332118 3300048906 Bacteria 978
580 Ga0496104_0007424 3300048907 Bacteria 9687
581 Ga0496104_0077961 3300048907 Bacteria 3157
582 Ga0496104_0152277 3300048907 Bacteria 2219
583 Ga0496104_0264483 3300048907 Bacteria 1632
584 Ga0496104_0359980 3300048907 Bacteria 1367
585 Ga0496104_1234365 3300048907 Bacteria 651
586 Ga0496105_0025502 3300048908 Bacteria 4813
587 Ga0496105_0110505 3300048908 Bacteria 2269
588 Ga0496105_0400501 3300048908 Bacteria 1089
589 Ga0496106_0022255 3300048909 Bacteria 4708
590 Ga0496106_0089526 3300048909 Bacteria 2373
591 Ga0496106_0122796 3300048909 Bacteria 2031
592 Ga0496106_0156861 3300048909 Bacteria 1798
593 Ga0496106_0197282 3300048909 Bacteria 1601
594 Ga0496107_0030280 3300048910 Bacteria 3857
595 Ga0496107_0042337 3300048910 Bacteria 3271
596 Ga0496107_0127378 3300048910 Bacteria 1878
597 Ga0496108_0001138 3300048911 Bacteria 20763
598 Ga0496108_0007308 3300048911 Bacteria 8954
599 Ga0496108_0019138 3300048911 Bacteria 5619
600 Ga0496108_0098178 3300048911 Bacteria 2496
601 Ga0496108_0178181 3300048911 Bacteria 1840
602 Ga0496108_0480988 3300048911 Bacteria 1085
603 Ga0496109_0001955 3300048912 Bacteria 17076
604 Ga0496109_0042490 3300048912 Bacteria 4117
605 Ga0496109_0045500 3300048912 Bacteria 3983
606 Ga0496109_0092075 3300048912 Bacteria 2804
607 Ga0496109_0109363 3300048912 Bacteria 2569
608 Ga0496109_0121914 3300048912 Bacteria 2429
609 Ga0496109_0477555 3300048912 Bacteria 1177
610 Ga0496109_1501347 3300048912 Bacteria 609
611 Ga0496110_0006618 3300048913 Bacteria 9207
612 Ga0496110_0013201 3300048913 Bacteria 6820
613 Ga0496110_0415377 3300048913 Bacteria 1226
614 Ga0496110_0472508 3300048913 Bacteria 1142
615 Ga0496111_0013617 3300048914 Bacteria 5540
616 Ga0496111_0035356 3300048914 Bacteria 3570
617 Ga0496111_0075899 3300048914 Bacteria 2449
618 Ga0496111_0271311 3300048914 Bacteria 1258
619 Ga0496111_0405831 3300048914 Bacteria 1007
620 Ga0496111_0704103 3300048914 Bacteria 734
621 Ga0496112_0002101 3300048915 Bacteria 15809
622 Ga0496112_0019710 3300048915 Bacteria 6374
623 Ga0496112_0135279 3300048915 Bacteria 2435
624 Ga0496112_0176598 3300048915 Bacteria 2100
625 Ga0496112_0219224 3300048915 Bacteria 1859
626 Ga0496112_0485261 3300048915 Bacteria 1172
627 Ga0496112_1064472 3300048915 Bacteria 727
628 Ga0496113_0007150 3300048916 Bacteria 7149
629 Ga0496113_0010704 3300048916 Bacteria 6076
630 Ga0496113_0043047 3300048916 Bacteria 3339
631 Ga0496113_0123349 3300048916 Bacteria 2027
632 Ga0496114_1531568 3300048917 Bacteria 555
633 Ga0496114_1735008 3300048917 Bacteria 512
634 Ga0496115_0051209 3300048918 Bacteria 3311
635 Ga0496115_0272613 3300048918 Bacteria 1390
636 Ga0496115_0394254 3300048918 Bacteria 1124
637 Ga0496126_0200797 3300048929 Bacteria 1684
638 Ga0496126_0213105 3300048929 Bacteria 1625
639 Ga0501031_0122074 3300049568 Bacteria 1702
640 Ga0501067_0460843 3300049583 Bacteria 710
641 Ga0501069_0852739 3300049585 Bacteria 553
642 Ga0501072_0455380 3300049588 Bacteria 1013
643 Ga0501044_0403166 3300049823 Bacteria 1280
