F473924

General Info

Members Datasets Scaffolds Average Seq Length
668 318 1336 227

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1008466|Ga0209758_10084664
Length 228
Sequence VSKVEQDPFDPDAFLAKAGAGRSIQKYHKNEKIYCQGEAADSVFYIQEGRVKLLVISGQGKEAIVGILQAGQFFGESCLGEHSRRMATTVAMEDSLITAIRKNEMLTVLRDQPKFSELFMAYLLNRNCRIEADLIDHLFNSSEKRLARLLVLLANFSKEDAGPQSIHLQISQESLAEMIGTTRSRVSYFMNRFRRMGFISYNGHIEVHSALRHAVLNEKLEFGDDPDE

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
175 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
272 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
277 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
281 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
287 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
288 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
294 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
295 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
296 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
297 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
298 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
299 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
300 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
301 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
302 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
303 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
304 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
305 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
306 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
307 2904699407
308 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
309 2922425934
310 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
311 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
312 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
313 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
314 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
315 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
316 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
317 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
318 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 0.6
Isolates 3.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 2.4
Rhizoplane 8.83
Rhizosphere 67.07
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1008466 3300025297 Bacteria 6650
2 JGI25153J46596_10000452 3300003215 Bacteria 26287
3 JGI25153J46596_10027854 3300003215 Bacteria 1971
4 JGI25160J50197_1000515 3300003354 Bacteria 22805
5 JGI25160J50197_1001954 3300003354 Bacteria 9837
6 Ga0055542_1013519 3300003762 Bacteria 1371
7 Ga0055531_10018768 3300003794 Bacteria 2837
8 Ga0065165_1012658 3300005262 Bacteria 3417
9 Ga0065165_1013906 3300005262 Bacteria 3160
10 Ga0065715_10119545 3300005293 Bacteria 2284
11 Ga0070658_10010161 3300005327 Bacteria 7554
12 Ga0070658_10177086 3300005327 Bacteria 1794
13 Ga0070676_10203680 3300005328 Bacteria 1298
14 Ga0070683_100102899 3300005329 Bacteria 2690
15 Ga0070683_100191575 3300005329 Bacteria 1941
16 Ga0070690_100181501 3300005330 Bacteria 1455
17 Ga0068869_100004469 3300005334 Bacteria 8695
18 Ga0068869_100026542 3300005334 Bacteria 4033
19 Ga0068869_100079060 3300005334 Bacteria 2450
20 Ga0070666_10319391 3300005335 Bacteria 1108
21 Ga0070680_100000783 3300005336 Bacteria 22328
22 Ga0070680_100023282 3300005336 Bacteria 4939
23 Ga0070680_100051070 3300005336 Bacteria 3374
24 Ga0070680_100911750 3300005336 Bacteria 758
25 Ga0070689_100291977 3300005340 Bacteria 1355
26 Ga0070689_100588434 3300005340 Bacteria 963
27 Ga0070691_10001231 3300005341 Bacteria 10780
28 Ga0070691_10042603 3300005341 Bacteria 2148
29 Ga0070668_100027966 3300005347 Bacteria 4279
30 Ga0070668_100131209 3300005347 Bacteria 2011
31 Ga0070668_100159754 3300005347 Bacteria 1828
32 Ga0070675_100179268 3300005354 Bacteria 1831
33 Ga0070667_100454045 3300005367 Bacteria 1171
34 Ga0070667_100477098 3300005367 Bacteria 1142
35 Ga0070709_10006867 3300005434 Bacteria 6218
36 Ga0070709_10014217 3300005434 Bacteria 4498
37 Ga0070709_10032965 3300005434 Bacteria 3128
38 Ga0070709_10411396 3300005434 Bacteria 1012
39 Ga0070714_100011614 3300005435 Bacteria 6991
40 Ga0070714_100017763 3300005435 Bacteria 5767
41 Ga0070714_100017836 3300005435 Bacteria 5756
42 Ga0070714_100676335 3300005435 Bacteria 995
43 Ga0070714_100832508 3300005435 Bacteria 894
44 Ga0070713_100011720 3300005436 Bacteria 6399
45 Ga0070713_100021325 3300005436 Bacteria 4980
46 Ga0070713_100073114 3300005436 Bacteria 2901
47 Ga0070713_100188447 3300005436 Bacteria 1857
48 Ga0070713_100598715 3300005436 Unclassified 1047
49 Ga0070710_10000766 3300005437 Bacteria 15325
50 Ga0070710_10001656 3300005437 Bacteria 10502
51 Ga0070710_10013077 3300005437 Bacteria 4143
52 Ga0070711_100010851 3300005439 Bacteria 5648
53 Ga0070711_100017723 3300005439 Bacteria 4537
54 Ga0070711_100072296 3300005439 Bacteria 2433
55 Ga0070711_100128221 3300005439 Bacteria 1886
56 Ga0070705_100161051 3300005440 Bacteria 1500
57 Ga0070663_100008631 3300005455 Bacteria 6281
58 Ga0070663_100026165 3300005455 Bacteria 3948
59 Ga0070663_100077143 3300005455 Bacteria 2438
60 Ga0070663_100088740 3300005455 Bacteria 2287
61 Ga0070678_100003618 3300005456 Bacteria 8618
62 Ga0070678_100010779 3300005456 Bacteria 5602
63 Ga0070678_100014830 3300005456 Bacteria 4931
64 Ga0070662_100248312 3300005457 Bacteria 1429
65 Ga0070681_10000423 3300005458 Bacteria 34363
66 Ga0070681_10165586 3300005458 Bacteria 2133
67 Ga0070681_10237034 3300005458 Bacteria 1738
68 Ga0070681_10451490 3300005458 Bacteria 1197
69 Ga0070681_10721296 3300005458 Bacteria 913
70 Ga0070685_10224415 3300005466 Bacteria 1232
71 Ga0070685_10426439 3300005466 Bacteria 924
72 Ga0070698_100380830 3300005471 Bacteria 1343
73 Ga0070679_100002998 3300005530 Bacteria 15416
74 Ga0070679_100024886 3300005530 Bacteria 5868
75 Ga0070679_100118122 3300005530 Bacteria 2637
76 Ga0070679_100549454 3300005530 Bacteria 1099
77 Ga0070679_100793588 3300005530 Bacteria 890
78 Ga0070684_100001413 3300005535 Bacteria 17268
79 Ga0070684_100020867 3300005535 Bacteria 5438
80 Ga0070684_100406599 3300005535 Bacteria 1255
81 Ga0068853_100019122 3300005539 Bacteria 5676
82 Ga0068853_100391867 3300005539 Bacteria 1299
83 Ga0070693_100121212 3300005547 Bacteria 1622
84 Ga0070665_100021319 3300005548 Bacteria 6517
85 Ga0070665_100041276 3300005548 Bacteria 4637
