F473924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 668 | 318 | 1336 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300025297|Ga0209758_1008466|Ga0209758_10084664 |
| Length | 228 |
| Sequence | VSKVEQDPFDPDAFLAKAGAGRSIQKYHKNEKIYCQGEAADSVFYIQEGRVKLLVISGQGKEAIVGILQAGQFFGESCLGEHSRRMATTVAMEDSLITAIRKNEMLTVLRDQPKFSELFMAYLLNRNCRIEADLIDHLFNSSEKRLARLLVLLANFSKEDAGPQSIHLQISQESLAEMIGTTRSRVSYFMNRFRRMGFISYNGHIEVHSALRHAVLNEKLEFGDDPDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 175 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 261 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 262 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 266 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 269 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 271 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 272 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 273 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 277 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 278 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 280 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 281 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 282 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 283 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 287 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 288 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 290 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 291 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 292 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 293 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 294 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 295 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 296 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 297 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 298 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 299 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 300 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 301 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 302 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 303 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 304 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 305 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 306 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 307 | 2904699407 | |||
| 308 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 309 | 2922425934 | |||
| 310 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 311 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 312 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 313 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 314 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 315 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 316 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 317 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 318 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.49 |
| Metatranscriptomes | 0.6 |
| Isolates | 3.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.43 |
| Nodule | 2.4 |
| Rhizoplane | 8.83 |
| Rhizosphere | 67.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209758_1008466 | 3300025297 | Bacteria | 6650 |
| 2 | JGI25153J46596_10000452 | 3300003215 | Bacteria | 26287 |
| 3 | JGI25153J46596_10027854 | 3300003215 | Bacteria | 1971 |
| 4 | JGI25160J50197_1000515 | 3300003354 | Bacteria | 22805 |
| 5 | JGI25160J50197_1001954 | 3300003354 | Bacteria | 9837 |
| 6 | Ga0055542_1013519 | 3300003762 | Bacteria | 1371 |
| 7 | Ga0055531_10018768 | 3300003794 | Bacteria | 2837 |
| 8 | Ga0065165_1012658 | 3300005262 | Bacteria | 3417 |
| 9 | Ga0065165_1013906 | 3300005262 | Bacteria | 3160 |
| 10 | Ga0065715_10119545 | 3300005293 | Bacteria | 2284 |
| 11 | Ga0070658_10010161 | 3300005327 | Bacteria | 7554 |
| 12 | Ga0070658_10177086 | 3300005327 | Bacteria | 1794 |
| 13 | Ga0070676_10203680 | 3300005328 | Bacteria | 1298 |
| 14 | Ga0070683_100102899 | 3300005329 | Bacteria | 2690 |
| 15 | Ga0070683_100191575 | 3300005329 | Bacteria | 1941 |
| 16 | Ga0070690_100181501 | 3300005330 | Bacteria | 1455 |
| 17 | Ga0068869_100004469 | 3300005334 | Bacteria | 8695 |
| 18 | Ga0068869_100026542 | 3300005334 | Bacteria | 4033 |
| 19 | Ga0068869_100079060 | 3300005334 | Bacteria | 2450 |
| 20 | Ga0070666_10319391 | 3300005335 | Bacteria | 1108 |
| 21 | Ga0070680_100000783 | 3300005336 | Bacteria | 22328 |
| 22 | Ga0070680_100023282 | 3300005336 | Bacteria | 4939 |
| 23 | Ga0070680_100051070 | 3300005336 | Bacteria | 3374 |
| 24 | Ga0070680_100911750 | 3300005336 | Bacteria | 758 |
| 25 | Ga0070689_100291977 | 3300005340 | Bacteria | 1355 |
| 26 | Ga0070689_100588434 | 3300005340 | Bacteria | 963 |
| 27 | Ga0070691_10001231 | 3300005341 | Bacteria | 10780 |
| 28 | Ga0070691_10042603 | 3300005341 | Bacteria | 2148 |
| 29 | Ga0070668_100027966 | 3300005347 | Bacteria | 4279 |
| 30 | Ga0070668_100131209 | 3300005347 | Bacteria | 2011 |
| 31 | Ga0070668_100159754 | 3300005347 | Bacteria | 1828 |
| 32 | Ga0070675_100179268 | 3300005354 | Bacteria | 1831 |
| 33 | Ga0070667_100454045 | 3300005367 | Bacteria | 1171 |
| 34 | Ga0070667_100477098 | 3300005367 | Bacteria | 1142 |
| 35 | Ga0070709_10006867 | 3300005434 | Bacteria | 6218 |
| 36 | Ga0070709_10014217 | 3300005434 | Bacteria | 4498 |
| 37 | Ga0070709_10032965 | 3300005434 | Bacteria | 3128 |
| 38 | Ga0070709_10411396 | 3300005434 | Bacteria | 1012 |
| 39 | Ga0070714_100011614 | 3300005435 | Bacteria | 6991 |
| 40 | Ga0070714_100017763 | 3300005435 | Bacteria | 5767 |
| 41 | Ga0070714_100017836 | 3300005435 | Bacteria | 5756 |
| 42 | Ga0070714_100676335 | 3300005435 | Bacteria | 995 |
| 43 | Ga0070714_100832508 | 3300005435 | Bacteria | 894 |
| 44 | Ga0070713_100011720 | 3300005436 | Bacteria | 6399 |
| 45 | Ga0070713_100021325 | 3300005436 | Bacteria | 4980 |
| 46 | Ga0070713_100073114 | 3300005436 | Bacteria | 2901 |
| 47 | Ga0070713_100188447 | 3300005436 | Bacteria | 1857 |
| 48 | Ga0070713_100598715 | 3300005436 | Unclassified | 1047 |
| 49 | Ga0070710_10000766 | 3300005437 | Bacteria | 15325 |
| 50 | Ga0070710_10001656 | 3300005437 | Bacteria | 10502 |
| 51 | Ga0070710_10013077 | 3300005437 | Bacteria | 4143 |
| 52 | Ga0070711_100010851 | 3300005439 | Bacteria | 5648 |
| 53 | Ga0070711_100017723 | 3300005439 | Bacteria | 4537 |
| 54 | Ga0070711_100072296 | 3300005439 | Bacteria | 2433 |
| 55 | Ga0070711_100128221 | 3300005439 | Bacteria | 1886 |
| 56 | Ga0070705_100161051 | 3300005440 | Bacteria | 1500 |
| 57 | Ga0070663_100008631 | 3300005455 | Bacteria | 6281 |
| 58 | Ga0070663_100026165 | 3300005455 | Bacteria | 3948 |
| 59 | Ga0070663_100077143 | 3300005455 | Bacteria | 2438 |
| 60 | Ga0070663_100088740 | 3300005455 | Bacteria | 2287 |
| 61 | Ga0070678_100003618 | 3300005456 | Bacteria | 8618 |
| 62 | Ga0070678_100010779 | 3300005456 | Bacteria | 5602 |
| 63 | Ga0070678_100014830 | 3300005456 | Bacteria | 4931 |
| 64 | Ga0070662_100248312 | 3300005457 | Bacteria | 1429 |
| 65 | Ga0070681_10000423 | 3300005458 | Bacteria | 34363 |
| 66 | Ga0070681_10165586 | 3300005458 | Bacteria | 2133 |
| 67 | Ga0070681_10237034 | 3300005458 | Bacteria | 1738 |
| 68 | Ga0070681_10451490 | 3300005458 | Bacteria | 1197 |
| 69 | Ga0070681_10721296 | 3300005458 | Bacteria | 913 |
| 70 | Ga0070685_10224415 | 3300005466 | Bacteria | 1232 |
| 71 | Ga0070685_10426439 | 3300005466 | Bacteria | 924 |
| 72 | Ga0070698_100380830 | 3300005471 | Bacteria | 1343 |
| 73 | Ga0070679_100002998 | 3300005530 | Bacteria | 15416 |
| 74 | Ga0070679_100024886 | 3300005530 | Bacteria | 5868 |
| 75 | Ga0070679_100118122 | 3300005530 | Bacteria | 2637 |
| 76 | Ga0070679_100549454 | 3300005530 | Bacteria | 1099 |
| 77 | Ga0070679_100793588 | 3300005530 | Bacteria | 890 |
| 78 | Ga0070684_100001413 | 3300005535 | Bacteria | 17268 |
| 79 | Ga0070684_100020867 | 3300005535 | Bacteria | 5438 |
| 80 | Ga0070684_100406599 | 3300005535 | Bacteria | 1255 |
| 81 | Ga0068853_100019122 | 3300005539 | Bacteria | 5676 |
| 82 | Ga0068853_100391867 | 3300005539 | Bacteria | 1299 |
| 83 | Ga0070693_100121212 | 3300005547 | Bacteria | 1622 |
| 84 | Ga0070665_100021319 | 3300005548 | Bacteria | 6517 |
| 85 | Ga0070665_100041276 | 3300005548 | Bacteria | 4637 |