644 nmdc:mga03n38_841227_c1 3300050490 Bacteria 536
645 nmdc:mga06z11_1021642_c1 3300050494 Bacteria 504
646 nmdc:mga05p37_1963204_c1 3300050507 Bacteria 555
647 nmdc:mga05p37_796702_c1 3300050507 Bacteria 1034
648 nmdc:mga09592_1282265_c1 3300050508 Bacteria 603
649 nmdc:mga06r32_529411_c1 3300050510 Bacteria 1154
650 nmdc:mga08y16_1365836_c1 3300050511 Bacteria 673
651 nmdc:mga08y16_165615_c1 3300050511 Bacteria 2296
652 nmdc:mga08y16_188827_c1 3300050511 Bacteria 2138
653 nmdc:mga08y16_824738_c1 3300050511 Bacteria 919
654 nmdc:mga0n895_2008168_c1 3300050512 Bacteria 536
655 nmdc:mga0n895_276793_c1 3300050512 Bacteria 1702
656 nmdc:mga0rr50_123652_c1 3300050513 Bacteria 2063
657 nmdc:mga08x19_461035_c1 3300050514 Bacteria 895
658 nmdc:mga08x19_642585_c1 3300050514 Bacteria 752
659 nmdc:mga0a205_31811_c1 3300050515 Bacteria 5057
660 nmdc:mga0a205_679785_c1 3300050515 Bacteria 880
661 Ga0495601_0125514 3300053077 Bacteria 1669
662 Ga0495612_0030349 3300053078 Bacteria 2177
663 Ga0495612_0234110 3300053078 Unclassified 815
664 Ga0495595_0003412 3300053084 Bacteria 6308
665 Ga0495619_0646586 3300053085 Bacteria 721
666 Ga0495619_0887734 3300053085 Bacteria 600
667 Ga0501082_0647726 3300060353 Bacteria 925
668 Ga0501082_1825450 3300060353 Bacteria 530
669 Ga0466962_0509488 3300061719 Bacteria 609
670 Ga0466958_0621611
671 JGI24737J22298_10126827
672 JGI24737J22298_10237343
673 JGI24745J21846_1017083
674 JGI24738J21930_10106420
675 JGI24742J22300_10071322
676 JGI25407J50210_10183408
677 Ga0070658_10975043
678 Ga0070658_11318953
679 Ga0070676_11159112
680 Ga0070683_100126932
681 Ga0070683_100678048
682 Ga0070683_100965890
683 Ga0068869_100059332
684 Ga0070682_100042933
685 Ga0068868_100004125
686 Ga0068868_100086294
687 Ga0068868_100189806
688 Ga0070660_100367024
689 Ga0070689_100042270
690 Ga0070689_100159423
691 Ga0070691_10381587
692 Ga0070687_100065682
693 Ga0070661_100291986
694 Ga0070661_100642889
695 Ga0070692_10156605
696 Ga0070668_100223769
697 Ga0070669_100557883
698 Ga0070675_100021086
699 Ga0070671_101129669
700 Ga0070674_100053305
701 Ga0070674_100576359
702 Ga0070673_100082739
703 Ga0070673_100383547
704 Ga0070688_100010216
705 Ga0070688_100798736
706 Ga0070659_100017863
707 Ga0070659_100160341
708 Ga0070659_100487531
709 Ga0070659_100658822
710 Ga0070659_101817592
711 Ga0070709_10045155
712 Ga0070714_100059805
713 Ga0070714_100141511
714 Ga0070714_100215735
715 Ga0070714_100553248
716 Ga0070714_101584805
717 Ga0070714_101811492
718 Ga0070713_100001626
719 Ga0070713_100102663
720 Ga0070713_100102997
721 Ga0070710_10001097
722 Ga0070710_10018087
723 Ga0070710_10090576
724 Ga0070710_10168156
725 Ga0070710_10367797
726 Ga0070701_10298618
727 Ga0070701_11051033
728 Ga0070711_100036574
729 Ga0070711_100047148
730 Ga0070705_100299882
731 Ga0070705_100453649
732 Ga0070700_100006610
733 Ga0070694_100142502
734 Ga0070708_100598629
735 Ga0070663_100242389
736 Ga0070678_100157477
737 Ga0070662_100268743
738 Ga0070681_11786865
739 Ga0070681_11802775
740 Ga0068867_100269430
741 Ga0070685_10033625
742 Ga0070685_10072944
