F473865

General Info

Members Datasets Scaffolds Average Seq Length
667 324 1334 116

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0946112|Ga0495602_0946112_62_481
Length 139
Sequence MAIQADGNAVLIVCAKILHPGGKEMTFQRIIAGLLVLTMAGLATSFYLHWKTNAQLQTMKAFVESYVFAEAVAACERAQSTTPFKWNGGTSTRVLGLNSVRLDKYVIVANYTLVADGVYCDFDPVKKKADIGSSFLERE

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
212 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0
Rhizoplane 6.15
Rhizosphere 85.16
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0946112 3300048088 Unclassified 571
2 JGI24739J22299_10119372 3300001989 Bacteria 788
3 JGI25406J46586_10000070 3300003203 Bacteria 46611
4 JGI25406J46586_10007363 3300003203 Bacteria 5027
5 JGI25153J46596_10011885 3300003215 Bacteria 3813
6 rootL2_10063827 3300003322 Bacteria 3168
7 rootL2_10080860 3300003322 Bacteria 6335
8 rootH1_10168448 3300003323 Bacteria 3261
9 JGI25404J52841_10024281 3300003659 Bacteria 1306
10 JGI25404J52841_10038539 3300003659 Bacteria 1014
11 Ga0065715_10259137 3300005293 Bacteria 1143
12 Ga0070658_10060332 3300005327 Bacteria 3089
13 Ga0070683_100007111 3300005329 Bacteria 9433
14 Ga0070683_101574111 3300005329 Bacteria 632
15 Ga0070670_101311100 3300005331 Bacteria 663
16 Ga0068869_100234632 3300005334 Bacteria 1459
17 Ga0070666_10598102 3300005335 Bacteria 805
18 Ga0070666_11423637 3300005335 Bacteria 518
19 Ga0070680_100009263 3300005336 Bacteria 7555
20 Ga0070680_100080627 3300005336 Bacteria 2684
21 Ga0070680_100212985 3300005336 Bacteria 1630
22 Ga0070680_100243849 3300005336 Bacteria 1519
23 Ga0070680_100606523 3300005336 Bacteria 940
24 Ga0070680_101853623 3300005336 Bacteria 523
25 Ga0070682_100021597 3300005337 Bacteria 3802
26 Ga0070682_100112386 3300005337 Bacteria 1817
27 Ga0070682_101842100 3300005337 Bacteria 529
28 Ga0068868_100029751 3300005338 Bacteria 4184
29 Ga0068868_100185571 3300005338 Bacteria 1728
30 Ga0068868_100673900 3300005338 Bacteria 923
31 Ga0068868_101807054 3300005338 Bacteria 577
32 Ga0070660_100012305 3300005339 Bacteria 6106
33 Ga0070660_100265234 3300005339 Bacteria 1403
34 Ga0070660_100736066 3300005339 Bacteria 828
35 Ga0070660_100943657 3300005339 Bacteria 728
36 Ga0070691_10743428 3300005341 Bacteria 592
37 Ga0070661_100668570 3300005344 Bacteria 844
38 Ga0070661_100769732 3300005344 Bacteria 788
39 Ga0070668_100082789 3300005347 Bacteria 2517
40 Ga0070668_100760057 3300005347 Bacteria 858
41 Ga0070668_101157194 3300005347 Bacteria 700
42 Ga0070671_100012940 3300005355 Bacteria 6723
43 Ga0070671_100253825 3300005355 Bacteria 1494
44 Ga0070674_100031516 3300005356 Bacteria 3513
45 Ga0070674_100382311 3300005356 Bacteria 1146
46 Ga0070674_101396455 3300005356 Bacteria 627
47 Ga0070674_101570727 3300005356 Bacteria 593
48 Ga0070673_100167771 3300005364 Bacteria 1872
49 Ga0070673_100291603 3300005364 Bacteria 1434