| 86 | Ga0070665_100076213 | 3300005548 | Bacteria | 3361 |
| 87 | Ga0070665_100432740 | 3300005548 | Bacteria | 1325 |
| 88 | Ga0070665_100467218 | 3300005548 | Bacteria | 1272 |
| 89 | Ga0070704_100423157 | 3300005549 | Bacteria | 1141 |
| 90 | Ga0068855_100108438 | 3300005563 | Bacteria | 3189 |
| 91 | Ga0068855_100364226 | 3300005563 | Bacteria | 1590 |
| 92 | Ga0068855_100638543 | 3300005563 | Bacteria | 1145 |
| 93 | Ga0070664_100135099 | 3300005564 | Bacteria | 2168 |
| 94 | Ga0068857_100000816 | 3300005577 | Bacteria | 23335 |
| 95 | Ga0068854_100035345 | 3300005578 | Bacteria | 3496 |
| 96 | Ga0068854_100261038 | 3300005578 | Bacteria | 1387 |
| 97 | Ga0068856_100002260 | 3300005614 | Bacteria | 19893 |
| 98 | Ga0068856_100552978 | 3300005614 | Bacteria | 1172 |
| 99 | Ga0068856_100655933 | 3300005614 | Bacteria | 1070 |
| 100 | Ga0070702_100088559 | 3300005615 | Bacteria | 1872 |
| 101 | Ga0068852_100002224 | 3300005616 | Bacteria | 13308 |
| 102 | Ga0068852_100045122 | 3300005616 | Bacteria | 3747 |
| 103 | Ga0068852_100155942 | 3300005616 | Bacteria | 2127 |
| 104 | Ga0068852_100180315 | 3300005616 | Bacteria | 1986 |
| 105 | Ga0068859_100195551 | 3300005617 | Bacteria | 2107 |
| 106 | Ga0068864_100155739 | 3300005618 | Bacteria | 2074 |
| 107 | Ga0068861_100416889 | 3300005719 | Bacteria | 1195 |
| 108 | Ga0068863_100187035 | 3300005841 | Bacteria | 1989 |
| 109 | Ga0068858_100197881 | 3300005842 | Bacteria | 1900 |
| 110 | Ga0068858_100357396 | 3300005842 | Bacteria | 1400 |
| 111 | Ga0068858_100425985 | 3300005842 | Bacteria | 1276 |
| 112 | Ga0068860_100086358 | 3300005843 | Bacteria | 2985 |
| 113 | Ga0068860_100120647 | 3300005843 | Bacteria | 2510 |
| 114 | Ga0068860_100247930 | 3300005843 | Bacteria | 1733 |
| 115 | Ga0068862_100018780 | 3300005844 | Bacteria | 5761 |
| 116 | Ga0068862_100132490 | 3300005844 | Bacteria | 2206 |
| 117 | Ga0068862_100177254 | 3300005844 | Bacteria | 1911 |
| 118 | Ga0068862_100201329 | 3300005844 | Bacteria | 1795 |
| 119 | Ga0068862_100249723 | 3300005844 | Bacteria | 1616 |
| 120 | Ga0068862_100425490 | 3300005844 | Bacteria | 1247 |
| 121 | Ga0070717_10001543 | 3300006028 | Bacteria | 15977 |
| 122 | Ga0070717_10009643 | 3300006028 | Bacteria | 7268 |
| 123 | Ga0070717_10072969 | 3300006028 | Bacteria | 2867 |
| 124 | Ga0070717_10159722 | 3300006028 | Bacteria | 1955 |
| 125 | Ga0070717_10458278 | 3300006028 | Bacteria | 1150 |
| 126 | Ga0075365_10013000 | 3300006038 | Bacteria | 4964 |
| 127 | Ga0075365_10067432 | 3300006038 | Bacteria | 2402 |
| 128 | Ga0075365_10147896 | 3300006038 | Bacteria | 1633 |
| 129 | Ga0075368_10002348 | 3300006042 | Bacteria | 6149 |
| 130 | Ga0075363_100188431 | 3300006048 | Bacteria | 1176 |
| 131 | Ga0075363_100211248 | 3300006048 | Bacteria | 1111 |
| 132 | Ga0070716_100010823 | 3300006173 | Bacteria | 4586 |
| 133 | Ga0070716_100090997 | 3300006173 | Bacteria | 1847 |
| 134 | Ga0070712_100000135 | 3300006175 | Bacteria | 38798 |
| 135 | Ga0070712_100004486 | 3300006175 | Bacteria | 8618 |
| 136 | Ga0070712_100010979 | 3300006175 | Bacteria | 5731 |
| 137 | Ga0070712_100034722 | 3300006175 | Bacteria | 3419 |
| 138 | Ga0070712_100056064 | 3300006175 | Bacteria | 2762 |
| 139 | Ga0075367_10013947 | 3300006178 | Bacteria | 4338 |
| 140 | Ga0075367_10082754 | 3300006178 | Bacteria | 1943 |
| 141 | Ga0075366_10003590 | 3300006195 | Bacteria | 8214 |
| 142 | Ga0075366_10047238 | 3300006195 | Bacteria | 2551 |
| 143 | Ga0097621_100754962 | 3300006237 | Bacteria | 899 |
| 144 | Ga0075370_10008154 | 3300006353 | Bacteria | 5375 |
| 145 | Ga0075370_10020357 | 3300006353 | Bacteria | 3625 |
| 146 | Ga0075370_10063401 | 3300006353 | Bacteria | 2107 |
| 147 | Ga0068871_100230689 | 3300006358 | Bacteria | 1607 |
| 148 | Ga0068865_100061443 | 3300006881 | Bacteria | 2634 |
| 149 | Ga0075436_100279286 | 3300006914 | Bacteria | 1194 |
| 150 | Ga0097620_100195540 | 3300006931 | Bacteria | 2107 |
| 151 | Ga0099794_10012081 | 3300007265 | Bacteria | 3714 |
| 152 | Ga0099794_10021821 | 3300007265 | Bacteria | 2913 |
| 153 | Ga0099795_10003403 | 3300007788 | Bacteria | 3931 |
| 154 | Ga0099795_10021273 | 3300007788 | Bacteria | 2125 |
| 155 | Ga0099795_10036412 | 3300007788 | Bacteria | 1726 |
| 156 | Ga0105240_10003489 | 3300009093 | Bacteria | 24383 |
| 157 | Ga0105240_10046509 | 3300009093 | Bacteria | 5498 |
| 158 | Ga0105240_10047603 | 3300009093 | Bacteria | 5425 |
| 159 | Ga0105245_10114400 | 3300009098 | Bacteria | 2513 |
| 160 | Ga0105245_10950334 | 3300009098 | Bacteria | 902 |
| 161 | Ga0105247_10023607 | 3300009101 | Bacteria | 3705 |
| 162 | Ga0105247_10029449 | 3300009101 | Bacteria | 3327 |
| 163 | Ga0105247_10081057 | 3300009101 | Bacteria | 2045 |
| 164 | Ga0105247_10095491 | 3300009101 | Bacteria | 1893 |
| 165 | Ga0105247_10170717 | 3300009101 | Bacteria | 1446 |
| 166 | Ga0105247_10315757 | 3300009101 | Bacteria | 1089 |
| 167 | Ga0105247_10357572 | 3300009101 | Bacteria | 1029 |
| 168 | Ga0105243_10279247 | 3300009148 | Bacteria | 1504 |
| 169 | Ga0105241_10001328 | 3300009174 | Bacteria | 18791 |
| 170 | Ga0105241_10034971 | 3300009174 | Bacteria | 3778 |
| 171 | Ga0105241_10057004 | 3300009174 | Bacteria | 2996 |
| 172 | Ga0105241_10157924 | 3300009174 | Bacteria | 1861 |
| 173 | Ga0105241_10180533 | 3300009174 | Bacteria | 1751 |
| 174 | Ga0105241_10241371 | 3300009174 | Bacteria | 1527 |
| 175 | Ga0105241_10736958 | 3300009174 | Bacteria | 902 |
| 176 | Ga0105242_10473240 | 3300009176 | Bacteria | 1186 |
| 177 | Ga0105248_10026820 | 3300009177 | Bacteria | 6409 |
| 178 | Ga0105248_10028048 | 3300009177 | Bacteria | 6271 |
| 179 | Ga0105248_10283762 | 3300009177 | Bacteria | 1864 |
| 180 | Ga0105248_10467738 | 3300009177 | Bacteria | 1421 |
| 181 | Ga0105248_11013463 | 3300009177 | Bacteria | 938 |
| 182 | Ga0105237_10000828 | 3300009545 | Bacteria | 42351 |
| 183 | Ga0105237_10006546 | 3300009545 | Bacteria | 12887 |
| 184 | Ga0105237_10007030 | 3300009545 | Bacteria | 12390 |
| 185 | Ga0105237_10040195 | 3300009545 | Bacteria | 4718 |
| 186 | Ga0105237_10041311 | 3300009545 | Bacteria | 4651 |
| 187 | Ga0105237_10065124 | 3300009545 | Bacteria | 3641 |
| 188 | Ga0105237_10171246 | 3300009545 | Bacteria | 2171 |
| 189 | Ga0105237_10200196 | 3300009545 | Bacteria | 1997 |
| 190 | Ga0105237_10593333 | 3300009545 | Bacteria | 1115 |
| 191 | Ga0105238_10001254 | 3300009551 | Bacteria | 25546 |
| 192 | Ga0105238_10089676 | 3300009551 | Bacteria | 3062 |
| 193 | Ga0105238_10253521 | 3300009551 | Bacteria | 1738 |
| 194 | Ga0105249_10115333 | 3300009553 | Bacteria | 2545 |
| 195 | Ga0105249_10283363 | 3300009553 | Bacteria | 1656 |
| 196 | Ga0105249_10319740 | 3300009553 | Bacteria | 1563 |
| 197 | Ga0105249_11138467 | 3300009553 | Bacteria | 851 |
| 198 | Ga0099796_10004221 | 3300010159 | Bacteria | 3449 |
| 199 | Ga0099796_10017587 | 3300010159 | Bacteria | 2132 |
| 200 | Ga0105239_10017195 | 3300010375 | Bacteria | 7994 |
| 201 | Ga0105239_10086875 | 3300010375 | Bacteria | 3447 |
| 202 | Ga0105239_10200184 | 3300010375 | Bacteria | 2237 |
| 203 | Ga0105239_10696539 | 3300010375 | Bacteria | 1161 |
| 204 | Ga0105239_11309090 | 3300010375 | Bacteria | 836 |
| 205 | Ga0105246_10014068 | 3300011119 | Bacteria | 5026 |
| 206 | Ga0105246_10079417 | 3300011119 | Bacteria | 2333 |
| 207 | Ga0105246_10343329 | 3300011119 | Bacteria | 1221 |
| 208 | Ga0157371_10241450 | 3300013102 | Bacteria | 1300 |
| 209 | Ga0157370_10066257 | 3300013104 | Bacteria | 3416 |
| 210 | Ga0157370_10232676 | 3300013104 | Bacteria | 1705 |
| 211 | Ga0157370_10566037 | 3300013104 | Bacteria | 1041 |
| 212 | Ga0157369_10006368 | 3300013105 | Bacteria | 13695 |
| 213 | Ga0157369_10090752 | 3300013105 | Bacteria | 3262 |
| 214 | Ga0157369_10216536 | 3300013105 | Bacteria | 2006 |
| 215 | Ga0157369_10294794 | 3300013105 | Bacteria | 1688 |
| 216 | Ga0157374_10018094 | 3300013296 | Bacteria | 6214 |
| 217 | Ga0157374_10027874 | 3300013296 | Bacteria | 5099 |
| 218 | Ga0157378_10045902 | 3300013297 | Bacteria | 3884 |
| 219 | Ga0157378_10260158 | 3300013297 | Bacteria | 1665 |
| 220 | Ga0157378_10289553 | 3300013297 | Bacteria | 1581 |
| 221 | Ga0157378_10531754 | 3300013297 | Bacteria | 1178 |
| 222 | Ga0163162_10017351 | 3300013306 | Bacteria | 7042 |
| 223 | Ga0163162_10067194 | 3300013306 | Bacteria | 3635 |