86 Ga0070665_100076213 3300005548 Bacteria 3361
87 Ga0070665_100432740 3300005548 Bacteria 1325
88 Ga0070665_100467218 3300005548 Bacteria 1272
89 Ga0070704_100423157 3300005549 Bacteria 1141
90 Ga0068855_100108438 3300005563 Bacteria 3189
91 Ga0068855_100364226 3300005563 Bacteria 1590
92 Ga0068855_100638543 3300005563 Bacteria 1145
93 Ga0070664_100135099 3300005564 Bacteria 2168
94 Ga0068857_100000816 3300005577 Bacteria 23335
95 Ga0068854_100035345 3300005578 Bacteria 3496
96 Ga0068854_100261038 3300005578 Bacteria 1387
97 Ga0068856_100002260 3300005614 Bacteria 19893
98 Ga0068856_100552978 3300005614 Bacteria 1172
99 Ga0068856_100655933 3300005614 Bacteria 1070
100 Ga0070702_100088559 3300005615 Bacteria 1872
101 Ga0068852_100002224 3300005616 Bacteria 13308
102 Ga0068852_100045122 3300005616 Bacteria 3747
103 Ga0068852_100155942 3300005616 Bacteria 2127
104 Ga0068852_100180315 3300005616 Bacteria 1986
105 Ga0068859_100195551 3300005617 Bacteria 2107
106 Ga0068864_100155739 3300005618 Bacteria 2074
107 Ga0068861_100416889 3300005719 Bacteria 1195
108 Ga0068863_100187035 3300005841 Bacteria 1989
109 Ga0068858_100197881 3300005842 Bacteria 1900
110 Ga0068858_100357396 3300005842 Bacteria 1400
111 Ga0068858_100425985 3300005842 Bacteria 1276
112 Ga0068860_100086358 3300005843 Bacteria 2985
113 Ga0068860_100120647 3300005843 Bacteria 2510
114 Ga0068860_100247930 3300005843 Bacteria 1733
115 Ga0068862_100018780 3300005844 Bacteria 5761
116 Ga0068862_100132490 3300005844 Bacteria 2206
117 Ga0068862_100177254 3300005844 Bacteria 1911
118 Ga0068862_100201329 3300005844 Bacteria 1795
119 Ga0068862_100249723 3300005844 Bacteria 1616
120 Ga0068862_100425490 3300005844 Bacteria 1247
121 Ga0070717_10001543 3300006028 Bacteria 15977
122 Ga0070717_10009643 3300006028 Bacteria 7268
123 Ga0070717_10072969 3300006028 Bacteria 2867
124 Ga0070717_10159722 3300006028 Bacteria 1955
125 Ga0070717_10458278 3300006028 Bacteria 1150
126 Ga0075365_10013000 3300006038 Bacteria 4964
127 Ga0075365_10067432 3300006038 Bacteria 2402
128 Ga0075365_10147896 3300006038 Bacteria 1633
129 Ga0075368_10002348 3300006042 Bacteria 6149
130 Ga0075363_100188431 3300006048 Bacteria 1176
131 Ga0075363_100211248 3300006048 Bacteria 1111
132 Ga0070716_100010823 3300006173 Bacteria 4586
133 Ga0070716_100090997 3300006173 Bacteria 1847
134 Ga0070712_100000135 3300006175 Bacteria 38798
135 Ga0070712_100004486 3300006175 Bacteria 8618
136 Ga0070712_100010979 3300006175 Bacteria 5731
137 Ga0070712_100034722 3300006175 Bacteria 3419
138 Ga0070712_100056064 3300006175 Bacteria 2762
139 Ga0075367_10013947 3300006178 Bacteria 4338
140 Ga0075367_10082754 3300006178 Bacteria 1943
141 Ga0075366_10003590 3300006195 Bacteria 8214
142 Ga0075366_10047238 3300006195 Bacteria 2551
143 Ga0097621_100754962 3300006237 Bacteria 899
144 Ga0075370_10008154 3300006353 Bacteria 5375
145 Ga0075370_10020357 3300006353 Bacteria 3625
146 Ga0075370_10063401 3300006353 Bacteria 2107
147 Ga0068871_100230689 3300006358 Bacteria 1607
148 Ga0068865_100061443 3300006881 Bacteria 2634
149 Ga0075436_100279286 3300006914 Bacteria 1194
150 Ga0097620_100195540 3300006931 Bacteria 2107
151 Ga0099794_10012081 3300007265 Bacteria 3714
152 Ga0099794_10021821 3300007265 Bacteria 2913
153 Ga0099795_10003403 3300007788 Bacteria 3931
154 Ga0099795_10021273 3300007788 Bacteria 2125
155 Ga0099795_10036412 3300007788 Bacteria 1726
156 Ga0105240_10003489 3300009093 Bacteria 24383
157 Ga0105240_10046509 3300009093 Bacteria 5498
158 Ga0105240_10047603 3300009093 Bacteria 5425
159 Ga0105245_10114400 3300009098 Bacteria 2513
160 Ga0105245_10950334 3300009098 Bacteria 902
161 Ga0105247_10023607 3300009101 Bacteria 3705
162 Ga0105247_10029449 3300009101 Bacteria 3327
163 Ga0105247_10081057 3300009101 Bacteria 2045
164 Ga0105247_10095491 3300009101 Bacteria 1893
165 Ga0105247_10170717 3300009101 Bacteria 1446
166 Ga0105247_10315757 3300009101 Bacteria 1089
167 Ga0105247_10357572 3300009101 Bacteria 1029
168 Ga0105243_10279247 3300009148 Bacteria 1504
169 Ga0105241_10001328 3300009174 Bacteria 18791
170 Ga0105241_10034971 3300009174 Bacteria 3778
171 Ga0105241_10057004 3300009174 Bacteria 2996
172 Ga0105241_10157924 3300009174 Bacteria 1861
173 Ga0105241_10180533 3300009174 Bacteria 1751
174 Ga0105241_10241371 3300009174 Bacteria 1527
175 Ga0105241_10736958 3300009174 Bacteria 902
176 Ga0105242_10473240 3300009176 Bacteria 1186
177 Ga0105248_10026820 3300009177 Bacteria 6409
178 Ga0105248_10028048 3300009177 Bacteria 6271
179 Ga0105248_10283762 3300009177 Bacteria 1864
180 Ga0105248_10467738 3300009177 Bacteria 1421
181 Ga0105248_11013463 3300009177 Bacteria 938
182 Ga0105237_10000828 3300009545 Bacteria 42351
183 Ga0105237_10006546 3300009545 Bacteria 12887
184 Ga0105237_10007030 3300009545 Bacteria 12390
185 Ga0105237_10040195 3300009545 Bacteria 4718
186 Ga0105237_10041311 3300009545 Bacteria 4651
187 Ga0105237_10065124 3300009545 Bacteria 3641
188 Ga0105237_10171246 3300009545 Bacteria 2171
189 Ga0105237_10200196 3300009545 Bacteria 1997
190 Ga0105237_10593333 3300009545 Bacteria 1115
191 Ga0105238_10001254 3300009551 Bacteria 25546
192 Ga0105238_10089676 3300009551 Bacteria 3062
193 Ga0105238_10253521 3300009551 Bacteria 1738
194 Ga0105249_10115333 3300009553 Bacteria 2545
195 Ga0105249_10283363 3300009553 Bacteria 1656
196 Ga0105249_10319740 3300009553 Bacteria 1563
197 Ga0105249_11138467 3300009553 Bacteria 851
198 Ga0099796_10004221 3300010159 Bacteria 3449
199 Ga0099796_10017587 3300010159 Bacteria 2132
200 Ga0105239_10017195 3300010375 Bacteria 7994
201 Ga0105239_10086875 3300010375 Bacteria 3447
202 Ga0105239_10200184 3300010375 Bacteria 2237
203 Ga0105239_10696539 3300010375 Bacteria 1161
204 Ga0105239_11309090 3300010375 Bacteria 836
205 Ga0105246_10014068 3300011119 Bacteria 5026
206 Ga0105246_10079417 3300011119 Bacteria 2333
207 Ga0105246_10343329 3300011119 Bacteria 1221
208 Ga0157371_10241450 3300013102 Bacteria 1300
209 Ga0157370_10066257 3300013104 Bacteria 3416
210 Ga0157370_10232676 3300013104 Bacteria 1705
211 Ga0157370_10566037 3300013104 Bacteria 1041
212 Ga0157369_10006368 3300013105 Bacteria 13695
213 Ga0157369_10090752 3300013105 Bacteria 3262
214 Ga0157369_10216536 3300013105 Bacteria 2006
215 Ga0157369_10294794 3300013105 Bacteria 1688
216 Ga0157374_10018094 3300013296 Bacteria 6214
217 Ga0157374_10027874 3300013296 Bacteria 5099