50 Ga0070673_100609286 3300005364 Bacteria 997
51 Ga0070659_101009731 3300005366 Bacteria 731
52 Ga0070709_10005193 3300005434 Bacteria 7044
53 Ga0070709_10008083 3300005434 Bacteria 5772
54 Ga0070709_10012672 3300005434 Bacteria 4722
55 Ga0070709_10347816 3300005434 Bacteria 1094
56 Ga0070709_11437765 3300005434 Bacteria 559
57 Ga0070714_100004264 3300005435 Bacteria 10769
58 Ga0070714_100046038 3300005435 Bacteria 3699
59 Ga0070714_100057490 3300005435 Bacteria 3330
60 Ga0070714_100194684 3300005435 Bacteria 1852
61 Ga0070713_100002430 3300005436 Bacteria 12143
62 Ga0070713_100054098 3300005436 Bacteria 3329
63 Ga0070713_100112874 3300005436 Bacteria 2372
64 Ga0070713_100216552 3300005436 Bacteria 1736
65 Ga0070713_100348408 3300005436 Bacteria 1374
66 Ga0070713_100387848 3300005436 Bacteria 1302
67 Ga0070710_10001162 3300005437 Bacteria 12453
68 Ga0070710_10001905 3300005437 Bacteria 9874
69 Ga0070710_10014272 3300005437 Bacteria 3997
70 Ga0070710_10555049 3300005437 Bacteria 794
71 Ga0070711_100001657 3300005439 Bacteria 12319
72 Ga0070711_100102314 3300005439 Bacteria 2086
73 Ga0070711_100111388 3300005439 Bacteria 2009
74 Ga0070711_100144564 3300005439 Bacteria 1787
75 Ga0070711_100244751 3300005439 Bacteria 1404
76 Ga0070711_100754766 3300005439 Bacteria 822
77 Ga0070711_100875060 3300005439 Bacteria 765
78 Ga0070705_100442242 3300005440 Bacteria 973
79 Ga0070700_101573584 3300005441 Bacteria 561
80 Ga0070663_100050500 3300005455 Bacteria 2958
81 Ga0070663_100060347 3300005455 Bacteria 2728
82 Ga0070663_100242508 3300005455 Bacteria 1423
83 Ga0070663_100563980 3300005455 Bacteria 953
84 Ga0070678_100009855 3300005456 Bacteria 5808
85 Ga0070678_100305849 3300005456 Bacteria 1353
86 Ga0070662_100333550 3300005457 Bacteria 1239
87 Ga0070681_10013524 3300005458 Bacteria 8115
88 Ga0070681_10031130 3300005458 Bacteria 5355
89 Ga0070681_10036529 3300005458 Bacteria 4934
90 Ga0070681_10045367 3300005458 Bacteria 4398
91 Ga0070681_10319064 3300005458 Bacteria 1463
92 Ga0070681_10347956 3300005458 Bacteria 1392
93 Ga0068867_101285470 3300005459 Bacteria 675
94 Ga0070679_100025706 3300005530 Bacteria 5778
95 Ga0070679_100157259 3300005530 Bacteria 2247
96 Ga0070679_100310289 3300005530 Bacteria 1527
97 Ga0070679_100321207 3300005530 Bacteria 1497
98 Ga0070679_101415599 3300005530 Bacteria 641
99 Ga0070684_100002967 3300005535 Bacteria 12630
100 Ga0070684_100018135 3300005535 Bacteria 5791
101 Ga0070684_100192396 3300005535 Bacteria 1857
102 Ga0070684_102245289 3300005535 Bacteria 515
103 Ga0068853_100007871 3300005539 Bacteria 8547
104 Ga0068853_100179788 3300005539 Bacteria 1918
105 Ga0068853_100186538 3300005539 Bacteria 1883
106 Ga0068853_100312636 3300005539 Bacteria 1455
107 Ga0070672_100238944 3300005543 Bacteria 1527
108 Ga0070672_100436978 3300005543 Bacteria 1126
109 Ga0070686_100453103 3300005544 Bacteria 987