| 224 | Ga0163162_10089841 | 3300013306 | Bacteria | 3153 |
| 225 | Ga0163162_10251998 | 3300013306 | Bacteria | 1897 |
| 226 | Ga0163162_10392724 | 3300013306 | Bacteria | 1520 |
| 227 | Ga0157372_10018217 | 3300013307 | Bacteria | 7548 |
| 228 | Ga0157372_10294146 | 3300013307 | Bacteria | 1888 |
| 229 | Ga0157375_10023067 | 3300013308 | Bacteria | 5737 |
| 230 | Ga0157375_10637031 | 3300013308 | Bacteria | 1223 |
| 231 | Ga0163163_10195748 | 3300014325 | Bacteria | 2069 |
| 232 | Ga0163163_10417686 | 3300014325 | Bacteria | 1400 |
| 233 | Ga0157379_10011193 | 3300014968 | Bacteria | 7819 |
| 234 | Ga0157379_10097706 | 3300014968 | Bacteria | 2637 |
| 235 | Ga0157379_10109168 | 3300014968 | Bacteria | 2484 |
| 236 | Ga0157379_10166270 | 3300014968 | Bacteria | 1991 |
| 237 | Ga0157376_10382936 | 3300014969 | Bacteria | 1355 |
| 238 | Ga0157376_10490532 | 3300014969 | Bacteria | 1205 |
| 239 | Ga0157376_10778438 | 3300014969 | Bacteria | 968 |
| 240 | Ga0163161_10379313 | 3300017792 | Bacteria | 1130 |
| 241 | Ga0163161_10531119 | 3300017792 | Bacteria | 962 |
| 242 | Ga0206354_11564108 | 3300020081 | Bacteria | 791 |
| 243 | Ga0224712_10076917 | 3300022467 | Bacteria | 1368 |
| 244 | Ga0224712_10134267 | 3300022467 | Bacteria | 1083 |
| 245 | Ga0209563_113633 | 3300025230 | Bacteria | 1066 |
| 246 | Ga0209677_103687 | 3300025253 | Bacteria | 4814 |
| 247 | Ga0209148_1000305 | 3300025254 | Bacteria | 70375 |
| 248 | Ga0209233_1016177 | 3300025261 | Bacteria | 2060 |
| 249 | Ga0209455_1005953 | 3300025272 | Bacteria | 3675 |
| 250 | Ga0209564_1002350 | 3300025295 | Bacteria | 15267 |
| 251 | Ga0209564_1009385 | 3300025295 | Bacteria | 4667 |
| 252 | Ga0209758_1000703 | 3300025297 | Bacteria | 49647 |
| 253 | Ga0209256_1017086 | 3300025299 | Bacteria | 2430 |
| 254 | Ga0207426_1000401 | 3300025302 | Bacteria | 73412 |
| 255 | Ga0207426_1004331 | 3300025302 | Bacteria | 6992 |
| 256 | Ga0207426_1023015 | 3300025302 | Bacteria | 2131 |
| 257 | Ga0207426_1032714 | 3300025302 | Bacteria | 1684 |
| 258 | Ga0209257_1008475 | 3300025304 | Bacteria | 5831 |
| 259 | Ga0209257_1010366 | 3300025304 | Bacteria | 4734 |
| 260 | Ga0209257_1021817 | 3300025304 | Bacteria | 2309 |
| 261 | Ga0207653_10041573 | 3300025885 | Bacteria | 1510 |
| 262 | Ga0207682_10158246 | 3300025893 | Bacteria | 1025 |
| 263 | Ga0207692_10001730 | 3300025898 | Bacteria | 8265 |
| 264 | Ga0207692_10003668 | 3300025898 | Bacteria | 6017 |
| 265 | Ga0207692_10014527 | 3300025898 | Bacteria | 3443 |
| 266 | Ga0207692_10016497 | 3300025898 | Bacteria | 3273 |
| 267 | Ga0207642_10100012 | 3300025899 | Bacteria | 1453 |
| 268 | Ga0207710_10078032 | 3300025900 | Bacteria | 1531 |
| 269 | Ga0207710_10090591 | 3300025900 | Bacteria | 1430 |
| 270 | Ga0207710_10139238 | 3300025900 | Bacteria | 1170 |
| 271 | Ga0207710_10207532 | 3300025900 | Bacteria | 969 |
| 272 | Ga0207710_10311643 | 3300025900 | Bacteria | 796 |
| 273 | Ga0207680_10075828 | 3300025903 | Bacteria | 2098 |
| 274 | Ga0207680_10210740 | 3300025903 | Bacteria | 1328 |
| 275 | Ga0207685_10116894 | 3300025905 | Bacteria | 1165 |
| 276 | Ga0207699_10010052 | 3300025906 | Bacteria | 4732 |
| 277 | Ga0207699_10120536 | 3300025906 | Bacteria | 1696 |
| 278 | Ga0207699_10320993 | 3300025906 | Bacteria | 1086 |
| 279 | Ga0207699_10403993 | 3300025906 | Bacteria | 973 |
| 280 | Ga0207645_10116839 | 3300025907 | Bacteria | 1730 |
| 281 | Ga0207705_10027508 | 3300025909 | Bacteria | 4056 |
| 282 | Ga0207705_10183723 | 3300025909 | Bacteria | 1579 |
| 283 | Ga0207705_10672386 | 3300025909 | Bacteria | 805 |
| 284 | Ga0207684_10158920 | 3300025910 | Bacteria | 1945 |
| 285 | Ga0207654_10019545 | 3300025911 | Bacteria | 3577 |
| 286 | Ga0207654_10033814 | 3300025911 | Bacteria | 2837 |
| 287 | Ga0207654_10072360 | 3300025911 | Bacteria | 2052 |
| 288 | Ga0207707_10000636 | 3300025912 | Bacteria | 34756 |
| 289 | Ga0207707_10014817 | 3300025912 | Bacteria | 6791 |
| 290 | Ga0207707_10024340 | 3300025912 | Bacteria | 5299 |
| 291 | Ga0207707_10116656 | 3300025912 | Bacteria | 2333 |
| 292 | Ga0207707_10296647 | 3300025912 | Bacteria | 1398 |
| 293 | Ga0207695_10000136 | 3300025913 | Bacteria | 217596 |
| 294 | Ga0207695_10002533 | 3300025913 | Bacteria | 26840 |
| 295 | Ga0207695_10194413 | 3300025913 | Bacteria | 1945 |
| 296 | Ga0207671_10003434 | 3300025914 | Bacteria | 15816 |
| 297 | Ga0207671_10013294 | 3300025914 | Bacteria | 6565 |
| 298 | Ga0207671_10040312 | 3300025914 | Bacteria | 3457 |
| 299 | Ga0207671_10060263 | 3300025914 | Bacteria | 2815 |
| 300 | Ga0207671_10113184 | 3300025914 | Bacteria | 2067 |
| 301 | Ga0207671_10115192 | 3300025914 | Bacteria | 2049 |
| 302 | Ga0207671_10120924 | 3300025914 | Bacteria | 2001 |
| 303 | Ga0207671_10395070 | 3300025914 | Bacteria | 1099 |
| 304 | Ga0207671_10405201 | 3300025914 | Bacteria | 1085 |
| 305 | Ga0207693_10000025 | 3300025915 | Bacteria | 124008 |
| 306 | Ga0207693_10005265 | 3300025915 | Bacteria | 10819 |
| 307 | Ga0207693_10021549 | 3300025915 | Bacteria | 5120 |
| 308 | Ga0207693_10463742 | 3300025915 | Bacteria | 990 |
| 309 | Ga0207693_10464960 | 3300025915 | Bacteria | 988 |
| 310 | Ga0207663_10000148 | 3300025916 | Bacteria | 32396 |
| 311 | Ga0207663_10007509 | 3300025916 | Bacteria | 5657 |
| 312 | Ga0207663_10057898 | 3300025916 | Bacteria | 2443 |
| 313 | Ga0207663_10172353 | 3300025916 | Bacteria | 1538 |
| 314 | Ga0207663_10257596 | 3300025916 | Bacteria | 1287 |
| 315 | Ga0207660_10032278 | 3300025917 | Bacteria | 3613 |
| 316 | Ga0207660_10044674 | 3300025917 | Bacteria | 3117 |
| 317 | Ga0207652_10001333 | 3300025921 | Bacteria | 21932 |
| 318 | Ga0207652_10054433 | 3300025921 | Bacteria | 3440 |
| 319 | Ga0207652_10087250 | 3300025921 | Bacteria | 2736 |
| 320 | Ga0207652_10543617 | 3300025921 | Bacteria | 1044 |
| 321 | Ga0207681_10112872 | 3300025923 | Bacteria | 1980 |
| 322 | Ga0207681_10569897 | 3300025923 | Bacteria | 933 |
| 323 | Ga0207694_10003050 | 3300025924 | Bacteria | 13429 |
| 324 | Ga0207694_10250934 | 3300025924 | Bacteria | 1448 |
| 325 | Ga0207694_10329811 | 3300025924 | Bacteria | 1261 |
| 326 | Ga0207659_10178704 | 3300025926 | Bacteria | 1679 |
| 327 | Ga0207659_10353496 | 3300025926 | Bacteria | 1220 |
| 328 | Ga0207687_10065573 | 3300025927 | Bacteria | 2579 |
| 329 | Ga0207700_10007363 | 3300025928 | Bacteria | 6722 |
| 330 | Ga0207700_10149040 | 3300025928 | Bacteria | 1931 |
| 331 | Ga0207700_10226268 | 3300025928 | Bacteria | 1588 |
| 332 | Ga0207664_10017819 | 3300025929 | Bacteria | 5217 |
| 333 | Ga0207664_10022185 | 3300025929 | Bacteria | 4737 |
| 334 | Ga0207664_10041681 | 3300025929 | Bacteria | 3578 |
| 335 | Ga0207664_10087387 | 3300025929 | Bacteria | 2549 |
| 336 | Ga0207664_10098204 | 3300025929 | Bacteria | 2414 |
| 337 | Ga0207644_10440978 | 3300025931 | Bacteria | 1069 |
| 338 | Ga0207686_10243783 | 3300025934 | Bacteria | 1309 |
| 339 | Ga0207670_10045879 | 3300025936 | Bacteria | 2900 |
| 340 | Ga0207670_10440586 | 3300025936 | Bacteria | 1049 |
| 341 | Ga0207669_10141054 | 3300025937 | Bacteria | 1673 |
| 342 | Ga0207704_10041590 | 3300025938 | Bacteria | 2697 |
| 343 | Ga0207704_10790752 | 3300025938 | Bacteria | 792 |
| 344 | Ga0207665_10002091 | 3300025939 | Bacteria | 13489 |
| 345 | Ga0207665_10003981 | 3300025939 | Bacteria | 9871 |
| 346 | Ga0207665_10013611 | 3300025939 | Bacteria | 5352 |
| 347 | Ga0207665_10068140 | 3300025939 | Bacteria | 2424 |
| 348 | Ga0207665_10400621 | 3300025939 | Bacteria | 1045 |
| 349 | Ga0207691_10522573 | 3300025940 | Bacteria | 1007 |
| 350 | Ga0207711_10222726 | 3300025941 | Bacteria | 1726 |
| 351 | Ga0207689_10098751 | 3300025942 | Bacteria | 2399 |
| 352 | Ga0207689_10109127 | 3300025942 | Bacteria | 2274 |
| 353 | Ga0207661_10002023 | 3300025944 | Bacteria | 13980 |
| 354 | Ga0207661_10004058 | 3300025944 | Bacteria | 10225 |
| 355 | Ga0207661_10020192 | 3300025944 | Bacteria | 4974 |
| 356 | Ga0207661_10468496 | 3300025944 | Bacteria | 1149 |
| 357 | Ga0207679_10203843 | 3300025945 | Bacteria | 1654 |
| 358 | Ga0207679_10233881 | 3300025945 | Bacteria | 1553 |
| 359 | Ga0207667_10000189 | 3300025949 | Bacteria | 90535 |
| 360 | Ga0207667_10227252 | 3300025949 | Bacteria | 1911 |
| 361 | Ga0207667_10752440 | 3300025949 | Bacteria | 974 |
| 362 | Ga0207651_10175895 | 3300025960 | Bacteria | 1693 |
| 363 | Ga0207712_10006797 | 3300025961 | Bacteria | 7215 |