218 Ga0157378_10045902 3300013297 Bacteria 3884
219 Ga0157378_10260158 3300013297 Bacteria 1665
220 Ga0157378_10289553 3300013297 Bacteria 1581
221 Ga0157378_10531754 3300013297 Bacteria 1178
222 Ga0163162_10017351 3300013306 Bacteria 7042
223 Ga0163162_10067194 3300013306 Bacteria 3635
224 Ga0163162_10089841 3300013306 Bacteria 3153
225 Ga0163162_10251998 3300013306 Bacteria 1897
226 Ga0163162_10392724 3300013306 Bacteria 1520
227 Ga0157372_10018217 3300013307 Bacteria 7548
228 Ga0157372_10294146 3300013307 Bacteria 1888
229 Ga0157375_10023067 3300013308 Bacteria 5737
230 Ga0157375_10637031 3300013308 Bacteria 1223
231 Ga0163163_10195748 3300014325 Bacteria 2069
232 Ga0163163_10417686 3300014325 Bacteria 1400
233 Ga0157379_10011193 3300014968 Bacteria 7819
234 Ga0157379_10097706 3300014968 Bacteria 2637
235 Ga0157379_10109168 3300014968 Bacteria 2484
236 Ga0157379_10166270 3300014968 Bacteria 1991
237 Ga0157376_10382936 3300014969 Bacteria 1355
238 Ga0157376_10490532 3300014969 Bacteria 1205
239 Ga0157376_10778438 3300014969 Bacteria 968
240 Ga0163161_10379313 3300017792 Bacteria 1130
241 Ga0163161_10531119 3300017792 Bacteria 962
242 Ga0206354_11564108 3300020081 Bacteria 791
243 Ga0224712_10076917 3300022467 Bacteria 1368
244 Ga0224712_10134267 3300022467 Bacteria 1083
245 Ga0209563_113633 3300025230 Bacteria 1066
246 Ga0209677_103687 3300025253 Bacteria 4814
247 Ga0209148_1000305 3300025254 Bacteria 70375
248 Ga0209233_1016177 3300025261 Bacteria 2060
249 Ga0209455_1005953 3300025272 Bacteria 3675
250 Ga0209564_1002350 3300025295 Bacteria 15267
251 Ga0209564_1009385 3300025295 Bacteria 4667
252 Ga0209758_1000703 3300025297 Bacteria 49647
253 Ga0209256_1017086 3300025299 Bacteria 2430
254 Ga0207426_1000401 3300025302 Bacteria 73412
255 Ga0207426_1004331 3300025302 Bacteria 6992
256 Ga0207426_1023015 3300025302 Bacteria 2131
257 Ga0207426_1032714 3300025302 Bacteria 1684
258 Ga0209257_1008475 3300025304 Bacteria 5831
259 Ga0209257_1010366 3300025304 Bacteria 4734
260 Ga0209257_1021817 3300025304 Bacteria 2309
261 Ga0207653_10041573 3300025885 Bacteria 1510
262 Ga0207682_10158246 3300025893 Bacteria 1025
263 Ga0207692_10001730 3300025898 Bacteria 8265
264 Ga0207692_10003668 3300025898 Bacteria 6017
265 Ga0207692_10014527 3300025898 Bacteria 3443
266 Ga0207692_10016497 3300025898 Bacteria 3273
267 Ga0207642_10100012 3300025899 Bacteria 1453
268 Ga0207710_10078032 3300025900 Bacteria 1531
269 Ga0207710_10090591 3300025900 Bacteria 1430
270 Ga0207710_10139238 3300025900 Bacteria 1170
271 Ga0207710_10207532 3300025900 Bacteria 969
272 Ga0207710_10311643 3300025900 Bacteria 796
273 Ga0207680_10075828 3300025903 Bacteria 2098
274 Ga0207680_10210740 3300025903 Bacteria 1328
275 Ga0207685_10116894 3300025905 Bacteria 1165
276 Ga0207699_10010052 3300025906 Bacteria 4732
277 Ga0207699_10120536 3300025906 Bacteria 1696
278 Ga0207699_10320993 3300025906 Bacteria 1086
279 Ga0207699_10403993 3300025906 Bacteria 973
280 Ga0207645_10116839 3300025907 Bacteria 1730
281 Ga0207705_10027508 3300025909 Bacteria 4056
282 Ga0207705_10183723 3300025909 Bacteria 1579
283 Ga0207705_10672386 3300025909 Bacteria 805
284 Ga0207684_10158920 3300025910 Bacteria 1945
285 Ga0207654_10019545 3300025911 Bacteria 3577
286 Ga0207654_10033814 3300025911 Bacteria 2837
287 Ga0207654_10072360 3300025911 Bacteria 2052
288 Ga0207707_10000636 3300025912 Bacteria 34756
289 Ga0207707_10014817 3300025912 Bacteria 6791
290 Ga0207707_10024340 3300025912 Bacteria 5299
291 Ga0207707_10116656 3300025912 Bacteria 2333
292 Ga0207707_10296647 3300025912 Bacteria 1398
293 Ga0207695_10000136 3300025913 Bacteria 217596
294 Ga0207695_10002533 3300025913 Bacteria 26840
295 Ga0207695_10194413 3300025913 Bacteria 1945
296 Ga0207671_10003434 3300025914 Bacteria 15816
297 Ga0207671_10013294 3300025914 Bacteria 6565
298 Ga0207671_10040312 3300025914 Bacteria 3457
299 Ga0207671_10060263 3300025914 Bacteria 2815
300 Ga0207671_10113184 3300025914 Bacteria 2067
301 Ga0207671_10115192 3300025914 Bacteria 2049
302 Ga0207671_10120924 3300025914 Bacteria 2001
303 Ga0207671_10395070 3300025914 Bacteria 1099
304 Ga0207671_10405201 3300025914 Bacteria 1085
305 Ga0207693_10000025 3300025915 Bacteria 124008
306 Ga0207693_10005265 3300025915 Bacteria 10819
307 Ga0207693_10021549 3300025915 Bacteria 5120
308 Ga0207693_10463742 3300025915 Bacteria 990
309 Ga0207693_10464960 3300025915 Bacteria 988
310 Ga0207663_10000148 3300025916 Bacteria 32396
311 Ga0207663_10007509 3300025916 Bacteria 5657
312 Ga0207663_10057898 3300025916 Bacteria 2443
313 Ga0207663_10172353 3300025916 Bacteria 1538
314 Ga0207663_10257596 3300025916 Bacteria 1287
315 Ga0207660_10032278 3300025917 Bacteria 3613
316 Ga0207660_10044674 3300025917 Bacteria 3117
317 Ga0207652_10001333 3300025921 Bacteria 21932
318 Ga0207652_10054433 3300025921 Bacteria 3440
319 Ga0207652_10087250 3300025921 Bacteria 2736
320 Ga0207652_10543617 3300025921 Bacteria 1044
321 Ga0207681_10112872 3300025923 Bacteria 1980
322 Ga0207681_10569897 3300025923 Bacteria 933
323 Ga0207694_10003050 3300025924 Bacteria 13429
324 Ga0207694_10250934 3300025924 Bacteria 1448
325 Ga0207694_10329811 3300025924 Bacteria 1261
326 Ga0207659_10178704 3300025926 Bacteria 1679
327 Ga0207659_10353496 3300025926 Bacteria 1220
328 Ga0207687_10065573 3300025927 Bacteria 2579
329 Ga0207700_10007363 3300025928 Bacteria 6722
330 Ga0207700_10149040 3300025928 Bacteria 1931
331 Ga0207700_10226268 3300025928 Bacteria 1588
332 Ga0207664_10017819 3300025929 Bacteria 5217
333 Ga0207664_10022185 3300025929 Bacteria 4737
334 Ga0207664_10041681 3300025929 Bacteria 3578
335 Ga0207664_10087387 3300025929 Bacteria 2549
336 Ga0207664_10098204 3300025929 Bacteria 2414
337 Ga0207644_10440978 3300025931 Bacteria 1069
338 Ga0207686_10243783 3300025934 Bacteria 1309
339 Ga0207670_10045879 3300025936 Bacteria 2900
340 Ga0207670_10440586 3300025936 Bacteria 1049
341 Ga0207669_10141054 3300025937 Bacteria 1673
342 Ga0207704_10041590 3300025938 Bacteria 2697
343 Ga0207704_10790752 3300025938 Bacteria 792
344 Ga0207665_10002091 3300025939 Bacteria 13489
345 Ga0207665_10003981 3300025939 Bacteria 9871
346 Ga0207665_10013611 3300025939 Bacteria 5352
347 Ga0207665_10068140 3300025939 Bacteria 2424
348 Ga0207665_10400621 3300025939 Bacteria 1045
349 Ga0207691_10522573 3300025940 Bacteria 1007
350 Ga0207711_10222726 3300025941 Bacteria 1726