110 Ga0070696_100302873 3300005546 Bacteria 1225
111 Ga0070693_100097628 3300005547 Bacteria 1783
112 Ga0070693_100578453 3300005547 Bacteria 808
113 Ga0070665_100060805 3300005548 Bacteria 3787
114 Ga0070665_100098860 3300005548 Bacteria 2923
115 Ga0070665_100227651 3300005548 Bacteria 1864
116 Ga0070665_101683513 3300005548 Bacteria 642
117 Ga0068855_100068264 3300005563 Bacteria 4139
118 Ga0068855_100116894 3300005563 Bacteria 3056
119 Ga0068855_100263113 3300005563 Bacteria 1921
120 Ga0068855_100270497 3300005563 Bacteria 1889
121 Ga0068855_101291775 3300005563 Bacteria 756
122 Ga0070664_102211649 3300005564 Bacteria 522
123 Ga0068857_100016728 3300005577 Bacteria 6425
124 Ga0068857_100133965 3300005577 Bacteria 2237
125 Ga0068857_100194164 3300005577 Bacteria 1850
126 Ga0068857_101137817 3300005577 Bacteria 754
127 Ga0068854_100201393 3300005578 Bacteria 1565
128 Ga0068854_100465816 3300005578 Bacteria 1058
129 Ga0068854_101530827 3300005578 Bacteria 606
130 Ga0068856_100000206 3300005614 Bacteria 63167
131 Ga0068856_100059030 3300005614 Bacteria 3789
132 Ga0068856_100161705 3300005614 Bacteria 2249
133 Ga0068856_101195143 3300005614 Bacteria 777
134 Ga0070702_100644687 3300005615 Bacteria 800
135 Ga0068852_100590724 3300005616 Bacteria 1114
136 Ga0068852_101102977 3300005616 Bacteria 814
137 Ga0068852_101838811 3300005616 Bacteria 628
138 Ga0068852_101868710 3300005616 Bacteria 623
139 Ga0068864_100092049 3300005618 Bacteria 2676
140 Ga0068864_100172287 3300005618 Bacteria 1974
141 Ga0068861_100141141 3300005719 Bacteria 1966
142 Ga0068861_100328286 3300005719 Bacteria 1335
143 Ga0068863_100378669 3300005841 Bacteria 1382
144 Ga0068858_102075014 3300005842 Bacteria 562
145 Ga0068862_100675133 3300005844 Bacteria 999
146 Ga0081455_10009281 3300005937 Bacteria 10131
147 Ga0081455_10029702 3300005937 Bacteria 4981
148 Ga0081455_10032712 3300005937 Bacteria 4684
149 Ga0081540_1004794 3300005983 Bacteria 10196
150 Ga0081540_1004926 3300005983 Bacteria 10050
151 Ga0081540_1019543 3300005983 Bacteria 4110
152 Ga0081540_1026736 3300005983 Bacteria 3286
153 Ga0081540_1089067 3300005983 Bacteria 1363
154 Ga0081539_10000250 3300005985 Bacteria 125352
155 Ga0081539_10000269 3300005985 Bacteria 119082
156 Ga0070717_10166382 3300006028 Bacteria 1915
157 Ga0070717_10462095 3300006028 Bacteria 1145
158 Ga0070717_10531086 3300006028 Bacteria 1065
159 Ga0070717_12088442 3300006028 Bacteria 510
160 Ga0075365_10142388 3300006038 Bacteria 1665
161 Ga0075365_10143927 3300006038 Bacteria 1656
162 Ga0075368_10000872 3300006042 Bacteria 9344
163 Ga0075363_100045604 3300006048 Bacteria 2325
164 Ga0070715_10000380 3300006163 Bacteria 11113
165 Ga0070715_10594503 3300006163 Bacteria 648
166 Ga0070716_100001573 3300006173 Bacteria 10249
167 Ga0070716_100006338 3300006173 Bacteria 5775
168 Ga0070716_100108961 3300006173 Bacteria 1712