| 364 | Ga0207712_10302519 | 3300025961 | Bacteria | 1313 |
| 365 | Ga0207668_10014976 | 3300025972 | Bacteria | 4810 |
| 366 | Ga0207668_10274140 | 3300025972 | Bacteria | 1380 |
| 367 | Ga0207640_10357569 | 3300025981 | Bacteria | 1175 |
| 368 | Ga0207658_10371741 | 3300025986 | Bacteria | 1250 |
| 369 | Ga0207677_10181755 | 3300026023 | Bacteria | 1655 |
| 370 | Ga0207703_10308968 | 3300026035 | Bacteria | 1445 |
| 371 | Ga0207703_10437952 | 3300026035 | Bacteria | 1219 |
| 372 | Ga0207639_10034086 | 3300026041 | Bacteria | 3760 |
| 373 | Ga0207639_10611736 | 3300026041 | Bacteria | 1005 |
| 374 | Ga0207678_10014664 | 3300026067 | Bacteria | 6897 |
| 375 | Ga0207678_10020691 | 3300026067 | Bacteria | 5768 |
| 376 | Ga0207678_10171262 | 3300026067 | Bacteria | 1854 |
| 377 | Ga0207678_10360778 | 3300026067 | Bacteria | 1254 |
| 378 | Ga0207678_10631369 | 3300026067 | Bacteria | 940 |
| 379 | Ga0207708_10198832 | 3300026075 | Bacteria | 1598 |
| 380 | Ga0207702_10005340 | 3300026078 | Bacteria | 11266 |
| 381 | Ga0207702_10195037 | 3300026078 | Bacteria | 1874 |
| 382 | Ga0207702_10574611 | 3300026078 | Bacteria | 1104 |
| 383 | Ga0207702_10778791 | 3300026078 | Bacteria | 945 |
| 384 | Ga0207702_10795209 | 3300026078 | Unclassified | 935 |
| 385 | Ga0207641_10826989 | 3300026088 | Bacteria | 917 |
| 386 | Ga0207674_10002199 | 3300026116 | Bacteria | 24686 |
| 387 | Ga0207683_10020024 | 3300026121 | Bacteria | 5717 |
| 388 | Ga0207698_10031535 | 3300026142 | Bacteria | 3827 |
| 389 | Ga0207698_10164285 | 3300026142 | Bacteria | 1946 |
| 390 | Ga0207698_10194760 | 3300026142 | Bacteria | 1809 |
| 391 | Ga0207698_10628881 | 3300026142 | Bacteria | 1061 |
| 392 | Ga0209588_1003085 | 3300027671 | Bacteria | 4594 |
| 393 | Ga0209588_1024824 | 3300027671 | Bacteria | 1894 |
| 394 | Ga0265357_1019884 | 3300028023 | Bacteria | 731 |
| 395 | Ga0268266_10003076 | 3300028379 | Bacteria | 17052 |
| 396 | Ga0268266_10008543 | 3300028379 | Bacteria | 9101 |
| 397 | Ga0268266_10162504 | 3300028379 | Bacteria | 2021 |
| 398 | Ga0268266_10264226 | 3300028379 | Bacteria | 1596 |
| 399 | Ga0268266_10400053 | 3300028379 | Bacteria | 1298 |
| 400 | Ga0268266_10490737 | 3300028379 | Bacteria | 1172 |
| 401 | Ga0268265_10074377 | 3300028380 | Bacteria | 2657 |
| 402 | Ga0268265_10088390 | 3300028380 | Bacteria | 2468 |
| 403 | Ga0268265_10262012 | 3300028380 | Bacteria | 1537 |
| 404 | Ga0268264_10073403 | 3300028381 | Bacteria | 2903 |
| 405 | Ga0268264_10082100 | 3300028381 | Bacteria | 2757 |
| 406 | Ga0268264_10449518 | 3300028381 | Bacteria | 1248 |
| 407 | Ga0307517_10085022 | 3300028786 | Bacteria | 2655 |
| 408 | Ga0307515_10015965 | 3300028794 | Bacteria | 13790 |
| 409 | Ga0307515_10021245 | 3300028794 | Bacteria | 11519 |
| 410 | Ga0307515_10331628 | 3300028794 | Bacteria | 1180 |
| 411 | Ga0307515_10461842 | 3300028794 | Bacteria | 884 |
| 412 | Ga0265760_10006241 | 3300031090 | Bacteria | 3411 |
| 413 | Ga0265328_10040324 | 3300031239 | Bacteria | 1721 |
| 414 | Ga0265329_10090348 | 3300031242 | Bacteria | 972 |
| 415 | Ga0265339_10249068 | 3300031249 | Bacteria | 860 |
| 416 | Ga0265327_10148261 | 3300031251 | Bacteria | 1091 |
| 417 | Ga0307513_10082240 | 3300031456 | Bacteria | 3316 |
| 418 | Ga0307508_10000092 | 3300031616 | Bacteria | 105585 |
| 419 | Ga0307508_10184115 | 3300031616 | Bacteria | 1691 |
| 420 | Ga0265314_10054074 | 3300031711 | Bacteria | 2780 |
| 421 | Ga0265314_10083949 | 3300031711 | Bacteria | 2092 |
| 422 | Ga0265314_10193097 | 3300031711 | Bacteria | 1210 |
| 423 | Ga0307516_10005831 | 3300031730 | Bacteria | 14589 |
| 424 | Ga0307516_10007969 | 3300031730 | Bacteria | 12058 |
| 425 | Ga0307405_10587727 | 3300031731 | Bacteria | 907 |
| 426 | Ga0307510_10000928 | 3300033180 | Bacteria | 31078 |
| 427 | Ga0307510_10121708 | 3300033180 | Bacteria | 2312 |
| 428 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 429 | Ga0316215_1004848 | 3300033544 | Bacteria | 1292 |
| 430 | Ga0373928_0035435 | 3300035084 | Bacteria | 1124 |
| 431 | Ga0373941_0003984 | 3300035115 | Bacteria | 3384 |
| 432 | Ga0373960_0012581 | 3300035121 | Bacteria | 2105 |
| 433 | Ga0373943_0014535 | 3300035170 | Bacteria | 3567 |
| 434 | Ga0373931_0029887 | 3300035691 | Bacteria | 2801 |
| 435 | Ga0373931_0036583 | 3300035691 | Bacteria | 2560 |
| 436 | Ga0373931_0054458 | 3300035691 | Bacteria | 2138 |
| 437 | Ga0373933_0000368 | 3300035724 | Bacteria | 28785 |
| 438 | Ga0373937_0643420 | 3300036401 | Bacteria | 1006 |
| 439 | Ga0395900_0699102 | 3300037418 | Bacteria | 948 |
| 440 | Ga0395898_0004778 | 3300037466 | Bacteria | 14739 |
| 441 | Ga0395905_0276015 | 3300037471 | Bacteria | 1566 |
| 442 | Ga0395905_0522355 | 3300037471 | Bacteria | 1088 |
| 443 | Ga0395901_0095741 | 3300038443 | Bacteria | 3111 |
| 444 | Ga0451841_0838279 | 3300041498 | Bacteria | 1626 |
| 445 | Ga0495603_0074508 | 3300046455 | Bacteria | 1993 |
| 446 | Ga0495603_0260169 | 3300046455 | Bacteria | 999 |
| 447 | Ga0495629_0009850 | 3300046459 | Bacteria | 6974 |
| 448 | Ga0495638_0015651 | 3300046460 | Bacteria | 5089 |
| 449 | Ga0495651_0009663 | 3300046462 | Bacteria | 7417 |
| 450 | Ga0495653_0037199 | 3300046463 | Bacteria | 3827 |
| 451 | Ga0495582_0057579 | 3300046473 | Bacteria | 2143 |
| 452 | Ga0495605_0072302 | 3300046474 | Bacteria | 1627 |
| 453 | Ga0495639_0145000 | 3300046475 | Bacteria | 1143 |
| 454 | Ga0495594_0250081 | 3300046499 | Bacteria | 1010 |
| 455 | Ga0495607_0012823 | 3300046501 | Bacteria | 5513 |
| 456 | Ga0495583_0016331 | 3300046506 | Bacteria | 3997 |
| 457 | Ga0495606_0016019 | 3300046507 | Bacteria | 5741 |
| 458 | Ga0495606_0072187 | 3300046507 | Bacteria | 2170 |
| 459 | Ga0495610_0018624 | 3300046512 | Bacteria | 3914 |
| 460 | Ga0495616_0040996 | 3300046513 | Bacteria | 2364 |
| 461 | Ga0495616_0063771 | 3300046513 | Bacteria | 1800 |
| 462 | Ga0495620_0031566 | 3300046515 | Bacteria | 2426 |
| 463 | Ga0495630_0775502 | 3300046517 | Bacteria | 732 |
| 464 | Ga0495631_0023544 | 3300046518 | Bacteria | 2854 |
| 465 | Ga0495631_0098814 | 3300046518 | Bacteria | 1256 |
| 466 | Ga0495637_0080919 | 3300046520 | Bacteria | 1295 |
| 467 | Ga0495643_0021980 | 3300046522 | Bacteria | 3648 |
| 468 | Ga0495648_0037355 | 3300046524 | Bacteria | 3122 |
| 469 | Ga0495652_0042805 | 3300046529 | Bacteria | 3904 |
| 470 | Ga0495654_0071502 | 3300046530 | Bacteria | 1644 |
| 471 | Ga0495640_0016110 | 3300046533 | Bacteria | 5598 |
| 472 | Ga0495597_0012735 | 3300046542 | Bacteria | 4050 |
| 473 | Ga0495622_0057336 | 3300046557 | Bacteria | 1805 |
| 474 | Ga0495634_0049088 | 3300046642 | Bacteria | 2839 |
| 475 | Ga0495611_0087772 | 3300046648 | Bacteria | 1435 |
| 476 | Ga0495611_0187899 | 3300046648 | Bacteria | 965 |
| 477 | Ga0495625_0095223 | 3300046660 | Bacteria | 2053 |
| 478 | Ga0495625_0149245 | 3300046660 | Bacteria | 1572 |
| 479 | Ga0495635_0017508 | 3300046663 | Bacteria | 5003 |
| 480 | Ga0495661_0165416 | 3300046665 | Bacteria | 1184 |
| 481 | Ga0495588_0027038 | 3300046674 | Bacteria | 2866 |
| 482 | Ga0495599_0151357 | 3300046678 | Bacteria | 1437 |
| 483 | Ga0495613_0136017 | 3300046689 | Bacteria | 1758 |
| 484 | Ga0495624_0028773 | 3300046690 | Bacteria | 3628 |
| 485 | Ga0495670_0056003 | 3300046691 | Bacteria | 1977 |
| 486 | Ga0495649_0012674 | 3300046694 | Bacteria | 4892 |
| 487 | Ga0495649_0095415 | 3300046694 | Bacteria | 1583 |
| 488 | Ga0495649_0102820 | 3300046694 | Bacteria | 1518 |
| 489 | Ga0495600_0014585 | 3300046809 | Bacteria | 4953 |
| 490 | Ga0495660_0146100 | 3300046810 | Bacteria | 1172 |
| 491 | Ga0495581_0067758 | 3300047315 | Bacteria | 2064 |
| 492 | Ga0495604_0230793 | 3300047317 | Bacteria | 1269 |
| 493 | Ga0495672_0009162 | 3300047320 | Bacteria | 7209 |
| 494 | Ga0495683_0142113 | 3300047323 | Bacteria | 1124 |
| 495 | Ga0495686_0048626 | 3300047472 | Bacteria | 2673 |
| 496 | Ga0495686_0161070 | 3300047472 | Bacteria | 1311 |
| 497 | Ga0495626_0109445 | 3300048091 | Bacteria | 1198 |
| 498 | Ga0496100_0040667 | 3300048903 | Bacteria | 2960 |
| 499 | Ga0496100_0563045 | 3300048903 | Bacteria | 883 |
| 500 | Ga0496101_0072007 | 3300048904 | Bacteria | 2536 |
| 501 | Ga0496101_0084425 | 3300048904 | Bacteria | 2352 |
| 502 | Ga0496101_0097592 | 3300048904 | Bacteria | 2195 |
| 503 | Ga0496101_0163519 | 3300048904 | Bacteria | 1708 |