743 Ga0070679_102156908
744 Ga0070684_100012900
745 Ga0068853_100141145
746 Ga0070672_100609243
747 Ga0070686_100032992
748 Ga0070695_100026125
749 Ga0070696_100078376
750 Ga0070696_100843352
751 Ga0070693_100249043
752 Ga0070693_101481165
753 Ga0070665_100268099
754 Ga0070704_100202741
755 Ga0068855_100162094
756 Ga0070664_100133715
757 Ga0070664_101481943
758 Ga0068857_100234482
759 Ga0068857_101953972
760 Ga0068857_102531117
761 Ga0068854_100035082
762 Ga0068854_100198003
763 Ga0068854_100559556
764 Ga0068854_101693377
765 Ga0068856_100012939
766 Ga0068856_100087219
767 Ga0068856_101084067
768 Ga0068856_101185387
769 Ga0070702_100013956
770 Ga0070702_100019289
771 Ga0070702_100101803
772 Ga0068852_100009006
773 Ga0068864_100016027
774 Ga0068861_100158100
775 Ga0068851_10410756
776 Ga0068870_10336907
777 Ga0068863_100306823
778 Ga0068863_100310039
779 Ga0068863_101333380
780 Ga0068860_100070592
781 Ga0068860_100209276
782 Ga0068862_100029234
783 Ga0068862_100160196
784 Ga0081538_10080101
785 Ga0081538_10120218
786 Ga0081540_1000909
787 Ga0081539_10284316
788 Ga0070717_10004102
789 Ga0070717_10014601
790 Ga0070717_10119170
791 Ga0070717_10176860
792 Ga0070717_11441576
793 Ga0070717_12089507
794 Ga0075432_10078277
795 Ga0070715_10072670
796 Ga0070716_100028669
797 Ga0070712_100004331
798 Ga0070712_100010830
799 Ga0070712_100018637
800 Ga0070712_100943563
801 Ga0075428_100444646
802 Ga0075428_101346999
803 Ga0075430_100509541
804 Ga0075431_100020305
805 Ga0075433_10191451
806 Ga0075434_100201402
807 Ga0075434_100538945
808 Ga0075429_101707003
809 Ga0068865_100062295
810 Ga0068865_100109958
811 Ga0068865_101199864
812 Ga0075436_100140631
813 Ga0075436_100981233
814 Ga0075435_100151374
815 Ga0111539_10142793
816 Ga0111539_10414419
817 Ga0111539_11384115
818 Ga0111539_11447587
819 Ga0111539_12945066
820 Ga0105245_10001162
821 Ga0105245_10064195
822 Ga0105245_11995932
823 Ga0114129_10217896
824 Ga0114129_11248222
825 Ga0105243_10030441
826 Ga0105243_10084455
827 Ga0105242_12113241
828 Ga0105248_10358059
829 Ga0105248_10881579
830 Ga0105237_10495205
831 Ga0105237_12173442
832 Ga0105238_10642716
833 Ga0105238_10868534
834 Ga0105249_10085119
835 Ga0105249_10207194
836 Ga0105249_10374124
837 Ga0105239_10002490
838 Ga0105239_10158475
839 Ga0105246_10033504
840 Ga0105246_10336824
841 Ga0157338_1063164
842 Ga0157371_11460338
843 Ga0157370_11270073
844 Ga0157369_10160747
845 Ga0157369_12624729
846 Ga0157374_10029368
847 Ga0163162_10567992
848 Ga0163162_10571214
849 Ga0163162_11713059
850 Ga0157372_10225056
851 Ga0157372_10353294
852 Ga0157372_11294693
853 Ga0157375_10034299
854 Ga0157375_10123554
855 Ga0157375_10363990
856 Ga0157375_13775041
857 Ga0163163_10064565
858 Ga0157380_10053021
859 Ga0157380_10104352
860 Ga0157380_10220997
861 Ga0182008_10427403
862 Ga0157377_10018408
863 Ga0157377_10019441
864 Ga0157377_10100199
865 Ga0157376_10180821
866 Ga0157376_11632306
867 Ga0163161_10540168
868 Ga0206356_11400700
869 Ga0206356_11495981
870 Ga0206354_11338150
871 Ga0213873_10003782
872 Ga0213873_10035559