169 Ga0070716_100121137 3300006173 Bacteria 1638
170 Ga0070716_100860027 3300006173 Bacteria 707
171 Ga0070712_100064121 3300006175 Bacteria 2604
172 Ga0070712_100081277 3300006175 Bacteria 2348
173 Ga0070712_100101802 3300006175 Bacteria 2126
174 Ga0070712_100364613 3300006175 Bacteria 1186
175 Ga0075362_10358562 3300006177 Bacteria 731
176 Ga0075367_10142957 3300006178 Bacteria 1483
177 Ga0075369_10110312 3300006186 Bacteria 1239
178 Ga0075366_10032477 3300006195 Bacteria 3072
179 Ga0097621_100190770 3300006237 Bacteria 1775
180 Ga0097621_100993411 3300006237 Bacteria 785
181 Ga0075370_10031584 3300006353 Bacteria 2957
182 Ga0075370_10248278 3300006353 Bacteria 1054
183 Ga0068871_100059511 3300006358 Bacteria 3113
184 Ga0068871_101251611 3300006358 Bacteria 697
185 Ga0075428_100809483 3300006844 Bacteria 996
186 Ga0075434_100102289 3300006871 Bacteria 2873
187 Ga0068865_101998907 3300006881 Bacteria 526
188 Ga0075435_100278089 3300007076 Bacteria 1429
189 Ga0099795_10022093 3300007788 Bacteria 2096
190 Ga0105250_10189532 3300009092 Bacteria 865
191 Ga0105240_10051150 3300009093 Bacteria 5202
192 Ga0105240_10112558 3300009093 Bacteria 3290
193 Ga0105240_10240744 3300009093 Bacteria 2097
194 Ga0111539_10153547 3300009094 Bacteria 2694
195 Ga0111539_11603346 3300009094 Bacteria 755
196 Ga0105245_10017389 3300009098 Bacteria 6272
197 Ga0105245_12188693 3300009098 Unclassified 607
198 Ga0105247_10286199 3300009101 Bacteria 1138
199 Ga0105247_10312066 3300009101 Bacteria 1094
200 Ga0105247_10363650 3300009101 Bacteria 1021
201 Ga0114129_13052041 3300009147 Bacteria 549
202 Ga0105243_10413284 3300009148 Bacteria 1256
203 Ga0105243_10626434 3300009148 Bacteria 1039
204 Ga0105243_12217192 3300009148 Bacteria 586
205 Ga0105241_10698117 3300009174 Bacteria 926
206 Ga0105241_10802861 3300009174 Bacteria 867
207 Ga0105241_12576868 3300009174 Bacteria 510
208 Ga0105242_10637251 3300009176 Bacteria 1035
209 Ga0105242_12596644 3300009176 Bacteria 555
210 Ga0105242_13157167 3300009176 Bacteria 511
211 Ga0105248_10132660 3300009177 Bacteria 2810
212 Ga0105248_10259375 3300009177 Bacteria 1957
213 Ga0105248_10409230 3300009177 Bacteria 1527
214 Ga0105248_10756810 3300009177 Bacteria 1096
215 Ga0105237_10240037 3300009545 Bacteria 1813
216 Ga0105237_10504180 3300009545 Bacteria 1217
217 Ga0105237_10631729 3300009545 Bacteria 1078
218 Ga0105237_10824583 3300009545 Bacteria 934
219 Ga0105237_11536315 3300009545 Bacteria 672
220 Ga0105237_11636887 3300009545 Bacteria 651
221 Ga0105238_10017117 3300009551 Bacteria 7358
222 Ga0105238_10155671 3300009551 Bacteria 2261
223 Ga0105238_10511777 3300009551 Bacteria 1202
224 Ga0105238_10920438 3300009551 Bacteria 893
225 Ga0105238_10927806 3300009551 Bacteria 890
226 Ga0105238_11264448 3300009551 Bacteria 763
227 Ga0105238_11438283 3300009551 Bacteria 717