| 504 | Ga0496102_0029798 | 3300048905 | Bacteria | 4883 |
| 505 | Ga0496102_0047174 | 3300048905 | Bacteria | 3913 |
| 506 | Ga0496102_0133853 | 3300048905 | Bacteria | 2322 |
| 507 | Ga0496102_0352961 | 3300048905 | Bacteria | 1385 |
| 508 | Ga0496102_0799110 | 3300048905 | Bacteria | 866 |
| 509 | Ga0496103_0006498 | 3300048906 | Bacteria | 6974 |
| 510 | Ga0496104_0001158 | 3300048907 | Bacteria | 22612 |
| 511 | Ga0496104_0046332 | 3300048907 | Bacteria | 4094 |
| 512 | Ga0496104_0066296 | 3300048907 | Bacteria | 3427 |
| 513 | Ga0496104_0200923 | 3300048907 | Bacteria | 1905 |
| 514 | Ga0496104_0234527 | 3300048907 | Bacteria | 1747 |
| 515 | Ga0496104_0463999 | 3300048907 | Bacteria | 1178 |
| 516 | Ga0496105_0004710 | 3300048908 | Bacteria | 10290 |
| 517 | Ga0496105_0010156 | 3300048908 | Bacteria | 7396 |
| 518 | Ga0496105_0369947 | 3300048908 | Bacteria | 1142 |
| 519 | Ga0496106_0004768 | 3300048909 | Bacteria | 10026 |
| 520 | Ga0496106_0012539 | 3300048909 | Bacteria | 6258 |
| 521 | Ga0496106_0030183 | 3300048909 | Bacteria | 4042 |
| 522 | Ga0496106_0118375 | 3300048909 | Bacteria | 2068 |
| 523 | Ga0496106_0236570 | 3300048909 | Bacteria | 1459 |
| 524 | Ga0496107_0007996 | 3300048910 | Bacteria | 7299 |
| 525 | Ga0496107_0144357 | 3300048910 | Bacteria | 1759 |
| 526 | Ga0496108_0018643 | 3300048911 | Bacteria | 5686 |
| 527 | Ga0496108_0022012 | 3300048911 | Bacteria | 5240 |
| 528 | Ga0496108_0039966 | 3300048911 | Bacteria | 3909 |
| 529 | Ga0496108_0194826 | 3300048911 | Bacteria | 1757 |
| 530 | Ga0496108_0447111 | 3300048911 | Bacteria | 1129 |
| 531 | Ga0496108_0483659 | 3300048911 | Bacteria | 1081 |
| 532 | Ga0496109_0025798 | 3300048912 | Bacteria | 5239 |
| 533 | Ga0496109_0201432 | 3300048912 | Bacteria | 1871 |
| 534 | Ga0496109_0214572 | 3300048912 | Bacteria | 1810 |
| 535 | Ga0496110_0001582 | 3300048913 | Bacteria | 16633 |
| 536 | Ga0496110_0016255 | 3300048913 | Bacteria | 6210 |
| 537 | Ga0496110_0122978 | 3300048913 | Bacteria | 2339 |
| 538 | Ga0496110_0443465 | 3300048913 | Bacteria | 1183 |
| 539 | Ga0496110_0830749 | 3300048913 | Bacteria | 829 |
| 540 | Ga0496111_0045339 | 3300048914 | Bacteria | 3163 |
| 541 | Ga0496111_0049174 | 3300048914 | Bacteria | 3040 |
| 542 | Ga0496111_0331112 | 3300048914 | Bacteria | 1127 |
| 543 | Ga0496112_0019557 | 3300048915 | Bacteria | 6394 |
| 544 | Ga0496112_0021694 | 3300048915 | Bacteria | 6109 |
| 545 | Ga0496112_0047365 | 3300048915 | Bacteria | 4217 |
| 546 | Ga0496112_0194851 | 3300048915 | Bacteria | 1987 |
| 547 | Ga0496112_0340566 | 3300048915 | Bacteria | 1443 |
| 548 | Ga0496113_0048068 | 3300048916 | Bacteria | 3173 |
| 549 | Ga0496113_0085278 | 3300048916 | Bacteria | 2426 |
| 550 | Ga0496114_0008737 | 3300048917 | Bacteria | 8025 |
| 551 | Ga0496114_0098077 | 3300048917 | Bacteria | 2498 |
| 552 | Ga0496114_0227961 | 3300048917 | Bacteria | 1636 |
| 553 | Ga0496115_0001085 | 3300048918 | Bacteria | 19693 |
| 554 | Ga0496115_0026896 | 3300048918 | Bacteria | 4495 |
| 555 | Ga0496115_0056643 | 3300048918 | Bacteria | 3151 |
| 556 | Ga0496115_0058036 | 3300048918 | Bacteria | 3113 |
| 557 | Ga0496116_0110018 | 3300048919 | Bacteria | 1622 |
| 558 | Ga0496117_0033068 | 3300048920 | Bacteria | 3916 |
| 559 | Ga0496117_0086306 | 3300048920 | Bacteria | 2039 |
| 560 | Ga0496118_0023315 | 3300048921 | Bacteria | 5380 |
| 561 | Ga0496118_0032338 | 3300048921 | Bacteria | 4312 |
| 562 | Ga0496118_0094593 | 3300048921 | Bacteria | 2043 |
| 563 | Ga0496118_0119118 | 3300048921 | Bacteria | 1727 |
| 564 | Ga0496118_0202614 | 3300048921 | Bacteria | 1173 |
| 565 | Ga0496119_0015262 | 3300048922 | Bacteria | 5933 |
| 566 | Ga0496120_0021987 | 3300048923 | Bacteria | 4018 |
| 567 | Ga0496121_0010402 | 3300048924 | Bacteria | 10500 |
| 568 | Ga0496121_0056437 | 3300048924 | Bacteria | 3262 |
| 569 | Ga0496121_0115235 | 3300048924 | Bacteria | 2041 |
| 570 | Ga0496121_0119316 | 3300048924 | Bacteria | 1995 |
| 571 | Ga0496121_0159257 | 3300048924 | Bacteria | 1653 |
| 572 | Ga0496121_0193365 | 3300048924 | Bacteria | 1457 |
| 573 | Ga0496121_0194740 | 3300048924 | Bacteria | 1450 |
| 574 | Ga0496121_0208485 | 3300048924 | Bacteria | 1386 |
| 575 | Ga0496122_0016595 | 3300048925 | Bacteria | 6952 |
| 576 | Ga0496122_0061849 | 3300048925 | Bacteria | 2745 |
| 577 | Ga0496123_0018256 | 3300048926 | Bacteria | 5586 |
| 578 | Ga0496123_0195197 | 3300048926 | Bacteria | 1043 |
| 579 | Ga0496124_0082765 | 3300048927 | Bacteria | 2634 |
| 580 | Ga0496124_0155564 | 3300048927 | Bacteria | 1788 |
| 581 | Ga0496125_0004577 | 3300048928 | Bacteria | 15842 |
| 582 | Ga0496125_0231446 | 3300048928 | Bacteria | 1181 |
| 583 | Ga0496126_0005628 | 3300048929 | Bacteria | 14249 |
| 584 | Ga0496126_0014342 | 3300048929 | Bacteria | 8014 |
| 585 | Ga0496126_0017332 | 3300048929 | Bacteria | 7179 |
| 586 | Ga0496126_0018592 | 3300048929 | Bacteria | 6880 |
| 587 | Ga0496126_0082162 | 3300048929 | Bacteria | 2847 |
| 588 | Ga0496126_0158135 | 3300048929 | Bacteria | 1938 |
| 589 | Ga0496126_0303184 | 3300048929 | Bacteria | 1317 |
| 590 | Ga0496126_0416739 | 3300048929 | Bacteria | 1086 |
| 591 | Ga0495682_0087406 | 3300049460 | Bacteria | 1120 |
| 592 | nmdc:mga03683_34524_c1 | 3300050489 | Bacteria | 2047 |
| 593 | nmdc:mga03n38_162168_c1 | 3300050490 | Bacteria | 1133 |
| 594 | nmdc:mga03n38_84937_c1 | 3300050490 | Bacteria | 1495 |
| 595 | nmdc:mga0yw44_188790_c1 | 3300050492 | Bacteria | 1359 |
| 596 | nmdc:mga07m45_15715_c1 | 3300050496 | Bacteria | 4043 |
| 597 | nmdc:mga07m45_20179_c1 | 3300050496 | Bacteria | 3619 |
| 598 | nmdc:mga07m45_5454_c1 | 3300050496 | Bacteria | 5177 |
| 599 | nmdc:mga08y16_537669_c1 | 3300050511 | Bacteria | 1184 |
| 600 | nmdc:mga0sz30_30689_c1 | 3300050516 | Bacteria | 2222 |
| 601 | nmdc:mga0sz30_90977_c1 | 3300050516 | Bacteria | 1327 |
| 602 | nmdc:mga0sz30_9146_c1 | 3300050516 | Bacteria | 3759 |
| 603 | nmdc:mga0sz30_9893_c1 | 3300050516 | Bacteria | 3640 |
| 604 | Ga0495601_0208680 | 3300053077 | Bacteria | 1276 |
| 605 | Ga0495619_0356293 | 3300053085 | Bacteria | 1012 |
| 606 | Ga0500578_0028541 | 3300053086 | Bacteria | 3584 |
| 607 | Ga0500578_0052937 | 3300053086 | Bacteria | 2599 |
| 608 | Ga0500578_0130955 | 3300053086 | Bacteria | 1573 |
| 609 | Ga0500581_054088 | 3300053089 | Bacteria | 2041 |
| 610 | Ga0500646_0029026 | 3300053090 | Bacteria | 1513 |
| 611 | Ga0500651_0098038 | 3300053093 | Bacteria | 1800 |
| 612 | Ga0500566_0005483 | 3300053094 | Bacteria | 7548 |
| 613 | Ga0500566_0034093 | 3300053094 | Bacteria | 2963 |
| 614 | Ga0500566_0154478 | 3300053094 | Bacteria | 1203 |
| 615 | Ga0500641_0020683 | 3300053096 | Bacteria | 2500 |
| 616 | Ga0500555_045250 | 3300053103 | Bacteria | 1217 |
| 617 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 618 | Ga0500569_001531 | 3300053109 | Bacteria | 4385 |
| 619 | Ga0500569_059864 | 3300053109 | Bacteria | 1173 |
| 620 | Ga0500592_000496 | 3300053116 | Bacteria | 6503 |
| 621 | Ga0500594_0008522 | 3300053118 | Bacteria | 2340 |
| 622 | Ga0500594_0020703 | 3300053118 | Bacteria | 1643 |
| 623 | Ga0500595_000262 | 3300053119 | Bacteria | 34880 |
| 624 | Ga0500607_145957 | 3300053121 | Bacteria | 1105 |
| 625 | Ga0500617_077151 | 3300053124 | Bacteria | 1450 |
| 626 | Ga0500642_0000104 | 3300053130 | Bacteria | 40747 |
| 627 | Ga0500652_000844 | 3300053131 | Bacteria | 10136 |
| 628 | Ga0500559_0079353 | 3300053136 | Bacteria | 1490 |
| 629 | Ga0500568_0005974 | 3300053139 | Bacteria | 6188 |
| 630 | Ga0500577_0015937 | 3300053142 | Bacteria | 2359 |
| 631 | Ga0500577_0055256 | 3300053142 | Bacteria | 1507 |
| 632 | Ga0500588_0017406 | 3300053146 | Bacteria | 1876 |
| 633 | Ga0500603_016779 | 3300053150 | Bacteria | 1742 |
| 634 | Ga0500616_0001128 | 3300053153 | Bacteria | 27467 |
| 635 | Ga0500622_0000957 | 3300053156 | Bacteria | 24532 |
| 636 | Ga0500634_0045559 | 3300053161 | Bacteria | 2373 |
| 637 | Ga0500637_0040605 | 3300053178 | Bacteria | 2628 |
| 638 | Ga0500570_083623 | 3300053724 | Bacteria | 1424 |
| 639 | Ga0500601_000034 | 3300053737 | Bacteria | 28953 |
| 640 | 2513651867 | 2513237095 | Bacteria | 8976980 |
| 641 | 2513863069 | 2513237137 | Bacteria | 9558895 |
| 642 | 2517895840 | 2517572143 | Bacteria | 9484767 |
| 643 | 2528853700 | 2528768022 | Bacteria | 10457665 |