351 Ga0207689_10098751 3300025942 Bacteria 2399
352 Ga0207689_10109127 3300025942 Bacteria 2274
353 Ga0207661_10002023 3300025944 Bacteria 13980
354 Ga0207661_10004058 3300025944 Bacteria 10225
355 Ga0207661_10020192 3300025944 Bacteria 4974
356 Ga0207661_10468496 3300025944 Bacteria 1149
357 Ga0207679_10203843 3300025945 Bacteria 1654
358 Ga0207679_10233881 3300025945 Bacteria 1553
359 Ga0207667_10000189 3300025949 Bacteria 90535
360 Ga0207667_10227252 3300025949 Bacteria 1911
361 Ga0207667_10752440 3300025949 Bacteria 974
362 Ga0207651_10175895 3300025960 Bacteria 1693
363 Ga0207712_10006797 3300025961 Bacteria 7215
364 Ga0207712_10302519 3300025961 Bacteria 1313
365 Ga0207668_10014976 3300025972 Bacteria 4810
366 Ga0207668_10274140 3300025972 Bacteria 1380
367 Ga0207640_10357569 3300025981 Bacteria 1175
368 Ga0207658_10371741 3300025986 Bacteria 1250
369 Ga0207677_10181755 3300026023 Bacteria 1655
370 Ga0207703_10308968 3300026035 Bacteria 1445
371 Ga0207703_10437952 3300026035 Bacteria 1219
372 Ga0207639_10034086 3300026041 Bacteria 3760
373 Ga0207639_10611736 3300026041 Bacteria 1005
374 Ga0207678_10014664 3300026067 Bacteria 6897
375 Ga0207678_10020691 3300026067 Bacteria 5768
376 Ga0207678_10171262 3300026067 Bacteria 1854
377 Ga0207678_10360778 3300026067 Bacteria 1254
378 Ga0207678_10631369 3300026067 Bacteria 940
379 Ga0207708_10198832 3300026075 Bacteria 1598
380 Ga0207702_10005340 3300026078 Bacteria 11266
381 Ga0207702_10195037 3300026078 Bacteria 1874
382 Ga0207702_10574611 3300026078 Bacteria 1104
383 Ga0207702_10778791 3300026078 Bacteria 945
384 Ga0207702_10795209 3300026078 Unclassified 935
385 Ga0207641_10826989 3300026088 Bacteria 917
386 Ga0207674_10002199 3300026116 Bacteria 24686
387 Ga0207683_10020024 3300026121 Bacteria 5717
388 Ga0207698_10031535 3300026142 Bacteria 3827
389 Ga0207698_10164285 3300026142 Bacteria 1946
390 Ga0207698_10194760 3300026142 Bacteria 1809
391 Ga0207698_10628881 3300026142 Bacteria 1061
392 Ga0209588_1003085 3300027671 Bacteria 4594
393 Ga0209588_1024824 3300027671 Bacteria 1894
394 Ga0265357_1019884 3300028023 Bacteria 731
395 Ga0268266_10003076 3300028379 Bacteria 17052
396 Ga0268266_10008543 3300028379 Bacteria 9101
397 Ga0268266_10162504 3300028379 Bacteria 2021
398 Ga0268266_10264226 3300028379 Bacteria 1596
399 Ga0268266_10400053 3300028379 Bacteria 1298
400 Ga0268266_10490737 3300028379 Bacteria 1172
401 Ga0268265_10074377 3300028380 Bacteria 2657
402 Ga0268265_10088390 3300028380 Bacteria 2468
403 Ga0268265_10262012 3300028380 Bacteria 1537
404 Ga0268264_10073403 3300028381 Bacteria 2903
405 Ga0268264_10082100 3300028381 Bacteria 2757
406 Ga0268264_10449518 3300028381 Bacteria 1248
407 Ga0307517_10085022 3300028786 Bacteria 2655
408 Ga0307515_10015965 3300028794 Bacteria 13790
409 Ga0307515_10021245 3300028794 Bacteria 11519
410 Ga0307515_10331628 3300028794 Bacteria 1180
411 Ga0307515_10461842 3300028794 Bacteria 884
412 Ga0265760_10006241 3300031090 Bacteria 3411
413 Ga0265328_10040324 3300031239 Bacteria 1721
414 Ga0265329_10090348 3300031242 Bacteria 972
415 Ga0265339_10249068 3300031249 Bacteria 860
416 Ga0265327_10148261 3300031251 Bacteria 1091
417 Ga0307513_10082240 3300031456 Bacteria 3316
418 Ga0307508_10000092 3300031616 Bacteria 105585
419 Ga0307508_10184115 3300031616 Bacteria 1691
420 Ga0265314_10054074 3300031711 Bacteria 2780
421 Ga0265314_10083949 3300031711 Bacteria 2092
422 Ga0265314_10193097 3300031711 Bacteria 1210
423 Ga0307516_10005831 3300031730 Bacteria 14589
424 Ga0307516_10007969 3300031730 Bacteria 12058
425 Ga0307405_10587727 3300031731 Bacteria 907
426 Ga0307510_10000928 3300033180 Bacteria 31078
427 Ga0307510_10121708 3300033180 Bacteria 2312
428 Ga0315911_1000004 3300033442 Bacteria 472637
429 Ga0316215_1004848 3300033544 Bacteria 1292
430 Ga0373928_0035435 3300035084 Bacteria 1124
431 Ga0373941_0003984 3300035115 Bacteria 3384
432 Ga0373960_0012581 3300035121 Bacteria 2105
433 Ga0373943_0014535 3300035170 Bacteria 3567
434 Ga0373931_0029887 3300035691 Bacteria 2801
435 Ga0373931_0036583 3300035691 Bacteria 2560
436 Ga0373931_0054458 3300035691 Bacteria 2138
437 Ga0373933_0000368 3300035724 Bacteria 28785
438 Ga0373937_0643420 3300036401 Bacteria 1006
439 Ga0395900_0699102 3300037418 Bacteria 948
440 Ga0395898_0004778 3300037466 Bacteria 14739
441 Ga0395905_0276015 3300037471 Bacteria 1566
442 Ga0395905_0522355 3300037471 Bacteria 1088
443 Ga0395901_0095741 3300038443 Bacteria 3111
444 Ga0451841_0838279 3300041498 Bacteria 1626
445 Ga0495603_0074508 3300046455 Bacteria 1993
446 Ga0495603_0260169 3300046455 Bacteria 999
447 Ga0495629_0009850 3300046459 Bacteria 6974
448 Ga0495638_0015651 3300046460 Bacteria 5089
449 Ga0495651_0009663 3300046462 Bacteria 7417
450 Ga0495653_0037199 3300046463 Bacteria 3827
451 Ga0495582_0057579 3300046473 Bacteria 2143
452 Ga0495605_0072302 3300046474 Bacteria 1627
453 Ga0495639_0145000 3300046475 Bacteria 1143
454 Ga0495594_0250081 3300046499 Bacteria 1010
455 Ga0495607_0012823 3300046501 Bacteria 5513
456 Ga0495583_0016331 3300046506 Bacteria 3997
457 Ga0495606_0016019 3300046507 Bacteria 5741
458 Ga0495606_0072187 3300046507 Bacteria 2170
459 Ga0495610_0018624 3300046512 Bacteria 3914
460 Ga0495616_0040996 3300046513 Bacteria 2364
461 Ga0495616_0063771 3300046513 Bacteria 1800
462 Ga0495620_0031566 3300046515 Bacteria 2426
463 Ga0495630_0775502 3300046517 Bacteria 732
464 Ga0495631_0023544 3300046518 Bacteria 2854
465 Ga0495631_0098814 3300046518 Bacteria 1256
466 Ga0495637_0080919 3300046520 Bacteria 1295
467 Ga0495643_0021980 3300046522 Bacteria 3648
468 Ga0495648_0037355 3300046524 Bacteria 3122
469 Ga0495652_0042805 3300046529 Bacteria 3904
470 Ga0495654_0071502 3300046530 Bacteria 1644
471 Ga0495640_0016110 3300046533 Bacteria 5598
472 Ga0495597_0012735 3300046542 Bacteria 4050
473 Ga0495622_0057336 3300046557 Bacteria 1805
474 Ga0495634_0049088 3300046642 Bacteria 2839
475 Ga0495611_0087772 3300046648 Bacteria 1435
476 Ga0495611_0187899 3300046648 Bacteria 965
477 Ga0495625_0095223 3300046660 Bacteria 2053
478 Ga0495625_0149245 3300046660 Bacteria 1572
479 Ga0495635_0017508 3300046663 Bacteria 5003
480 Ga0495661_0165416 3300046665 Bacteria 1184
481 Ga0495588_0027038 3300046674 Bacteria 2866
482 Ga0495599_0151357 3300046678 Bacteria 1437
483 Ga0495613_0136017 3300046689 Bacteria 1758
484 Ga0495624_0028773 3300046690 Bacteria 3628