873 Ga0213873_10211031
874 Ga0213874_10064988
875 Ga0213874_10082119
876 Ga0213874_10094647
877 Ga0213876_10050699
878 Ga0213876_10074850
879 Ga0213876_10087474
880 Ga0213875_10000186
881 Ga0213875_10000997
882 Ga0213875_10038649
883 Ga0224712_10460235
884 Ga0207656_10262179
885 Ga0207692_10031269
886 Ga0207692_10059133
887 Ga0207692_10174296
888 Ga0207692_10175480
889 Ga0207692_10318371
890 Ga0207692_11093452
891 Ga0207688_10005519
892 Ga0207688_10017444
893 Ga0207647_10716734
894 Ga0207685_10099382
895 Ga0207685_10811813
896 Ga0207699_10003813
897 Ga0207699_10023944
898 Ga0207699_10124302
899 Ga0207699_10263376
900 Ga0207699_10590698
901 Ga0207699_10620592
902 Ga0207699_10824805
903 Ga0207693_10016915
904 Ga0207693_10024407
905 Ga0207693_10042728
906 Ga0207693_10473340
907 Ga0207693_10659421
908 Ga0207693_11440446
909 Ga0207663_10069031
910 Ga0207663_10093546
911 Ga0207663_10166072
912 Ga0207663_11590123
913 Ga0207662_10074422
914 Ga0207657_10072991
915 Ga0207649_10191407
916 Ga0207649_10667126
917 Ga0207652_11031207
918 Ga0207694_11756687
919 Ga0207687_10010849
920 Ga0207687_10066216
921 Ga0207700_10004785
922 Ga0207700_10085220
923 Ga0207700_10121106
924 Ga0207700_10488039
925 Ga0207700_11486616
926 Ga0207664_10001310
927 Ga0207664_10008528
928 Ga0207664_10026238
929 Ga0207664_10083219
930 Ga0207664_10244011
931 Ga0207664_10276292
932 Ga0207664_10402074
933 Ga0207664_10434410
934 Ga0207664_11336483
935 Ga0207664_11347569
936 Ga0207664_11862235
937 Ga0207644_10344535
938 Ga0207644_10810507
939 Ga0207690_10055646
940 Ga0207690_10139351
941 Ga0207690_10815563
942 Ga0207690_11531663
943 Ga0207706_10241025
944 Ga0207706_10313344
945 Ga0207686_10984758
946 Ga0207709_10034676
947 Ga0207670_10027082
948 Ga0207669_10349140
949 Ga0207669_10541376
950 Ga0207704_10042883
951 Ga0207704_10054587
952 Ga0207704_10233939
953 Ga0207665_10006524
954 Ga0207665_10039444
955 Ga0207691_10327076
956 Ga0207711_10796346
957 Ga0207711_11265068
958 Ga0207689_11247257
959 Ga0207689_11827916
960 Ga0207661_10225805
961 Ga0207661_10291092
962 Ga0207661_10523113
963 Ga0207679_10022979
964 Ga0207679_10664084
965 Ga0207667_10304810
966 Ga0207667_11436222
967 Ga0207712_10011136
968 Ga0207712_10590113
969 Ga0207668_10079117
970 Ga0207668_10187124
971 Ga0207640_10240989
972 Ga0207640_10410762
973 Ga0207658_10748710
974 Ga0207677_10069992
975 Ga0207677_10218070
976 Ga0207677_10286650
977 Ga0207703_12283566
978 Ga0207639_10089294
979 Ga0207678_10426227
980 Ga0207678_10779022
981 Ga0207708_10000257
982 Ga0207708_10006737
983 Ga0207702_11127726
984 Ga0207641_10474354
985 Ga0207641_11024291
986 Ga0207648_10024849
987 Ga0207676_10032298
988 Ga0207676_10279940
989 Ga0207676_10382585
990 Ga0207674_10146160
991 Ga0207674_10537809
992 Ga0207675_100013552
993 Ga0207675_100288124
994 Ga0207683_10004929
995 Ga0207698_10044252
996 Ga0207698_10303572
997 Ga0207428_10265703
998 Ga0207428_10362316
999 Ga0268265_10200972
1000 Ga0268265_11724196
1001 Ga0268264_10051841
1002 Ga0265773_1001040
1003 Ga0307408_100564852
1004 Ga0307508_10599750