| 644 | 2528856400 | 2528768022 | Bacteria | 10457665 |
| 645 | 2818242031 | 2816332527 | Bacteria | 8933356 |
| 646 | 2842044766 | 2842038055 | Bacteria | 8002051 |
| 647 | 2842053047 | 2842045827 | Bacteria | 8006841 |
| 648 | 2849077543 | 2849076700 | Bacteria | 7039503 |
| 649 | 2857525373 | 2857524615 | Bacteria | 6615449 |
| 650 | 2888386219 | 2888378607 | Bacteria | 9652610 |
| 651 | 2888392063 | 2888388044 | Bacteria | 7304136 |
| 652 | 2889034979 | 2889033259 | Bacteria | 9099371 |
| 653 | 2889036231 | 2889033259 | Bacteria | 9099371 |
| 654 | 2889038540 | 2889033259 | Bacteria | 9099371 |
| 655 | 2889039215 | 2889033259 | Bacteria | 9099371 |
| 656 | 2904700828 | |||
| 657 | 2904710114 | |||
| 658 | 2919074936 | 2919073203 | Bacteria | 6531949 |
| 659 | 2922428706 | |||
| 660 | 2929623056 | 2929615660 | Bacteria | 9193770 |
| 661 | 2929630641 | 2929624759 | Bacteria | 9339455 |
| 662 | 2933584962 | 2933577622 | Bacteria | 9116884 |
| 663 | 3005507740 | 3005506211 | Bacteria | 6943378 |
| 664 | 8006935611 | 8006933436 | Bacteria | 10410654 |
| 665 | 8006975540 | 8006973647 | Bacteria | 10679141 |
| 666 | 8006993065 | 8006984368 | Bacteria | 9651211 |
| 667 | 8055748795 | 8055742211 | Bacteria | 9226248 |
| 668 | 8056969180 | 8056967851 | Bacteria | 9038162 |
| 669 | Ga0209758_1008466 | |||
| 670 | JGI25153J46596_10000452 | |||
| 671 | JGI25153J46596_10027854 | |||
| 672 | JGI25160J50197_1000515 | |||
| 673 | JGI25160J50197_1001954 | |||
| 674 | Ga0055542_1013519 | |||
| 675 | Ga0055531_10018768 | |||
| 676 | Ga0065165_1012658 | |||
| 677 | Ga0065165_1013906 | |||
| 678 | Ga0065715_10119545 | |||
| 679 | Ga0070658_10010161 | |||
| 680 | Ga0070658_10177086 | |||
| 681 | Ga0070676_10203680 | |||
| 682 | Ga0070683_100102899 | |||
| 683 | Ga0070683_100191575 | |||
| 684 | Ga0070690_100181501 | |||
| 685 | Ga0068869_100004469 | |||
| 686 | Ga0068869_100026542 | |||
| 687 | Ga0068869_100079060 | |||
| 688 | Ga0070666_10319391 | |||
| 689 | Ga0070680_100000783 | |||
| 690 | Ga0070680_100023282 | |||
| 691 | Ga0070680_100051070 | |||
| 692 | Ga0070680_100911750 | |||
| 693 | Ga0070689_100291977 | |||
| 694 | Ga0070689_100588434 | |||
| 695 | Ga0070691_10001231 | |||
| 696 | Ga0070691_10042603 | |||
| 697 | Ga0070668_100027966 | |||
| 698 | Ga0070668_100131209 | |||
| 699 | Ga0070668_100159754 | |||
| 700 | Ga0070675_100179268 | |||
| 701 | Ga0070667_100454045 | |||
| 702 | Ga0070667_100477098 | |||
| 703 | Ga0070709_10006867 | |||
| 704 | Ga0070709_10014217 | |||
| 705 | Ga0070709_10032965 | |||
| 706 | Ga0070709_10411396 | |||
| 707 | Ga0070714_100011614 | |||
| 708 | Ga0070714_100017763 | |||
| 709 | Ga0070714_100017836 | |||
| 710 | Ga0070714_100676335 | |||
| 711 | Ga0070714_100832508 | |||
| 712 | Ga0070713_100011720 | |||
| 713 | Ga0070713_100021325 | |||
| 714 | Ga0070713_100073114 | |||
| 715 | Ga0070713_100188447 | |||
| 716 | Ga0070713_100598715 | |||
| 717 | Ga0070710_10000766 | |||
| 718 | Ga0070710_10001656 | |||
| 719 | Ga0070710_10013077 | |||
| 720 | Ga0070711_100010851 | |||
| 721 | Ga0070711_100017723 | |||
| 722 | Ga0070711_100072296 | |||
| 723 | Ga0070711_100128221 | |||
| 724 | Ga0070705_100161051 | |||
| 725 | Ga0070663_100008631 | |||
| 726 | Ga0070663_100026165 | |||
| 727 | Ga0070663_100077143 | |||
| 728 | Ga0070663_100088740 | |||
| 729 | Ga0070678_100003618 | |||
| 730 | Ga0070678_100010779 | |||
| 731 | Ga0070678_100014830 | |||
| 732 | Ga0070662_100248312 | |||
| 733 | Ga0070681_10000423 | |||
| 734 | Ga0070681_10165586 | |||
| 735 | Ga0070681_10237034 | |||
| 736 | Ga0070681_10451490 | |||
| 737 | Ga0070681_10721296 | |||
| 738 | Ga0070685_10224415 | |||
| 739 | Ga0070685_10426439 | |||
| 740 | Ga0070698_100380830 | |||
| 741 | Ga0070679_100002998 | |||
| 742 | Ga0070679_100024886 | |||
| 743 | Ga0070679_100118122 | |||
| 744 | Ga0070679_100549454 | |||
| 745 | Ga0070679_100793588 | |||
| 746 | Ga0070684_100001413 | |||
| 747 | Ga0070684_100020867 | |||
| 748 | Ga0070684_100406599 | |||
| 749 | Ga0068853_100019122 | |||
| 750 | Ga0068853_100391867 | |||
| 751 | Ga0070693_100121212 | |||
| 752 | Ga0070665_100021319 | |||
| 753 | Ga0070665_100041276 | |||
| 754 | Ga0070665_100076213 | |||
| 755 | Ga0070665_100432740 | |||
| 756 | Ga0070665_100467218 | |||
| 757 | Ga0070704_100423157 | |||
| 758 | Ga0068855_100108438 | |||
| 759 | Ga0068855_100364226 | |||
| 760 | Ga0068855_100638543 | |||
| 761 | Ga0070664_100135099 | |||
| 762 | Ga0068857_100000816 | |||
| 763 | Ga0068854_100035345 | |||
| 764 | Ga0068854_100261038 | |||
| 765 | Ga0068856_100002260 | |||
| 766 | Ga0068856_100552978 | |||
| 767 | Ga0068856_100655933 | |||
| 768 | Ga0070702_100088559 | |||
| 769 | Ga0068852_100002224 | |||
| 770 | Ga0068852_100045122 | |||
| 771 | Ga0068852_100155942 | |||
| 772 | Ga0068852_100180315 | |||
| 773 | Ga0068859_100195551 | |||
| 774 | Ga0068864_100155739 | |||
| 775 | Ga0068861_100416889 | |||
| 776 | Ga0068863_100187035 | |||
| 777 | Ga0068858_100197881 | |||
| 778 | Ga0068858_100357396 | |||
| 779 | Ga0068858_100425985 | |||
| 780 | Ga0068860_100086358 | |||
| 781 | Ga0068860_100120647 | |||
| 782 | Ga0068860_100247930 | |||
| 783 | Ga0068862_100018780 | |||
| 784 | Ga0068862_100132490 | |||
| 785 | Ga0068862_100177254 | |||
| 786 | Ga0068862_100201329 | |||
| 787 | Ga0068862_100249723 | |||
| 788 | Ga0068862_100425490 | |||
| 789 | Ga0070717_10001543 | |||
| 790 | Ga0070717_10009643 | |||
| 791 | Ga0070717_10072969 | |||
| 792 | Ga0070717_10159722 | |||
| 793 | Ga0070717_10458278 | |||
| 794 | Ga0075365_10013000 | |||
| 795 | Ga0075365_10067432 | |||
| 796 | Ga0075365_10147896 | |||
| 797 | Ga0075368_10002348 | |||
| 798 | Ga0075363_100188431 | |||
| 799 | Ga0075363_100211248 | |||
| 800 | Ga0070716_100010823 | |||
| 801 | Ga0070716_100090997 | |||
| 802 | Ga0070712_100000135 | |||
| 803 | Ga0070712_100004486 | |||
| 804 | Ga0070712_100010979 | |||
| 805 | Ga0070712_100034722 | |||
| 806 | Ga0070712_100056064 | |||
| 807 | Ga0075367_10013947 | |||
| 808 | Ga0075367_10082754 | |||
| 809 | Ga0075366_10003590 | |||
| 810 | Ga0075366_10047238 | |||
| 811 | Ga0097621_100754962 | |||
| 812 | Ga0075370_10008154 | |||
| 813 | Ga0075370_10020357 | |||
| 814 | Ga0075370_10063401 | |||
| 815 | Ga0068871_100230689 | |||
| 816 | Ga0068865_100061443 | |||
| 817 | Ga0075436_100279286 | |||
| 818 | Ga0097620_100195540 | |||
| 819 | Ga0099794_10012081 | |||
| 820 | Ga0099794_10021821 | |||
| 821 | Ga0099795_10003403 | |||
| 822 | Ga0099795_10021273 | |||
| 823 | Ga0099795_10036412 | |||
| 824 | Ga0105240_10003489 | |||
| 825 | Ga0105240_10046509 | |||
| 826 | Ga0105240_10047603 | |||
| 827 | Ga0105245_10114400 | |||
| 828 | Ga0105245_10950334 | |||
| 829 | Ga0105247_10023607 | |||
| 830 | Ga0105247_10029449 | |||
| 831 | Ga0105247_10081057 | |||
| 832 | Ga0105247_10095491 | |||
| 833 | Ga0105247_10170717 | |||
| 834 | Ga0105247_10315757 | |||
| 835 | Ga0105247_10357572 | |||
| 836 | Ga0105243_10279247 | |||
| 837 | Ga0105241_10001328 | |||
| 838 | Ga0105241_10034971 | |||
| 839 | Ga0105241_10057004 | |||
| 840 | Ga0105241_10157924 | |||
| 841 | Ga0105241_10180533 | |||
| 842 | Ga0105241_10241371 | |||
| 843 | Ga0105241_10736958 | |||
| 844 | Ga0105242_10473240 | |||
| 845 | Ga0105248_10026820 | |||
| 846 | Ga0105248_10028048 | |||
| 847 | Ga0105248_10283762 | |||
| 848 | Ga0105248_10467738 | |||
| 849 | Ga0105248_11013463 | |||
| 850 | Ga0105237_10000828 | |||
| 851 | Ga0105237_10006546 | |||
| 852 | Ga0105237_10007030 | |||
| 853 | Ga0105237_10040195 | |||
| 854 | Ga0105237_10041311 | |||
| 855 | Ga0105237_10065124 | |||
| 856 | Ga0105237_10171246 | |||
| 857 | Ga0105237_10200196 | |||
| 858 | Ga0105237_10593333 | |||
| 859 | Ga0105238_10001254 | |||
| 860 | Ga0105238_10089676 | |||
| 861 | Ga0105238_10253521 | |||
| 862 | Ga0105249_10115333 | |||
| 863 | Ga0105249_10283363 | |||
| 864 | Ga0105249_10319740 | |||
| 865 | Ga0105249_11138467 | |||
| 866 | Ga0099796_10004221 | |||
| 867 | Ga0099796_10017587 | |||
| 868 | Ga0105239_10017195 | |||
| 869 | Ga0105239_10086875 | |||
| 870 | Ga0105239_10200184 | |||
| 871 | Ga0105239_10696539 | |||
| 872 | Ga0105239_11309090 | |||
| 873 | Ga0105246_10014068 | |||
| 874 | Ga0105246_10079417 | |||
| 875 | Ga0105246_10343329 | |||
| 876 | Ga0157371_10241450 | |||
| 877 | Ga0157370_10066257 | |||
| 878 | Ga0157370_10232676 | |||