228 Ga0105249_10078047 3300009553 Bacteria 3072
229 Ga0105249_10862154 3300009553 Bacteria 971
230 Ga0099796_10011904 3300010159 Bacteria 2441
231 Ga0105239_10192647 3300010375 Bacteria 2282
232 Ga0105239_10194966 3300010375 Bacteria 2268
233 Ga0105239_10224669 3300010375 Bacteria 2106
234 Ga0105239_10248574 3300010375 Bacteria 1997
235 Ga0105239_10363206 3300010375 Bacteria 1635
236 Ga0105239_10393826 3300010375 Bacteria 1567
237 Ga0105246_10099947 3300011119 Bacteria 2110
238 Ga0105246_10588822 3300011119 Bacteria 959
239 Ga0105246_12377237 3300011119 Bacteria 519
240 Ga0157338_1057347 3300012515 Bacteria 576
241 Ga0157370_10100545 3300013104 Bacteria 2709
242 Ga0157370_10123516 3300013104 Bacteria 2417
243 Ga0157370_10227945 3300013104 Bacteria 1725
244 Ga0157370_10688321 3300013104 Bacteria 933
245 Ga0157369_10019069 3300013105 Bacteria 7680
246 Ga0157369_10082565 3300013105 Bacteria 3438
247 Ga0157369_10285189 3300013105 Bacteria 1719
248 Ga0157369_11146239 3300013105 Bacteria 794
249 Ga0157374_10175590 3300013296 Bacteria 2091
250 Ga0157374_10603985 3300013296 Bacteria 1107
251 Ga0157378_12635823 3300013297 Bacteria 555
252 Ga0157378_12718709 3300013297 Bacteria 547
253 Ga0163162_10029891 3300013306 Bacteria 5395
254 Ga0163162_10039165 3300013306 Bacteria 4735
255 Ga0163162_10374159 3300013306 Bacteria 1558
256 Ga0163162_10628459 3300013306 Bacteria 1199
257 Ga0157372_10116199 3300013307 Bacteria 3068
258 Ga0157372_10224132 3300013307 Bacteria 2179
259 Ga0157372_10631149 3300013307 Bacteria 1248
260 Ga0157375_10535645 3300013308 Bacteria 1334
261 Ga0157375_11780676 3300013308 Bacteria 730
262 Ga0157375_13059708 3300013308 Bacteria 558
263 Ga0163163_10018251 3300014325 Bacteria 6562
264 Ga0163163_10118688 3300014325 Bacteria 2678
265 Ga0163163_10180822 3300014325 Bacteria 2156
266 Ga0157380_10204169 3300014326 Bacteria 1756
267 Ga0157380_10582089 3300014326 Bacteria 1104
268 Ga0157380_10637625 3300014326 Bacteria 1061
269 Ga0157380_10793139 3300014326 Bacteria 963
270 Ga0157380_10843869 3300014326 Bacteria 937
271 Ga0157377_10541501 3300014745 Bacteria 821
272 Ga0157379_10108391 3300014968 Bacteria 2493
273 Ga0157379_10268179 3300014968 Bacteria 1552
274 Ga0157379_10418075 3300014968 Bacteria 1234
275 Ga0157379_11236898 3300014968 Bacteria 719
276 Ga0157379_11268465 3300014968 Bacteria 710
277 Ga0157376_10060648 3300014969 Bacteria 3178
278 Ga0157376_10208515 3300014969 Bacteria 1803
279 Ga0157376_10272855 3300014969 Bacteria 1589
280 Ga0163161_11209867 3300017792 Bacteria 653
281 Ga0213875_10061024 3300021388 Bacteria 1763
282 Ga0209758_1013601 3300025297 Bacteria 4417
283 Ga0207692_10004221 3300025898 Bacteria 5679
284 Ga0207642_10411537 3300025899 Bacteria 811
285 Ga0207710_10158108 3300025900 Bacteria 1102
286 Ga0207688_10437797 3300025901 Bacteria 814
287 Ga0207680_10247866 3300025903 Bacteria 1229