485 Ga0495670_0056003 3300046691 Bacteria 1977
486 Ga0495649_0012674 3300046694 Bacteria 4892
487 Ga0495649_0095415 3300046694 Bacteria 1583
488 Ga0495649_0102820 3300046694 Bacteria 1518
489 Ga0495600_0014585 3300046809 Bacteria 4953
490 Ga0495660_0146100 3300046810 Bacteria 1172
491 Ga0495581_0067758 3300047315 Bacteria 2064
492 Ga0495604_0230793 3300047317 Bacteria 1269
493 Ga0495672_0009162 3300047320 Bacteria 7209
494 Ga0495683_0142113 3300047323 Bacteria 1124
495 Ga0495686_0048626 3300047472 Bacteria 2673
496 Ga0495686_0161070 3300047472 Bacteria 1311
497 Ga0495626_0109445 3300048091 Bacteria 1198
498 Ga0496100_0040667 3300048903 Bacteria 2960
499 Ga0496100_0563045 3300048903 Bacteria 883
500 Ga0496101_0072007 3300048904 Bacteria 2536
501 Ga0496101_0084425 3300048904 Bacteria 2352
502 Ga0496101_0097592 3300048904 Bacteria 2195
503 Ga0496101_0163519 3300048904 Bacteria 1708
504 Ga0496102_0029798 3300048905 Bacteria 4883
505 Ga0496102_0047174 3300048905 Bacteria 3913
506 Ga0496102_0133853 3300048905 Bacteria 2322
507 Ga0496102_0352961 3300048905 Bacteria 1385
508 Ga0496102_0799110 3300048905 Bacteria 866
509 Ga0496103_0006498 3300048906 Bacteria 6974
510 Ga0496104_0001158 3300048907 Bacteria 22612
511 Ga0496104_0046332 3300048907 Bacteria 4094
512 Ga0496104_0066296 3300048907 Bacteria 3427
513 Ga0496104_0200923 3300048907 Bacteria 1905
514 Ga0496104_0234527 3300048907 Bacteria 1747
515 Ga0496104_0463999 3300048907 Bacteria 1178
516 Ga0496105_0004710 3300048908 Bacteria 10290
517 Ga0496105_0010156 3300048908 Bacteria 7396
518 Ga0496105_0369947 3300048908 Bacteria 1142
519 Ga0496106_0004768 3300048909 Bacteria 10026
520 Ga0496106_0012539 3300048909 Bacteria 6258
521 Ga0496106_0030183 3300048909 Bacteria 4042
522 Ga0496106_0118375 3300048909 Bacteria 2068
523 Ga0496106_0236570 3300048909 Bacteria 1459
524 Ga0496107_0007996 3300048910 Bacteria 7299
525 Ga0496107_0144357 3300048910 Bacteria 1759
526 Ga0496108_0018643 3300048911 Bacteria 5686
527 Ga0496108_0022012 3300048911 Bacteria 5240
528 Ga0496108_0039966 3300048911 Bacteria 3909
529 Ga0496108_0194826 3300048911 Bacteria 1757
530 Ga0496108_0447111 3300048911 Bacteria 1129
531 Ga0496108_0483659 3300048911 Bacteria 1081
532 Ga0496109_0025798 3300048912 Bacteria 5239
533 Ga0496109_0201432 3300048912 Bacteria 1871
534 Ga0496109_0214572 3300048912 Bacteria 1810
535 Ga0496110_0001582 3300048913 Bacteria 16633
536 Ga0496110_0016255 3300048913 Bacteria 6210
537 Ga0496110_0122978 3300048913 Bacteria 2339
538 Ga0496110_0443465 3300048913 Bacteria 1183
539 Ga0496110_0830749 3300048913 Bacteria 829
540 Ga0496111_0045339 3300048914 Bacteria 3163
541 Ga0496111_0049174 3300048914 Bacteria 3040
542 Ga0496111_0331112 3300048914 Bacteria 1127
543 Ga0496112_0019557 3300048915 Bacteria 6394
544 Ga0496112_0021694 3300048915 Bacteria 6109
545 Ga0496112_0047365 3300048915 Bacteria 4217
546 Ga0496112_0194851 3300048915 Bacteria 1987
547 Ga0496112_0340566 3300048915 Bacteria 1443
548 Ga0496113_0048068 3300048916 Bacteria 3173
549 Ga0496113_0085278 3300048916 Bacteria 2426
550 Ga0496114_0008737 3300048917 Bacteria 8025
551 Ga0496114_0098077 3300048917 Bacteria 2498
552 Ga0496114_0227961 3300048917 Bacteria 1636
553 Ga0496115_0001085 3300048918 Bacteria 19693
554 Ga0496115_0026896 3300048918 Bacteria 4495
555 Ga0496115_0056643 3300048918 Bacteria 3151
556 Ga0496115_0058036 3300048918 Bacteria 3113
557 Ga0496116_0110018 3300048919 Bacteria 1622
558 Ga0496117_0033068 3300048920 Bacteria 3916
559 Ga0496117_0086306 3300048920 Bacteria 2039
560 Ga0496118_0023315 3300048921 Bacteria 5380
561 Ga0496118_0032338 3300048921 Bacteria 4312
562 Ga0496118_0094593 3300048921 Bacteria 2043
563 Ga0496118_0119118 3300048921 Bacteria 1727
564 Ga0496118_0202614 3300048921 Bacteria 1173
565 Ga0496119_0015262 3300048922 Bacteria 5933
566 Ga0496120_0021987 3300048923 Bacteria 4018
567 Ga0496121_0010402 3300048924 Bacteria 10500
568 Ga0496121_0056437 3300048924 Bacteria 3262
569 Ga0496121_0115235 3300048924 Bacteria 2041
570 Ga0496121_0119316 3300048924 Bacteria 1995
571 Ga0496121_0159257 3300048924 Bacteria 1653
572 Ga0496121_0193365 3300048924 Bacteria 1457
573 Ga0496121_0194740 3300048924 Bacteria 1450
574 Ga0496121_0208485 3300048924 Bacteria 1386
575 Ga0496122_0016595 3300048925 Bacteria 6952
576 Ga0496122_0061849 3300048925 Bacteria 2745
577 Ga0496123_0018256 3300048926 Bacteria 5586
578 Ga0496123_0195197 3300048926 Bacteria 1043
579 Ga0496124_0082765 3300048927 Bacteria 2634
580 Ga0496124_0155564 3300048927 Bacteria 1788
581 Ga0496125_0004577 3300048928 Bacteria 15842
582 Ga0496125_0231446 3300048928 Bacteria 1181
583 Ga0496126_0005628 3300048929 Bacteria 14249
584 Ga0496126_0014342 3300048929 Bacteria 8014
585 Ga0496126_0017332 3300048929 Bacteria 7179
586 Ga0496126_0018592 3300048929 Bacteria 6880
587 Ga0496126_0082162 3300048929 Bacteria 2847
588 Ga0496126_0158135 3300048929 Bacteria 1938
589 Ga0496126_0303184 3300048929 Bacteria 1317
590 Ga0496126_0416739 3300048929 Bacteria 1086
591 Ga0495682_0087406 3300049460 Bacteria 1120
592 nmdc:mga03683_34524_c1 3300050489 Bacteria 2047
593 nmdc:mga03n38_162168_c1 3300050490 Bacteria 1133
594 nmdc:mga03n38_84937_c1 3300050490 Bacteria 1495
595 nmdc:mga0yw44_188790_c1 3300050492 Bacteria 1359
596 nmdc:mga07m45_15715_c1 3300050496 Bacteria 4043
597 nmdc:mga07m45_20179_c1 3300050496 Bacteria 3619
598 nmdc:mga07m45_5454_c1 3300050496 Bacteria 5177
599 nmdc:mga08y16_537669_c1 3300050511 Bacteria 1184
600 nmdc:mga0sz30_30689_c1 3300050516 Bacteria 2222
601 nmdc:mga0sz30_90977_c1 3300050516 Bacteria 1327
602 nmdc:mga0sz30_9146_c1 3300050516 Bacteria 3759
603 nmdc:mga0sz30_9893_c1 3300050516 Bacteria 3640
604 Ga0495601_0208680 3300053077 Bacteria 1276
605 Ga0495619_0356293 3300053085 Bacteria 1012
606 Ga0500578_0028541 3300053086 Bacteria 3584
607 Ga0500578_0052937 3300053086 Bacteria 2599
608 Ga0500578_0130955 3300053086 Bacteria 1573
609 Ga0500581_054088 3300053089 Bacteria 2041
610 Ga0500646_0029026 3300053090 Bacteria 1513
611 Ga0500651_0098038 3300053093 Bacteria 1800
612 Ga0500566_0005483 3300053094 Bacteria 7548
613 Ga0500566_0034093 3300053094 Bacteria 2963
614 Ga0500566_0154478 3300053094 Bacteria 1203
615 Ga0500641_0020683 3300053096 Bacteria 2500
616 Ga0500555_045250 3300053103 Bacteria 1217
617 Ga0500556_0000003 3300053104 Bacteria 679379
618 Ga0500569_001531 3300053109 Bacteria 4385