| 879 | Ga0157370_10566037 | |||
| 880 | Ga0157369_10006368 | |||
| 881 | Ga0157369_10090752 | |||
| 882 | Ga0157369_10216536 | |||
| 883 | Ga0157369_10294794 | |||
| 884 | Ga0157374_10018094 | |||
| 885 | Ga0157374_10027874 | |||
| 886 | Ga0157378_10045902 | |||
| 887 | Ga0157378_10260158 | |||
| 888 | Ga0157378_10289553 | |||
| 889 | Ga0157378_10531754 | |||
| 890 | Ga0163162_10017351 | |||
| 891 | Ga0163162_10067194 | |||
| 892 | Ga0163162_10089841 | |||
| 893 | Ga0163162_10251998 | |||
| 894 | Ga0163162_10392724 | |||
| 895 | Ga0157372_10018217 | |||
| 896 | Ga0157372_10294146 | |||
| 897 | Ga0157375_10023067 | |||
| 898 | Ga0157375_10637031 | |||
| 899 | Ga0163163_10195748 | |||
| 900 | Ga0163163_10417686 | |||
| 901 | Ga0157379_10011193 | |||
| 902 | Ga0157379_10097706 | |||
| 903 | Ga0157379_10109168 | |||
| 904 | Ga0157379_10166270 | |||
| 905 | Ga0157376_10382936 | |||
| 906 | Ga0157376_10490532 | |||
| 907 | Ga0157376_10778438 | |||
| 908 | Ga0163161_10379313 | |||
| 909 | Ga0163161_10531119 | |||
| 910 | Ga0206354_11564108 | |||
| 911 | Ga0224712_10076917 | |||
| 912 | Ga0224712_10134267 | |||
| 913 | Ga0209563_113633 | |||
| 914 | Ga0209677_103687 | |||
| 915 | Ga0209148_1000305 | |||
| 916 | Ga0209233_1016177 | |||
| 917 | Ga0209455_1005953 | |||
| 918 | Ga0209564_1002350 | |||
| 919 | Ga0209564_1009385 | |||
| 920 | Ga0209758_1000703 | |||
| 921 | Ga0209256_1017086 | |||
| 922 | Ga0207426_1000401 | |||
| 923 | Ga0207426_1004331 | |||
| 924 | Ga0207426_1023015 | |||
| 925 | Ga0207426_1032714 | |||
| 926 | Ga0209257_1008475 | |||
| 927 | Ga0209257_1010366 | |||
| 928 | Ga0209257_1021817 | |||
| 929 | Ga0207653_10041573 | |||
| 930 | Ga0207682_10158246 | |||
| 931 | Ga0207692_10001730 | |||
| 932 | Ga0207692_10003668 | |||
| 933 | Ga0207692_10014527 | |||
| 934 | Ga0207692_10016497 | |||
| 935 | Ga0207642_10100012 | |||
| 936 | Ga0207710_10078032 | |||
| 937 | Ga0207710_10090591 | |||
| 938 | Ga0207710_10139238 | |||
| 939 | Ga0207710_10207532 | |||
| 940 | Ga0207710_10311643 | |||
| 941 | Ga0207680_10075828 | |||
| 942 | Ga0207680_10210740 | |||
| 943 | Ga0207685_10116894 | |||
| 944 | Ga0207699_10010052 | |||
| 945 | Ga0207699_10120536 | |||
| 946 | Ga0207699_10320993 | |||
| 947 | Ga0207699_10403993 | |||
| 948 | Ga0207645_10116839 | |||
| 949 | Ga0207705_10027508 | |||
| 950 | Ga0207705_10183723 | |||
| 951 | Ga0207705_10672386 | |||
| 952 | Ga0207684_10158920 | |||
| 953 | Ga0207654_10019545 | |||
| 954 | Ga0207654_10033814 | |||
| 955 | Ga0207654_10072360 | |||
| 956 | Ga0207707_10000636 | |||
| 957 | Ga0207707_10014817 | |||
| 958 | Ga0207707_10024340 | |||
| 959 | Ga0207707_10116656 | |||
| 960 | Ga0207707_10296647 | |||
| 961 | Ga0207695_10000136 | |||
| 962 | Ga0207695_10002533 | |||
| 963 | Ga0207695_10194413 | |||
| 964 | Ga0207671_10003434 | |||
| 965 | Ga0207671_10013294 | |||
| 966 | Ga0207671_10040312 | |||
| 967 | Ga0207671_10060263 | |||
| 968 | Ga0207671_10113184 | |||
| 969 | Ga0207671_10115192 | |||
| 970 | Ga0207671_10120924 | |||
| 971 | Ga0207671_10395070 | |||
| 972 | Ga0207671_10405201 | |||
| 973 | Ga0207693_10000025 | |||
| 974 | Ga0207693_10005265 | |||
| 975 | Ga0207693_10021549 | |||
| 976 | Ga0207693_10463742 | |||
| 977 | Ga0207693_10464960 | |||
| 978 | Ga0207663_10000148 | |||
| 979 | Ga0207663_10007509 | |||
| 980 | Ga0207663_10057898 | |||
| 981 | Ga0207663_10172353 | |||
| 982 | Ga0207663_10257596 | |||
| 983 | Ga0207660_10032278 | |||
| 984 | Ga0207660_10044674 | |||
| 985 | Ga0207652_10001333 | |||
| 986 | Ga0207652_10054433 | |||
| 987 | Ga0207652_10087250 | |||
| 988 | Ga0207652_10543617 | |||
| 989 | Ga0207681_10112872 | |||
| 990 | Ga0207681_10569897 | |||
| 991 | Ga0207694_10003050 | |||
| 992 | Ga0207694_10250934 | |||
| 993 | Ga0207694_10329811 | |||
| 994 | Ga0207659_10178704 | |||
| 995 | Ga0207659_10353496 | |||
| 996 | Ga0207687_10065573 | |||
| 997 | Ga0207700_10007363 | |||
| 998 | Ga0207700_10149040 | |||
| 999 | Ga0207700_10226268 | |||
| 1000 | Ga0207664_10017819 | |||
| 1001 | Ga0207664_10022185 | |||
| 1002 | Ga0207664_10041681 | |||
| 1003 | Ga0207664_10087387 | |||
| 1004 | Ga0207664_10098204 | |||
| 1005 | Ga0207644_10440978 | |||
| 1006 | Ga0207686_10243783 | |||
| 1007 | Ga0207670_10045879 | |||
| 1008 | Ga0207670_10440586 | |||
| 1009 | Ga0207669_10141054 | |||
| 1010 | Ga0207704_10041590 | |||
| 1011 | Ga0207704_10790752 | |||
| 1012 | Ga0207665_10002091 | |||
| 1013 | Ga0207665_10003981 | |||
| 1014 | Ga0207665_10013611 | |||
| 1015 | Ga0207665_10068140 | |||
| 1016 | Ga0207665_10400621 | |||
| 1017 | Ga0207691_10522573 | |||
| 1018 | Ga0207711_10222726 | |||
| 1019 | Ga0207689_10098751 | |||
| 1020 | Ga0207689_10109127 | |||
| 1021 | Ga0207661_10002023 | |||
| 1022 | Ga0207661_10004058 | |||
| 1023 | Ga0207661_10020192 | |||
| 1024 | Ga0207661_10468496 | |||
| 1025 | Ga0207679_10203843 | |||
| 1026 | Ga0207679_10233881 | |||
| 1027 | Ga0207667_10000189 | |||
| 1028 | Ga0207667_10227252 | |||
| 1029 | Ga0207667_10752440 | |||
| 1030 | Ga0207651_10175895 | |||
| 1031 | Ga0207712_10006797 | |||
| 1032 | Ga0207712_10302519 | |||
| 1033 | Ga0207668_10014976 | |||
| 1034 | Ga0207668_10274140 | |||
| 1035 | Ga0207640_10357569 | |||
| 1036 | Ga0207658_10371741 | |||
| 1037 | Ga0207677_10181755 | |||
| 1038 | Ga0207703_10308968 | |||
| 1039 | Ga0207703_10437952 | |||
| 1040 | Ga0207639_10034086 | |||
| 1041 | Ga0207639_10611736 | |||
| 1042 | Ga0207678_10014664 | |||
| 1043 | Ga0207678_10020691 | |||
| 1044 | Ga0207678_10171262 | |||
| 1045 | Ga0207678_10360778 | |||
| 1046 | Ga0207678_10631369 | |||
| 1047 | Ga0207708_10198832 | |||
| 1048 | Ga0207702_10005340 | |||
| 1049 | Ga0207702_10195037 | |||
| 1050 | Ga0207702_10574611 | |||
| 1051 | Ga0207702_10778791 | |||
| 1052 | Ga0207702_10795209 | |||
| 1053 | Ga0207641_10826989 | |||
| 1054 | Ga0207674_10002199 | |||
| 1055 | Ga0207683_10020024 | |||
| 1056 | Ga0207698_10031535 | |||
| 1057 | Ga0207698_10164285 | |||
| 1058 | Ga0207698_10194760 | |||
| 1059 | Ga0207698_10628881 | |||
| 1060 | Ga0209588_1003085 | |||
| 1061 | Ga0209588_1024824 | |||
| 1062 | Ga0265357_1019884 | |||
| 1063 | Ga0268266_10003076 | |||
| 1064 | Ga0268266_10008543 | |||
| 1065 | Ga0268266_10162504 | |||
| 1066 | Ga0268266_10264226 | |||
| 1067 | Ga0268266_10400053 | |||
| 1068 | Ga0268266_10490737 | |||
| 1069 | Ga0268265_10074377 | |||
| 1070 | Ga0268265_10088390 | |||
| 1071 | Ga0268265_10262012 | |||
| 1072 | Ga0268264_10073403 | |||
| 1073 | Ga0268264_10082100 | |||
| 1074 | Ga0268264_10449518 | |||
| 1075 | Ga0307517_10085022 | |||
| 1076 | Ga0307515_10015965 | |||
| 1077 | Ga0307515_10021245 | |||
| 1078 | Ga0307515_10331628 | |||
| 1079 | Ga0307515_10461842 | |||
| 1080 | Ga0265760_10006241 | |||
| 1081 | Ga0265328_10040324 | |||
| 1082 | Ga0265329_10090348 | |||
| 1083 | Ga0265339_10249068 | |||
| 1084 | Ga0265327_10148261 | |||
| 1085 | Ga0307513_10082240 | |||
| 1086 | Ga0307508_10000092 | |||
| 1087 | Ga0307508_10184115 | |||
| 1088 | Ga0265314_10054074 | |||
| 1089 | Ga0265314_10083949 | |||
| 1090 | Ga0265314_10193097 | |||
| 1091 | Ga0307516_10005831 | |||
| 1092 | Ga0307516_10007969 | |||
| 1093 | Ga0307405_10587727 | |||
| 1094 | Ga0307510_10000928 | |||
| 1095 | Ga0307510_10121708 | |||
| 1096 | Ga0315911_1000004 | |||
| 1097 | Ga0316215_1004848 | |||
| 1098 | Ga0373928_0035435 | |||
| 1099 | Ga0373941_0003984 | |||
| 1100 | Ga0373960_0012581 | |||
| 1101 | Ga0373943_0014535 | |||
| 1102 | Ga0373931_0029887 | |||
| 1103 | Ga0373931_0036583 | |||
| 1104 | Ga0373931_0054458 | |||
| 1105 | Ga0373933_0000368 | |||
| 1106 | Ga0373937_0643420 | |||
| 1107 | Ga0395900_0699102 | |||
| 1108 | Ga0395898_0004778 | |||
| 1109 | Ga0395905_0276015 | |||
| 1110 | Ga0395905_0522355 | |||
| 1111 | Ga0395901_0095741 | |||
| 1112 | Ga0451841_0838279 | |||
| 1113 | Ga0495603_0074508 | |||
| 1114 | Ga0495603_0260169 | |||
| 1115 | Ga0495629_0009850 | |||
| 1116 | Ga0495638_0015651 | |||
| 1117 | Ga0495651_0009663 | |||
| 1118 | Ga0495653_0037199 | |||
| 1119 | Ga0495582_0057579 | |||
| 1120 | Ga0495605_0072302 | |||
| 1121 | Ga0495639_0145000 | |||
| 1122 | Ga0495594_0250081 | |||
| 1123 | Ga0495607_0012823 | |||
| 1124 | Ga0495583_0016331 | |||
| 1125 | Ga0495606_0016019 | |||
| 1126 | Ga0495606_0072187 | |||
| 1127 | Ga0495610_0018624 | |||
| 1128 | Ga0495616_0040996 | |||
| 1129 | Ga0495616_0063771 | |||