1005 Ga0307405_10063065
1006 Ga0307405_11643206
1007 Ga0307413_10202732
1008 Ga0307410_10089032
1009 Ga0307406_10010707
1010 Ga0307406_10521788
1011 Ga0307407_10053232
1012 Ga0307407_10522467
1013 Ga0307409_100091745
1014 Ga0307409_102868430
1015 Ga0307416_100689800
1016 Ga0307414_10151090
1017 Ga0307411_10160044
1018 Ga0307411_10513573
1019 Ga0307415_100024290
1020 Ga0307415_100460512
1021 Ga0373926_0000669
1022 Ga0373926_0235475
1023 Ga0373934_0005922
1024 Ga0373934_0290879
1025 Ga0373944_0006404
1026 Ga0373923_0012613
1027 Ga0373936_0006206
1028 Ga0373936_0011774
1029 Ga0373945_0000183
1030 Ga0373953_0058116
1031 Ga0373954_0044602
1032 Ga0373956_0012548
1033 Ga0373957_0070720
1034 Ga0373957_0257819
1035 Ga0373943_0003396
1036 Ga0373943_0089661
1037 Ga0373943_0530612
1038 Ga0373946_0000342
1039 Ga0373955_0024710
1040 Ga0373955_0077311
1041 Ga0373924_0020662
1042 Ga0373935_0003699
1043 Ga0373935_0209089
1044 Ga0373935_0430759
1045 Ga0373935_1067151
1046 Ga0373927_0044908
1047 Ga0373927_0592702
1048 Ga0373933_0081679
1049 Ga0373933_0103634
1050 Ga0373947_0002494
1051 Ga0373947_0535475
1052 Ga0373937_0007626
1053 Ga0373937_0096395
1054 Ga0373937_1861043
1055 Ga0373925_0007696
1056 Ga0373925_0046238
1057 Ga0373925_0267702
1058 Ga0373925_0358595
1059 Ga0395899_0464197
1060 Ga0395900_1207558
1061 Ga0436364_0005797
1062 Ga0436364_0080238
1063 Ga0436364_0164224
1064 Ga0436364_0277033
1065 Ga0436364_0601973
1066 Ga0436364_0742832
1067 Ga0436364_0909519
1068 Ga0436364_0976537
1069 Ga0436364_1040466
1070 Ga0395901_1104653
1071 Ga0436365_0261533
1072 Ga0436365_0506212
1073 Ga0436365_0942116
1074 Ga0436365_1473063
1075 Ga0436365_1535432
1076 Ga0436360_0140758
1077 Ga0436363_0054377
1078 Ga0436363_0226467
1079 Ga0436363_0804670
1080 Ga0436363_1070317
1081 Ga0436363_1678274
1082 Ga0436362_0182618
1083 Ga0436362_0291930
1084 Ga0436362_0339878
1085 Ga0436362_0835069
1086 Ga0436362_0916569
1087 Ga0436362_1029294
1088 Ga0451793_1360198
1089 Ga0451853_1627770
1090 Ga0466969_0213819
1091 Ga0466965_0165800
1092 Ga0466965_0197041
1093 Ga0466963_0011509
1094 Ga0466963_0070565
1095 Ga0466963_0161856
1096 Ga0466963_0170970
1097 Ga0466963_0185105
1098 Ga0466964_0074879
1099 Ga0466964_0214265
1100 Ga0466971_0010877
1101 Ga0466968_0632099
1102 Ga0466957_0024250
1103 Ga0466957_1346245
1104 Ga0466960_0865010
1105 Ga0466960_0865847
1106 Ga0466960_0942271
1107 Ga0466959_0932557
1108 Ga0466959_1164121
1109 Ga0466958_0021562
1110 Ga0466958_0386710
1111 Ga0466967_0032899
1112 Ga0466967_0118062
1113 Ga0466967_0171852
1114 Ga0466967_0328022
1115 Ga0466967_0413111
1116 Ga0466967_0650824
1117 Ga0466967_0830283
1118 Ga0466967_1526293
1119 Ga0466967_1920897
1120 Ga0466967_1978492
1121 Ga0466967_2018516
1122 Ga0466967_2168547
1123 Ga0466967_2223421
1124 Ga0466967_2350167
1125 Ga0495592_0150062
1126 Ga0495592_0183525
1127 Ga0495592_0373716
1128 Ga0495603_0542209
1129 Ga0495603_0662009
1130 Ga0495629_0078111
1131 Ga0495629_0305071
1132 Ga0495629_0321818
1133 Ga0495641_0015755
1134 Ga0495641_0097755
1135 Ga0495641_0511159
1136 Ga0495641_0570225