619 Ga0500569_059864 3300053109 Bacteria 1173
620 Ga0500592_000496 3300053116 Bacteria 6503
621 Ga0500594_0008522 3300053118 Bacteria 2340
622 Ga0500594_0020703 3300053118 Bacteria 1643
623 Ga0500595_000262 3300053119 Bacteria 34880
624 Ga0500607_145957 3300053121 Bacteria 1105
625 Ga0500617_077151 3300053124 Bacteria 1450
626 Ga0500642_0000104 3300053130 Bacteria 40747
627 Ga0500652_000844 3300053131 Bacteria 10136
628 Ga0500559_0079353 3300053136 Bacteria 1490
629 Ga0500568_0005974 3300053139 Bacteria 6188
630 Ga0500577_0015937 3300053142 Bacteria 2359
631 Ga0500577_0055256 3300053142 Bacteria 1507
632 Ga0500588_0017406 3300053146 Bacteria 1876
633 Ga0500603_016779 3300053150 Bacteria 1742
634 Ga0500616_0001128 3300053153 Bacteria 27467
635 Ga0500622_0000957 3300053156 Bacteria 24532
636 Ga0500634_0045559 3300053161 Bacteria 2373
637 Ga0500637_0040605 3300053178 Bacteria 2628
638 Ga0500570_083623 3300053724 Bacteria 1424
639 Ga0500601_000034 3300053737 Bacteria 28953
640 2513651867 2513237095 Bacteria 8976980
641 2513863069 2513237137 Bacteria 9558895
642 2517895840 2517572143 Bacteria 9484767
643 2528853700 2528768022 Bacteria 10457665
644 2528856400 2528768022 Bacteria 10457665
645 2818242031 2816332527 Bacteria 8933356
646 2842044766 2842038055 Bacteria 8002051
647 2842053047 2842045827 Bacteria 8006841
648 2849077543 2849076700 Bacteria 7039503
649 2857525373 2857524615 Bacteria 6615449
650 2888386219 2888378607 Bacteria 9652610
651 2888392063 2888388044 Bacteria 7304136
652 2889034979 2889033259 Bacteria 9099371
653 2889036231 2889033259 Bacteria 9099371
654 2889038540 2889033259 Bacteria 9099371
655 2889039215 2889033259 Bacteria 9099371
656 2904700828
657 2904710114
658 2919074936 2919073203 Bacteria 6531949
659 2922428706
660 2929623056 2929615660 Bacteria 9193770
661 2929630641 2929624759 Bacteria 9339455
662 2933584962 2933577622 Bacteria 9116884
663 3005507740 3005506211 Bacteria 6943378
664 8006935611 8006933436 Bacteria 10410654
665 8006975540 8006973647 Bacteria 10679141
666 8006993065 8006984368 Bacteria 9651211
667 8055748795 8055742211 Bacteria 9226248
668 8056969180 8056967851 Bacteria 9038162
669 Ga0209758_1008466
670 JGI25153J46596_10000452
671 JGI25153J46596_10027854
672 JGI25160J50197_1000515
673 JGI25160J50197_1001954
674 Ga0055542_1013519
675 Ga0055531_10018768
676 Ga0065165_1012658
677 Ga0065165_1013906
678 Ga0065715_10119545
679 Ga0070658_10010161
680 Ga0070658_10177086
681 Ga0070676_10203680
682 Ga0070683_100102899
683 Ga0070683_100191575
684 Ga0070690_100181501
685 Ga0068869_100004469
686 Ga0068869_100026542
687 Ga0068869_100079060
688 Ga0070666_10319391
689 Ga0070680_100000783
690 Ga0070680_100023282
691 Ga0070680_100051070
692 Ga0070680_100911750
693 Ga0070689_100291977
694 Ga0070689_100588434
695 Ga0070691_10001231
696 Ga0070691_10042603
697 Ga0070668_100027966
698 Ga0070668_100131209
699 Ga0070668_100159754
700 Ga0070675_100179268
701 Ga0070667_100454045
702 Ga0070667_100477098
703 Ga0070709_10006867
704 Ga0070709_10014217
705 Ga0070709_10032965
706 Ga0070709_10411396
707 Ga0070714_100011614
708 Ga0070714_100017763
709 Ga0070714_100017836
710 Ga0070714_100676335
711 Ga0070714_100832508
712 Ga0070713_100011720
713 Ga0070713_100021325
714 Ga0070713_100073114
715 Ga0070713_100188447
716 Ga0070713_100598715
717 Ga0070710_10000766
718 Ga0070710_10001656
719 Ga0070710_10013077
720 Ga0070711_100010851
721 Ga0070711_100017723
722 Ga0070711_100072296
723 Ga0070711_100128221
724 Ga0070705_100161051
725 Ga0070663_100008631
726 Ga0070663_100026165
727 Ga0070663_100077143
728 Ga0070663_100088740
729 Ga0070678_100003618
730 Ga0070678_100010779
731 Ga0070678_100014830
732 Ga0070662_100248312
733 Ga0070681_10000423
734 Ga0070681_10165586
735 Ga0070681_10237034
736 Ga0070681_10451490
737 Ga0070681_10721296
738 Ga0070685_10224415
739 Ga0070685_10426439
740 Ga0070698_100380830
741 Ga0070679_100002998
742 Ga0070679_100024886
743 Ga0070679_100118122
744 Ga0070679_100549454
745 Ga0070679_100793588
746 Ga0070684_100001413
747 Ga0070684_100020867
748 Ga0070684_100406599
749 Ga0068853_100019122
750 Ga0068853_100391867
751 Ga0070693_100121212
752 Ga0070665_100021319
753 Ga0070665_100041276
754 Ga0070665_100076213
755 Ga0070665_100432740
756 Ga0070665_100467218
757 Ga0070704_100423157
758 Ga0068855_100108438
759 Ga0068855_100364226
760 Ga0068855_100638543
761 Ga0070664_100135099
762 Ga0068857_100000816
763 Ga0068854_100035345
764 Ga0068854_100261038
765 Ga0068856_100002260
766 Ga0068856_100552978
767 Ga0068856_100655933
768 Ga0070702_100088559
769 Ga0068852_100002224
770 Ga0068852_100045122
771 Ga0068852_100155942
772 Ga0068852_100180315
773 Ga0068859_100195551
774 Ga0068864_100155739
775 Ga0068861_100416889
776 Ga0068863_100187035
777 Ga0068858_100197881
778 Ga0068858_100357396
779 Ga0068858_100425985
780 Ga0068860_100086358
781 Ga0068860_100120647
782 Ga0068860_100247930
783 Ga0068862_100018780
784 Ga0068862_100132490
785 Ga0068862_100177254
786 Ga0068862_100201329
787 Ga0068862_100249723
788 Ga0068862_100425490
789 Ga0070717_10001543
790 Ga0070717_10009643
791 Ga0070717_10072969
792 Ga0070717_10159722
793 Ga0070717_10458278
794 Ga0075365_10013000
795 Ga0075365_10067432
796 Ga0075365_10147896
797 Ga0075368_10002348
798 Ga0075363_100188431
799 Ga0075363_100211248
800 Ga0070716_100010823
801 Ga0070716_100090997
802 Ga0070712_100000135
803 Ga0070712_100004486
804 Ga0070712_100010979
805 Ga0070712_100034722
806 Ga0070712_100056064
807 Ga0075367_10013947
808 Ga0075367_10082754
809 Ga0075366_10003590
810 Ga0075366_10047238
811 Ga0097621_100754962
812 Ga0075370_10008154
813 Ga0075370_10020357
814 Ga0075370_10063401
815 Ga0068871_100230689
816 Ga0068865_100061443
817 Ga0075436_100279286
818 Ga0097620_100195540
819 Ga0099794_10012081
820 Ga0099794_10021821
821 Ga0099795_10003403
822 Ga0099795_10021273
823 Ga0099795_10036412
824 Ga0105240_10003489
825 Ga0105240_10046509
826 Ga0105240_10047603
827 Ga0105245_10114400
828 Ga0105245_10950334
829 Ga0105247_10023607
830 Ga0105247_10029449
831 Ga0105247_10081057
832 Ga0105247_10095491
833 Ga0105247_10170717
834 Ga0105247_10315757
835 Ga0105247_10357572
836 Ga0105243_10279247
837 Ga0105241_10001328
838 Ga0105241_10034971
839 Ga0105241_10057004
840 Ga0105241_10157924
841 Ga0105241_10180533
842 Ga0105241_10241371
843 Ga0105241_10736958
844 Ga0105242_10473240
845 Ga0105248_10026820
846 Ga0105248_10028048