| 1130 | Ga0495620_0031566 | |||
| 1131 | Ga0495630_0775502 | |||
| 1132 | Ga0495631_0023544 | |||
| 1133 | Ga0495631_0098814 | |||
| 1134 | Ga0495637_0080919 | |||
| 1135 | Ga0495643_0021980 | |||
| 1136 | Ga0495648_0037355 | |||
| 1137 | Ga0495652_0042805 | |||
| 1138 | Ga0495654_0071502 | |||
| 1139 | Ga0495640_0016110 | |||
| 1140 | Ga0495597_0012735 | |||
| 1141 | Ga0495622_0057336 | |||
| 1142 | Ga0495634_0049088 | |||
| 1143 | Ga0495611_0087772 | |||
| 1144 | Ga0495611_0187899 | |||
| 1145 | Ga0495625_0095223 | |||
| 1146 | Ga0495625_0149245 | |||
| 1147 | Ga0495635_0017508 | |||
| 1148 | Ga0495661_0165416 | |||
| 1149 | Ga0495588_0027038 | |||
| 1150 | Ga0495599_0151357 | |||
| 1151 | Ga0495613_0136017 | |||
| 1152 | Ga0495624_0028773 | |||
| 1153 | Ga0495670_0056003 | |||
| 1154 | Ga0495649_0012674 | |||
| 1155 | Ga0495649_0095415 | |||
| 1156 | Ga0495649_0102820 | |||
| 1157 | Ga0495600_0014585 | |||
| 1158 | Ga0495660_0146100 | |||
| 1159 | Ga0495581_0067758 | |||
| 1160 | Ga0495604_0230793 | |||
| 1161 | Ga0495672_0009162 | |||
| 1162 | Ga0495683_0142113 | |||
| 1163 | Ga0495686_0048626 | |||
| 1164 | Ga0495686_0161070 | |||
| 1165 | Ga0495626_0109445 | |||
| 1166 | Ga0496100_0040667 | |||
| 1167 | Ga0496100_0563045 | |||
| 1168 | Ga0496101_0072007 | |||
| 1169 | Ga0496101_0084425 | |||
| 1170 | Ga0496101_0097592 | |||
| 1171 | Ga0496101_0163519 | |||
| 1172 | Ga0496102_0029798 | |||
| 1173 | Ga0496102_0047174 | |||
| 1174 | Ga0496102_0133853 | |||
| 1175 | Ga0496102_0352961 | |||
| 1176 | Ga0496102_0799110 | |||
| 1177 | Ga0496103_0006498 | |||
| 1178 | Ga0496104_0001158 | |||
| 1179 | Ga0496104_0046332 | |||
| 1180 | Ga0496104_0066296 | |||
| 1181 | Ga0496104_0200923 | |||
| 1182 | Ga0496104_0234527 | |||
| 1183 | Ga0496104_0463999 | |||
| 1184 | Ga0496105_0004710 | |||
| 1185 | Ga0496105_0010156 | |||
| 1186 | Ga0496105_0369947 | |||
| 1187 | Ga0496106_0004768 | |||
| 1188 | Ga0496106_0012539 | |||
| 1189 | Ga0496106_0030183 | |||
| 1190 | Ga0496106_0118375 | |||
| 1191 | Ga0496106_0236570 | |||
| 1192 | Ga0496107_0007996 | |||
| 1193 | Ga0496107_0144357 | |||
| 1194 | Ga0496108_0018643 | |||
| 1195 | Ga0496108_0022012 | |||
| 1196 | Ga0496108_0039966 | |||
| 1197 | Ga0496108_0194826 | |||
| 1198 | Ga0496108_0447111 | |||
| 1199 | Ga0496108_0483659 | |||
| 1200 | Ga0496109_0025798 | |||
| 1201 | Ga0496109_0201432 | |||
| 1202 | Ga0496109_0214572 | |||
| 1203 | Ga0496110_0001582 | |||
| 1204 | Ga0496110_0016255 | |||
| 1205 | Ga0496110_0122978 | |||
| 1206 | Ga0496110_0443465 | |||
| 1207 | Ga0496110_0830749 | |||
| 1208 | Ga0496111_0045339 | |||
| 1209 | Ga0496111_0049174 | |||
| 1210 | Ga0496111_0331112 | |||
| 1211 | Ga0496112_0019557 | |||
| 1212 | Ga0496112_0021694 | |||
| 1213 | Ga0496112_0047365 | |||
| 1214 | Ga0496112_0194851 | |||
| 1215 | Ga0496112_0340566 | |||
| 1216 | Ga0496113_0048068 | |||
| 1217 | Ga0496113_0085278 | |||
| 1218 | Ga0496114_0008737 | |||
| 1219 | Ga0496114_0098077 | |||
| 1220 | Ga0496114_0227961 | |||
| 1221 | Ga0496115_0001085 | |||
| 1222 | Ga0496115_0026896 | |||
| 1223 | Ga0496115_0056643 | |||
| 1224 | Ga0496115_0058036 | |||
| 1225 | Ga0496116_0110018 | |||
| 1226 | Ga0496117_0033068 | |||
| 1227 | Ga0496117_0086306 | |||
| 1228 | Ga0496118_0023315 | |||
| 1229 | Ga0496118_0032338 | |||
| 1230 | Ga0496118_0094593 | |||
| 1231 | Ga0496118_0119118 | |||
| 1232 | Ga0496118_0202614 | |||
| 1233 | Ga0496119_0015262 | |||
| 1234 | Ga0496120_0021987 | |||
| 1235 | Ga0496121_0010402 | |||
| 1236 | Ga0496121_0056437 | |||
| 1237 | Ga0496121_0115235 | |||
| 1238 | Ga0496121_0119316 | |||
| 1239 | Ga0496121_0159257 | |||
| 1240 | Ga0496121_0193365 | |||
| 1241 | Ga0496121_0194740 | |||
| 1242 | Ga0496121_0208485 | |||
| 1243 | Ga0496122_0016595 | |||
| 1244 | Ga0496122_0061849 | |||
| 1245 | Ga0496123_0018256 | |||
| 1246 | Ga0496123_0195197 | |||
| 1247 | Ga0496124_0082765 | |||
| 1248 | Ga0496124_0155564 | |||
| 1249 | Ga0496125_0004577 | |||
| 1250 | Ga0496125_0231446 | |||
| 1251 | Ga0496126_0005628 | |||
| 1252 | Ga0496126_0014342 | |||
| 1253 | Ga0496126_0017332 | |||
| 1254 | Ga0496126_0018592 | |||
| 1255 | Ga0496126_0082162 | |||
| 1256 | Ga0496126_0158135 | |||
| 1257 | Ga0496126_0303184 | |||
| 1258 | Ga0496126_0416739 | |||
| 1259 | Ga0495682_0087406 | |||
| 1260 | nmdc:mga03683_34524_c1 | |||
| 1261 | nmdc:mga03n38_162168_c1 | |||
| 1262 | nmdc:mga03n38_84937_c1 | |||
| 1263 | nmdc:mga0yw44_188790_c1 | |||
| 1264 | nmdc:mga07m45_15715_c1 | |||
| 1265 | nmdc:mga07m45_20179_c1 | |||
| 1266 | nmdc:mga07m45_5454_c1 | |||
| 1267 | nmdc:mga08y16_537669_c1 | |||
| 1268 | nmdc:mga0sz30_30689_c1 | |||
| 1269 | nmdc:mga0sz30_90977_c1 | |||
| 1270 | nmdc:mga0sz30_9146_c1 | |||
| 1271 | nmdc:mga0sz30_9893_c1 | |||
| 1272 | Ga0495601_0208680 | |||
| 1273 | Ga0495619_0356293 | |||
| 1274 | Ga0500578_0028541 | |||
| 1275 | Ga0500578_0052937 | |||
| 1276 | Ga0500578_0130955 | |||
| 1277 | Ga0500581_054088 | |||
| 1278 | Ga0500646_0029026 | |||
| 1279 | Ga0500651_0098038 | |||
| 1280 | Ga0500566_0005483 | |||
| 1281 | Ga0500566_0034093 | |||
| 1282 | Ga0500566_0154478 | |||
| 1283 | Ga0500641_0020683 | |||
| 1284 | Ga0500555_045250 | |||
| 1285 | Ga0500556_0000003 | |||
| 1286 | Ga0500569_001531 | |||
| 1287 | Ga0500569_059864 | |||
| 1288 | Ga0500592_000496 | |||
| 1289 | Ga0500594_0008522 | |||
| 1290 | Ga0500594_0020703 | |||
| 1291 | Ga0500595_000262 | |||
| 1292 | Ga0500607_145957 | |||
| 1293 | Ga0500617_077151 | |||
| 1294 | Ga0500642_0000104 | |||
| 1295 | Ga0500652_000844 | |||
| 1296 | Ga0500559_0079353 | |||
| 1297 | Ga0500568_0005974 | |||
| 1298 | Ga0500577_0015937 | |||
| 1299 | Ga0500577_0055256 | |||
| 1300 | Ga0500588_0017406 | |||
| 1301 | Ga0500603_016779 | |||
| 1302 | Ga0500616_0001128 | |||
| 1303 | Ga0500622_0000957 | |||
| 1304 | Ga0500634_0045559 | |||
| 1305 | Ga0500637_0040605 | |||
| 1306 | Ga0500570_083623 | |||
| 1307 | Ga0500601_000034 | |||
| 1308 | 2513651867 | |||
| 1309 | 2513863069 | |||
| 1310 | 2517895840 | |||
| 1311 | 2528853700 | |||
| 1312 | 2528856400 | |||
| 1313 | 2818242031 | |||
| 1314 | 2842044766 | |||
| 1315 | 2842053047 | |||
| 1316 | 2849077543 | |||
| 1317 | 2857525373 | |||
| 1318 | 2888386219 | |||
| 1319 | 2888392063 | |||
| 1320 | 2889034979 | |||
| 1321 | 2889036231 | |||
| 1322 | 2889038540 | |||
| 1323 | 2889039215 | |||
| 1324 | 2904700828 | |||
| 1325 | 2904710114 | |||
| 1326 | 2919074936 | |||
| 1327 | 2922428706 | |||
| 1328 | 2929623056 | |||
| 1329 | 2929630641 | |||
| 1330 | 2933584962 | |||
| 1331 | 3005507740 | |||
| 1332 | 8006935611 | |||
| 1333 | 8006975540 | |||
| 1334 | 8006993065 | |||
| 1335 | 8055748795 | |||
| 1336 | 8056969180 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ku8-assembly2.cif.gz_B | structures of pkgi reveal a cgmp-selective activation mechanism | 0.8893 | 22 | 105 |
| 5j48-assembly2.cif.gz_B | pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp | 0.8852 | 20 | 111 |
| 4ku8-assembly3.cif.gz_C | structures of pkgi reveal a cgmp-selective activation mechanism | 0.8761 | 22 | 111 |
| 7ssb-assembly1.cif.gz_A | co-structure of pkg1 regulatory domain with compound 33 | 0.8664 | 22 | 111 |
| 4ku7-assembly1.cif.gz_A | structures of pkgi reveal a cgmp-selective activation mechanism | 0.8601 | 22 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5EDB9_5_131_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9263 | 21 | 101 | 2.60.120.10 |
| 5j3uA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9234 | 21 | 107 | 2.60.120.10 |
| 2xkpF01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.921 | 22 | 126 | 2.60.120.10 |
| 5kbfB01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9201 | 21 | 106 | 2.60.120.10 |
| af_A0A2R8Q8F0_19_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9115 | 20 | 101 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q1ZUQ0-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9325 | 20 | 126 |
|
| AF-A0A3D5Q3P1-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.9318 | 20 | 107 |
GO:0003700
GO:0005829 |
| AF-A0A1Q7EDL1-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9277 | 23 | 101 |
GO:0005829
|
| AF-A0A353EHB4-F1-model_v4 | Cyclic nucleotide-binding protein | 0.926 | 20 | 105 |
|
| AF-T0ZZD3-F1-model_v4 | Transcriptional regulator, Crp/Fnr family | 0.9208 | 23 | 96 |
GO:0003700
GO:0005829 |