288 Ga0207680_10271816 3300025903 Bacteria 1176
289 Ga0207647_10002405 3300025904 Bacteria 14208
290 Ga0207685_10088083 3300025905 Bacteria 1300
291 Ga0207699_10005494 3300025906 Bacteria 6070
292 Ga0207699_10014797 3300025906 Bacteria 4035
293 Ga0207699_10348101 3300025906 Bacteria 1045
294 Ga0207699_10922439 3300025906 Bacteria 645
295 Ga0207705_11342551 3300025909 Bacteria 545
296 Ga0207705_11362738 3300025909 Bacteria 540
297 Ga0207684_10051772 3300025910 Bacteria 3484
298 Ga0207684_10773239 3300025910 Bacteria 813
299 Ga0207654_10108080 3300025911 Bacteria 1725
300 Ga0207707_10000811 3300025912 Bacteria 30594
301 Ga0207707_10009415 3300025912 Bacteria 8473
302 Ga0207707_10065238 3300025912 Bacteria 3171
303 Ga0207707_10136748 3300025912 Bacteria 2142
304 Ga0207707_10503564 3300025912 Bacteria 1033
305 Ga0207707_10905232 3300025912 Bacteria 729
306 Ga0207695_10028180 3300025913 Bacteria 6235
307 Ga0207695_10209077 3300025913 Bacteria 1863
308 Ga0207695_10314929 3300025913 Bacteria 1455
309 Ga0207671_10334433 3300025914 Bacteria 1200
310 Ga0207671_10370029 3300025914 Bacteria 1138
311 Ga0207671_10614501 3300025914 Bacteria 866
312 Ga0207671_11039137 3300025914 Bacteria 645
313 Ga0207693_10000941 3300025915 Bacteria 26122
314 Ga0207693_10028476 3300025915 Bacteria 4414
315 Ga0207693_10123355 3300025915 Bacteria 2035
316 Ga0207663_10000377 3300025916 Bacteria 19464
317 Ga0207663_10087292 3300025916 Bacteria 2059
318 Ga0207663_10153260 3300025916 Bacteria 1619
319 Ga0207663_10168847 3300025916 Bacteria 1552
320 Ga0207663_10714742 3300025916 Bacteria 794
321 Ga0207663_10823181 3300025916 Bacteria 740
322 Ga0207663_10892140 3300025916 Bacteria 711
323 Ga0207660_10034871 3300025917 Bacteria 3490
324 Ga0207657_10003989 3300025919 Bacteria 15691
325 Ga0207657_10723340 3300025919 Bacteria 772
326 Ga0207657_10882365 3300025919 Bacteria 689
327 Ga0207652_10012855 3300025921 Bacteria 6768
328 Ga0207652_10025754 3300025921 Bacteria 4894
329 Ga0207652_10028346 3300025921 Bacteria 4672
330 Ga0207652_10929128 3300025921 Bacteria 767
331 Ga0207681_10711186 3300025923 Bacteria 836
332 Ga0207694_10041206 3300025924 Bacteria 3558
333 Ga0207694_10047652 3300025924 Bacteria 3315
334 Ga0207694_10296959 3300025924 Bacteria 1330
335 Ga0207694_10340238 3300025924 Bacteria 1241
336 Ga0207650_10389146 3300025925 Bacteria 1152
337 Ga0207650_10903585 3300025925 Bacteria 750
338 Ga0207659_10371545 3300025926 Bacteria 1191
339 Ga0207687_10081124 3300025927 Bacteria 2343
340 Ga0207687_10419965 3300025927 Bacteria 1103
341 Ga0207700_10017487 3300025928 Bacteria 4791
342 Ga0207700_10178456 3300025928 Bacteria 1776
343 Ga0207700_10229427 3300025928 Bacteria 1578
344 Ga0207700_10239254 3300025928 Bacteria 1546
345 Ga0207700_10326700 3300025928 Bacteria 1330
346 Ga0207700_10705860 3300025928 Bacteria 900
347 Ga0207664_10039762 3300025929 Bacteria 3652