847 Ga0105248_10283762
848 Ga0105248_10467738
849 Ga0105248_11013463
850 Ga0105237_10000828
851 Ga0105237_10006546
852 Ga0105237_10007030
853 Ga0105237_10040195
854 Ga0105237_10041311
855 Ga0105237_10065124
856 Ga0105237_10171246
857 Ga0105237_10200196
858 Ga0105237_10593333
859 Ga0105238_10001254
860 Ga0105238_10089676
861 Ga0105238_10253521
862 Ga0105249_10115333
863 Ga0105249_10283363
864 Ga0105249_10319740
865 Ga0105249_11138467
866 Ga0099796_10004221
867 Ga0099796_10017587
868 Ga0105239_10017195
869 Ga0105239_10086875
870 Ga0105239_10200184
871 Ga0105239_10696539
872 Ga0105239_11309090
873 Ga0105246_10014068
874 Ga0105246_10079417
875 Ga0105246_10343329
876 Ga0157371_10241450
877 Ga0157370_10066257
878 Ga0157370_10232676
879 Ga0157370_10566037
880 Ga0157369_10006368
881 Ga0157369_10090752
882 Ga0157369_10216536
883 Ga0157369_10294794
884 Ga0157374_10018094
885 Ga0157374_10027874
886 Ga0157378_10045902
887 Ga0157378_10260158
888 Ga0157378_10289553
889 Ga0157378_10531754
890 Ga0163162_10017351
891 Ga0163162_10067194
892 Ga0163162_10089841
893 Ga0163162_10251998
894 Ga0163162_10392724
895 Ga0157372_10018217
896 Ga0157372_10294146
897 Ga0157375_10023067
898 Ga0157375_10637031
899 Ga0163163_10195748
900 Ga0163163_10417686
901 Ga0157379_10011193
902 Ga0157379_10097706
903 Ga0157379_10109168
904 Ga0157379_10166270
905 Ga0157376_10382936
906 Ga0157376_10490532
907 Ga0157376_10778438
908 Ga0163161_10379313
909 Ga0163161_10531119
910 Ga0206354_11564108
911 Ga0224712_10076917
912 Ga0224712_10134267
913 Ga0209563_113633
914 Ga0209677_103687
915 Ga0209148_1000305
916 Ga0209233_1016177
917 Ga0209455_1005953
918 Ga0209564_1002350
919 Ga0209564_1009385
920 Ga0209758_1000703
921 Ga0209256_1017086
922 Ga0207426_1000401
923 Ga0207426_1004331
924 Ga0207426_1023015
925 Ga0207426_1032714
926 Ga0209257_1008475
927 Ga0209257_1010366
928 Ga0209257_1021817
929 Ga0207653_10041573
930 Ga0207682_10158246
931 Ga0207692_10001730
932 Ga0207692_10003668
933 Ga0207692_10014527
934 Ga0207692_10016497
935 Ga0207642_10100012
936 Ga0207710_10078032
937 Ga0207710_10090591
938 Ga0207710_10139238
939 Ga0207710_10207532
940 Ga0207710_10311643
941 Ga0207680_10075828
942 Ga0207680_10210740
943 Ga0207685_10116894
944 Ga0207699_10010052
945 Ga0207699_10120536
946 Ga0207699_10320993
947 Ga0207699_10403993
948 Ga0207645_10116839
949 Ga0207705_10027508
950 Ga0207705_10183723
951 Ga0207705_10672386
952 Ga0207684_10158920
953 Ga0207654_10019545
954 Ga0207654_10033814
955 Ga0207654_10072360
956 Ga0207707_10000636
957 Ga0207707_10014817
958 Ga0207707_10024340
959 Ga0207707_10116656
960 Ga0207707_10296647
961 Ga0207695_10000136
962 Ga0207695_10002533
963 Ga0207695_10194413
964 Ga0207671_10003434
965 Ga0207671_10013294
966 Ga0207671_10040312
967 Ga0207671_10060263
968 Ga0207671_10113184
969 Ga0207671_10115192
970 Ga0207671_10120924
971 Ga0207671_10395070
972 Ga0207671_10405201
973 Ga0207693_10000025
974 Ga0207693_10005265
975 Ga0207693_10021549
976 Ga0207693_10463742
977 Ga0207693_10464960
978 Ga0207663_10000148
979 Ga0207663_10007509
980 Ga0207663_10057898
981 Ga0207663_10172353
982 Ga0207663_10257596
983 Ga0207660_10032278
984 Ga0207660_10044674
985 Ga0207652_10001333
986 Ga0207652_10054433
987 Ga0207652_10087250
988 Ga0207652_10543617
989 Ga0207681_10112872
990 Ga0207681_10569897
991 Ga0207694_10003050
992 Ga0207694_10250934
993 Ga0207694_10329811
994 Ga0207659_10178704
995 Ga0207659_10353496
996 Ga0207687_10065573
997 Ga0207700_10007363
998 Ga0207700_10149040
999 Ga0207700_10226268
1000 Ga0207664_10017819
1001 Ga0207664_10022185
1002 Ga0207664_10041681
1003 Ga0207664_10087387
1004 Ga0207664_10098204
1005 Ga0207644_10440978
1006 Ga0207686_10243783
1007 Ga0207670_10045879
1008 Ga0207670_10440586
1009 Ga0207669_10141054
1010 Ga0207704_10041590
1011 Ga0207704_10790752
1012 Ga0207665_10002091
1013 Ga0207665_10003981
1014 Ga0207665_10013611
1015 Ga0207665_10068140
1016 Ga0207665_10400621
1017 Ga0207691_10522573
1018 Ga0207711_10222726
1019 Ga0207689_10098751
1020 Ga0207689_10109127
1021 Ga0207661_10002023
1022 Ga0207661_10004058
1023 Ga0207661_10020192
1024 Ga0207661_10468496
1025 Ga0207679_10203843
1026 Ga0207679_10233881
1027 Ga0207667_10000189
1028 Ga0207667_10227252
1029 Ga0207667_10752440
1030 Ga0207651_10175895
1031 Ga0207712_10006797
1032 Ga0207712_10302519
1033 Ga0207668_10014976
1034 Ga0207668_10274140
1035 Ga0207640_10357569
1036 Ga0207658_10371741
1037 Ga0207677_10181755
1038 Ga0207703_10308968
1039 Ga0207703_10437952
1040 Ga0207639_10034086
1041 Ga0207639_10611736
1042 Ga0207678_10014664
1043 Ga0207678_10020691
1044 Ga0207678_10171262
1045 Ga0207678_10360778
1046 Ga0207678_10631369
1047 Ga0207708_10198832
1048 Ga0207702_10005340
1049 Ga0207702_10195037
1050 Ga0207702_10574611
1051 Ga0207702_10778791
1052 Ga0207702_10795209
1053 Ga0207641_10826989
1054 Ga0207674_10002199
1055 Ga0207683_10020024
1056 Ga0207698_10031535
1057 Ga0207698_10164285
1058 Ga0207698_10194760
1059 Ga0207698_10628881
1060 Ga0209588_1003085
1061 Ga0209588_1024824
1062 Ga0265357_1019884
1063 Ga0268266_10003076
1064 Ga0268266_10008543
1065 Ga0268266_10162504
1066 Ga0268266_10264226
1067 Ga0268266_10400053
1068 Ga0268266_10490737
1069 Ga0268265_10074377
1070 Ga0268265_10088390
1071 Ga0268265_10262012
1072 Ga0268264_10073403
1073 Ga0268264_10082100
1074 Ga0268264_10449518
1075 Ga0307517_10085022
1076 Ga0307515_10015965
1077 Ga0307515_10021245
1078 Ga0307515_10331628
1079 Ga0307515_10461842
1080 Ga0265760_10006241
1081 Ga0265328_10040324
1082 Ga0265329_10090348
1083 Ga0265339_10249068
1084 Ga0265327_10148261
1085 Ga0307513_10082240
1086 Ga0307508_10000092
1087 Ga0307508_10184115
1088 Ga0265314_10054074
1089 Ga0265314_10083949
1090 Ga0265314_10193097
1091 Ga0307516_10005831
1092 Ga0307516_10007969
1093 Ga0307405_10587727
1094 Ga0307510_10000928
1095 Ga0307510_10121708
1096 Ga0315911_1000004
1097 Ga0316215_1004848
1098 Ga0373928_0035435
1099 Ga0373941_0003984
1100 Ga0373960_0012581
1101 Ga0373943_0014535
1102 Ga0373931_0029887
1103 Ga0373931_0036583
1104 Ga0373931_0054458
1105 Ga0373933_0000368
1106 Ga0373937_0643420
1107 Ga0395900_0699102
1108 Ga0395898_0004778
1109 Ga0395905_0276015
1110 Ga0395905_0522355
1111 Ga0395901_0095741
1112 Ga0451841_0838279
1113 Ga0495603_0074508
1114 Ga0495603_0260169
1115 Ga0495629_0009850
1116 Ga0495638_0015651
1117 Ga0495651_0009663
1118 Ga0495653_0037199
1119 Ga0495582_0057579
1120 Ga0495605_0072302