1137 Ga0495651_0017552
1138 Ga0495651_0021367
1139 Ga0495651_0179382
1140 Ga0495653_0001969
1141 Ga0495653_0040350
1142 Ga0495582_0033732
1143 Ga0495582_0120127
1144 Ga0495582_0861945
1145 Ga0495639_0061090
1146 Ga0495662_0014298
1147 Ga0495664_0015345
1148 Ga0495608_0043177
1149 Ga0495608_0073216
1150 Ga0495608_0090733
1151 Ga0495618_0035497
1152 Ga0495618_0051824
1153 Ga0495618_0848836
1154 Ga0495628_0101706
1155 Ga0495630_0025796
1156 Ga0495630_0110220
1157 Ga0495630_0287018
1158 Ga0495666_0565456
1159 Ga0495652_0015218
1160 Ga0495652_0047882
1161 Ga0495652_0136336
1162 Ga0495652_0514867
1163 Ga0495665_0034814
1164 Ga0495640_0049591
1165 Ga0495640_0178492
1166 Ga0495640_0373083
1167 Ga0495640_0679837
1168 Ga0495586_0348995
1169 Ga0495587_0037446
1170 Ga0495587_0046421
1171 Ga0495587_0060083
1172 Ga0495597_0423350
1173 Ga0495645_0071367
1174 Ga0495645_0096851
1175 Ga0495645_0649854
1176 Ga0495667_0019245
1177 Ga0495667_0083423
1178 Ga0495667_0097485
1179 Ga0495667_0238182
1180 Ga0495634_0021430
1181 Ga0495634_0021522
1182 Ga0495634_0399099
1183 Ga0495635_0001793
1184 Ga0495635_0008009
1185 Ga0495635_0120642
1186 Ga0495657_0012679
1187 Ga0495657_0029077
1188 Ga0495657_0039133
1189 Ga0495599_0022129
1190 Ga0495599_0071393
1191 Ga0495599_0082560
1192 Ga0495623_0027934
1193 Ga0495623_0445954
1194 Ga0495646_0017772
1195 Ga0495646_0093735
1196 Ga0495646_0140082
1197 Ga0495647_0081946
1198 Ga0495613_0222465
1199 Ga0495613_1099368
1200 Ga0495624_0002779
1201 Ga0495624_0728623
1202 Ga0495600_0038299
1203 Ga0495600_0042130
1204 Ga0495600_0071090
1205 Ga0495581_0008731
1206 Ga0495581_0100780
1207 Ga0495581_0301569
1208 Ga0495604_0033864
1209 Ga0495604_0088596
1210 Ga0495604_0350593
1211 Ga0495674_0016313
1212 Ga0495674_0031216
1213 Ga0495674_0046729
1214 Ga0495674_0399669
1215 Ga0495674_0435191
1216 Ga0495676_0027359
1217 Ga0495676_0191080
1218 Ga0495676_0477873
1219 Ga0495680_0001267
1220 Ga0495680_0012859
1221 Ga0495680_0044464
1222 Ga0495680_0154341
1223 Ga0495684_0004023
1224 Ga0495684_0050366
1225 Ga0495684_0102159
1226 Ga0495593_0033202
1227 Ga0495593_0082999
1228 Ga0495602_0015445
1229 Ga0495602_0134685
1230 Ga0495602_0484254
1231 Ga0496100_0027081
1232 Ga0496100_0152476
1233 Ga0496100_0832470
1234 Ga0496100_1548089
1235 Ga0496101_0055365
1236 Ga0496101_0066212
1237 Ga0496101_0071053
1238 Ga0496101_0180375
1239 Ga0496101_0826590
1240 Ga0496101_1551102
1241 Ga0496102_0011630
1242 Ga0496102_0048630
1243 Ga0496102_0061018
1244 Ga0496102_0252632
1245 Ga0496102_1395676
1246 Ga0496103_0032184
1247 Ga0496103_0130584
1248 Ga0496103_0332118
1249 Ga0496104_0007424
1250 Ga0496104_0077961
1251 Ga0496104_0152277
1252 Ga0496104_0264483
1253 Ga0496104_0359980
1254 Ga0496104_1234365
1255 Ga0496105_0025502
1256 Ga0496105_0110505
1257 Ga0496105_0400501
1258 Ga0496106_0022255
1259 Ga0496106_0089526
1260 Ga0496106_0122796
1261 Ga0496106_0156861
1262 Ga0496106_0197282
1263 Ga0496107_0030280
1264 Ga0496107_0042337
1265 Ga0496107_0127378
1266 Ga0496108_0001138
1267 Ga0496108_0007308
1268 Ga0496108_0019138