1121 Ga0495639_0145000
1122 Ga0495594_0250081
1123 Ga0495607_0012823
1124 Ga0495583_0016331
1125 Ga0495606_0016019
1126 Ga0495606_0072187
1127 Ga0495610_0018624
1128 Ga0495616_0040996
1129 Ga0495616_0063771
1130 Ga0495620_0031566
1131 Ga0495630_0775502
1132 Ga0495631_0023544
1133 Ga0495631_0098814
1134 Ga0495637_0080919
1135 Ga0495643_0021980
1136 Ga0495648_0037355
1137 Ga0495652_0042805
1138 Ga0495654_0071502
1139 Ga0495640_0016110
1140 Ga0495597_0012735
1141 Ga0495622_0057336
1142 Ga0495634_0049088
1143 Ga0495611_0087772
1144 Ga0495611_0187899
1145 Ga0495625_0095223
1146 Ga0495625_0149245
1147 Ga0495635_0017508
1148 Ga0495661_0165416
1149 Ga0495588_0027038
1150 Ga0495599_0151357
1151 Ga0495613_0136017
1152 Ga0495624_0028773
1153 Ga0495670_0056003
1154 Ga0495649_0012674
1155 Ga0495649_0095415
1156 Ga0495649_0102820
1157 Ga0495600_0014585
1158 Ga0495660_0146100
1159 Ga0495581_0067758
1160 Ga0495604_0230793
1161 Ga0495672_0009162
1162 Ga0495683_0142113
1163 Ga0495686_0048626
1164 Ga0495686_0161070
1165 Ga0495626_0109445
1166 Ga0496100_0040667
1167 Ga0496100_0563045
1168 Ga0496101_0072007
1169 Ga0496101_0084425
1170 Ga0496101_0097592
1171 Ga0496101_0163519
1172 Ga0496102_0029798
1173 Ga0496102_0047174
1174 Ga0496102_0133853
1175 Ga0496102_0352961
1176 Ga0496102_0799110
1177 Ga0496103_0006498
1178 Ga0496104_0001158
1179 Ga0496104_0046332
1180 Ga0496104_0066296
1181 Ga0496104_0200923
1182 Ga0496104_0234527
1183 Ga0496104_0463999
1184 Ga0496105_0004710
1185 Ga0496105_0010156
1186 Ga0496105_0369947
1187 Ga0496106_0004768
1188 Ga0496106_0012539
1189 Ga0496106_0030183
1190 Ga0496106_0118375
1191 Ga0496106_0236570
1192 Ga0496107_0007996
1193 Ga0496107_0144357
1194 Ga0496108_0018643
1195 Ga0496108_0022012
1196 Ga0496108_0039966
1197 Ga0496108_0194826
1198 Ga0496108_0447111
1199 Ga0496108_0483659
1200 Ga0496109_0025798
1201 Ga0496109_0201432
1202 Ga0496109_0214572
1203 Ga0496110_0001582
1204 Ga0496110_0016255
1205 Ga0496110_0122978
1206 Ga0496110_0443465
1207 Ga0496110_0830749
1208 Ga0496111_0045339
1209 Ga0496111_0049174
1210 Ga0496111_0331112
1211 Ga0496112_0019557
1212 Ga0496112_0021694
1213 Ga0496112_0047365
1214 Ga0496112_0194851
1215 Ga0496112_0340566
1216 Ga0496113_0048068
1217 Ga0496113_0085278
1218 Ga0496114_0008737
1219 Ga0496114_0098077
1220 Ga0496114_0227961
1221 Ga0496115_0001085
1222 Ga0496115_0026896
1223 Ga0496115_0056643
1224 Ga0496115_0058036
1225 Ga0496116_0110018
1226 Ga0496117_0033068
1227 Ga0496117_0086306
1228 Ga0496118_0023315
1229 Ga0496118_0032338
1230 Ga0496118_0094593
1231 Ga0496118_0119118
1232 Ga0496118_0202614
1233 Ga0496119_0015262
1234 Ga0496120_0021987
1235 Ga0496121_0010402
1236 Ga0496121_0056437
1237 Ga0496121_0115235
1238 Ga0496121_0119316
1239 Ga0496121_0159257
1240 Ga0496121_0193365
1241 Ga0496121_0194740
1242 Ga0496121_0208485
1243 Ga0496122_0016595
1244 Ga0496122_0061849
1245 Ga0496123_0018256
1246 Ga0496123_0195197
1247 Ga0496124_0082765
1248 Ga0496124_0155564
1249 Ga0496125_0004577
1250 Ga0496125_0231446
1251 Ga0496126_0005628
1252 Ga0496126_0014342
1253 Ga0496126_0017332
1254 Ga0496126_0018592
1255 Ga0496126_0082162
1256 Ga0496126_0158135
1257 Ga0496126_0303184
1258 Ga0496126_0416739
1259 Ga0495682_0087406
1260 nmdc:mga03683_34524_c1
1261 nmdc:mga03n38_162168_c1
1262 nmdc:mga03n38_84937_c1
1263 nmdc:mga0yw44_188790_c1
1264 nmdc:mga07m45_15715_c1
1265 nmdc:mga07m45_20179_c1
1266 nmdc:mga07m45_5454_c1
1267 nmdc:mga08y16_537669_c1
1268 nmdc:mga0sz30_30689_c1
1269 nmdc:mga0sz30_90977_c1
1270 nmdc:mga0sz30_9146_c1
1271 nmdc:mga0sz30_9893_c1
1272 Ga0495601_0208680
1273 Ga0495619_0356293
1274 Ga0500578_0028541
1275 Ga0500578_0052937
1276 Ga0500578_0130955
1277 Ga0500581_054088
1278 Ga0500646_0029026
1279 Ga0500651_0098038
1280 Ga0500566_0005483
1281 Ga0500566_0034093
1282 Ga0500566_0154478
1283 Ga0500641_0020683
1284 Ga0500555_045250
1285 Ga0500556_0000003
1286 Ga0500569_001531
1287 Ga0500569_059864
1288 Ga0500592_000496
1289 Ga0500594_0008522
1290 Ga0500594_0020703
1291 Ga0500595_000262
1292 Ga0500607_145957
1293 Ga0500617_077151
1294 Ga0500642_0000104
1295 Ga0500652_000844
1296 Ga0500559_0079353
1297 Ga0500568_0005974
1298 Ga0500577_0015937
1299 Ga0500577_0055256
1300 Ga0500588_0017406
1301 Ga0500603_016779
1302 Ga0500616_0001128
1303 Ga0500622_0000957
1304 Ga0500634_0045559
1305 Ga0500637_0040605
1306 Ga0500570_083623
1307 Ga0500601_000034
1308 2513651867
1309 2513863069
1310 2517895840
1311 2528853700
1312 2528856400
1313 2818242031
1314 2842044766
1315 2842053047
1316 2849077543
1317 2857525373
1318 2888386219
1319 2888392063
1320 2889034979
1321 2889036231
1322 2889038540
1323 2889039215
1324 2904700828
1325 2904710114
1326 2919074936
1327 2922428706
1328 2929623056
1329 2929630641
1330 2933584962
1331 3005507740
1332 8006935611
1333 8006975540
1334 8006993065
1335 8055748795
1336 8056969180

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

24

112

0.95

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

144

212

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ku8-assembly2.cif.gz_B structures of pkgi reveal a cgmp-selective activation mechanism 0.8893 22 105
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.8852 20 111
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.8761 22 111
7ssb-assembly1.cif.gz_A co-structure of pkg1 regulatory domain with compound 33 0.8664 22 111
4ku7-assembly1.cif.gz_A structures of pkgi reveal a cgmp-selective activation mechanism 0.8601 22 117
ID Description Score Start End Superfamily
af_G5EDB9_5_131_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9263 21 101 2.60.120.10
5j3uA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9234 21 107 2.60.120.10
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.921 22 126 2.60.120.10
5kbfB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9201 21 106 2.60.120.10
af_A0A2R8Q8F0_19_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9115 20 101 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q1ZUQ0-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9325 20 126
AF-A0A3D5Q3P1-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9318 20 107 GO:0003700
GO:0005829
AF-A0A1Q7EDL1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9277 23 101 GO:0005829
AF-A0A353EHB4-F1-model_v4 Cyclic nucleotide-binding protein 0.926 20 105
AF-T0ZZD3-F1-model_v4 Transcriptional regulator, Crp/Fnr family 0.9208 23 96 GO:0003700
GO:0005829

Map