1269 Ga0496108_0098178
1270 Ga0496108_0178181
1271 Ga0496108_0480988
1272 Ga0496109_0001955
1273 Ga0496109_0042490
1274 Ga0496109_0045500
1275 Ga0496109_0092075
1276 Ga0496109_0109363
1277 Ga0496109_0121914
1278 Ga0496109_0477555
1279 Ga0496109_1501347
1280 Ga0496110_0006618
1281 Ga0496110_0013201
1282 Ga0496110_0415377
1283 Ga0496110_0472508
1284 Ga0496111_0013617
1285 Ga0496111_0035356
1286 Ga0496111_0075899
1287 Ga0496111_0271311
1288 Ga0496111_0405831
1289 Ga0496111_0704103
1290 Ga0496112_0002101
1291 Ga0496112_0019710
1292 Ga0496112_0135279
1293 Ga0496112_0176598
1294 Ga0496112_0219224
1295 Ga0496112_0485261
1296 Ga0496112_1064472
1297 Ga0496113_0007150
1298 Ga0496113_0010704
1299 Ga0496113_0043047
1300 Ga0496113_0123349
1301 Ga0496114_1531568
1302 Ga0496114_1735008
1303 Ga0496115_0051209
1304 Ga0496115_0272613
1305 Ga0496115_0394254
1306 Ga0496126_0200797
1307 Ga0496126_0213105
1308 Ga0501031_0122074
1309 Ga0501067_0460843
1310 Ga0501069_0852739
1311 Ga0501072_0455380
1312 Ga0501044_0403166
1313 nmdc:mga03n38_841227_c1
1314 nmdc:mga06z11_1021642_c1
1315 nmdc:mga05p37_1963204_c1
1316 nmdc:mga05p37_796702_c1
1317 nmdc:mga09592_1282265_c1
1318 nmdc:mga06r32_529411_c1
1319 nmdc:mga08y16_1365836_c1
1320 nmdc:mga08y16_165615_c1
1321 nmdc:mga08y16_188827_c1
1322 nmdc:mga08y16_824738_c1
1323 nmdc:mga0n895_2008168_c1
1324 nmdc:mga0n895_276793_c1
1325 nmdc:mga0rr50_123652_c1
1326 nmdc:mga08x19_461035_c1
1327 nmdc:mga08x19_642585_c1
1328 nmdc:mga0a205_31811_c1
1329 nmdc:mga0a205_679785_c1
1330 Ga0495601_0125514
1331 Ga0495612_0030349
1332 Ga0495612_0234110
1333 Ga0495595_0003412
1334 Ga0495619_0646586
1335 Ga0495619_0887734
1336 Ga0501082_0647726
1337 Ga0501082_1825450
1338 Ga0466962_0509488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.931 13 68
7q37-assembly1.cif.gz_A crystal structure of proton pump mar rhodopsin pressurized with krypton 0.908 13 69
3stq-assembly3.cif.gz_C hypothetical protein pa2703 pseudomonas aeruginosa pao1 0.7752 10 70
3g80-assembly1.cif.gz_A nodamura virus protein b2, rna-binding domain 0.7461 12 65
3rq9-assembly1.cif.gz_A structure of tsi2, a tse2-immunity protein from pseudomonas aeruginosa 0.7437 10 69
ID Description Score Start End Superfamily
af_O35165_2_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.8443 24 69 1.20.58.400
af_Q7T366_1_120_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8429 24 69 1.20.58.90
af_O35166_1_120_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.838 24 69 1.20.58.90
af_Q61390_407_528_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.831 17 56 1.10.560.10
af_Q4CVD2_1_111_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.8249 13 68 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A7V9EBS6-F1-model_v4 Uncharacterized protein 0.9782 9 69 GO:0016020
AF-A0A292Z2A8-F1-model_v4 Uncharacterized protein 0.9754 1 69 GO:0016020
AF-A0A263DSI9-F1-model_v4 Uncharacterized protein 0.9752 12 69
AF-A0A371XPB8-F1-model_v4 DUF4328 domain-containing protein 0.9737 1 68
AF-A4FHJ4-F1-model_v4 Uncharacterized protein 0.9721 1 70

Map