348 Ga0207664_10325932 3300025929 Bacteria 1356
349 Ga0207664_10449353 3300025929 Bacteria 1150
350 Ga0207664_10465804 3300025929 Bacteria 1129
351 Ga0207644_10222443 3300025931 Bacteria 1497
352 Ga0207690_10109429 3300025932 Bacteria 1988
353 Ga0207706_10370441 3300025933 Bacteria 1244
354 Ga0207709_10014780 3300025935 Bacteria 4316
355 Ga0207669_11239698 3300025937 Bacteria 632
356 Ga0207704_10365549 3300025938 Bacteria 1128
357 Ga0207704_10445258 3300025938 Bacteria 1032
358 Ga0207704_10629645 3300025938 Bacteria 881
359 Ga0207665_10000175 3300025939 Bacteria 43114
360 Ga0207665_10011239 3300025939 Bacteria 5874
361 Ga0207665_10132023 3300025939 Bacteria 1774
362 Ga0207665_10159347 3300025939 Bacteria 1622
363 Ga0207691_10197004 3300025940 Bacteria 1754
364 Ga0207691_10412379 3300025940 Bacteria 1151
365 Ga0207711_10136012 3300025941 Bacteria 2207
366 Ga0207711_10173476 3300025941 Bacteria 1958
367 Ga0207689_10343812 3300025942 Bacteria 1239
368 Ga0207689_11314663 3300025942 Bacteria 607
369 Ga0207661_10146204 3300025944 Bacteria 2039
370 Ga0207679_10453964 3300025945 Bacteria 1137
371 Ga0207667_10045088 3300025949 Bacteria 4670
372 Ga0207667_10105498 3300025949 Bacteria 2907
373 Ga0207667_10626624 3300025949 Bacteria 1083
374 Ga0207651_10113676 3300025960 Bacteria 2038
375 Ga0207651_10265610 3300025960 Bacteria 1411
376 Ga0207712_10087687 3300025961 Bacteria 2283
377 Ga0207668_10076630 3300025972 Bacteria 2408
378 Ga0207668_10936013 3300025972 Bacteria 772
379 Ga0207640_10274662 3300025981 Bacteria 1320
380 Ga0207640_10290644 3300025981 Bacteria 1288
381 Ga0207640_10461480 3300025981 Bacteria 1049
382 Ga0207677_10077800 3300026023 Bacteria 2367
383 Ga0207677_10521676 3300026023 Bacteria 1031
384 Ga0207703_11250110 3300026035 Bacteria 714
385 Ga0207703_11515542 3300026035 Bacteria 645
386 Ga0207639_10005362 3300026041 Bacteria 8666
387 Ga0207639_10132049 3300026041 Bacteria 2068
388 Ga0207678_10039371 3300026067 Bacteria 4103
389 Ga0207678_10054458 3300026067 Bacteria 3445
390 Ga0207678_10129834 3300026067 Bacteria 2149
391 Ga0207678_10249902 3300026067 Bacteria 1519
392 Ga0207678_10368037 3300026067 Bacteria 1241
393 Ga0207702_10000075 3300026078 Bacteria 112303
394 Ga0207702_10105796 3300026078 Bacteria 2492
395 Ga0207702_11351763 3300026078 Bacteria 706
396 Ga0207641_10656984 3300026088 Bacteria 1030
397 Ga0207648_10040321 3300026089 Bacteria 4104
398 Ga0207676_10076353 3300026095 Bacteria 2707
399 Ga0207674_10024558 3300026116 Bacteria 6437
400 Ga0207674_10060529 3300026116 Bacteria 3828
401 Ga0207674_10215218 3300026116 Bacteria 1870
402 Ga0207674_10497062 3300026116 Bacteria 1178
403 Ga0207675_100100936 3300026118 Bacteria 2718
404 Ga0207675_100270817 3300026118 Bacteria 1648
405 Ga0207675_101428565 3300026118 Bacteria 713
406 Ga0207683_10019107 3300026121 Bacteria 5849
407 Ga0207683_10242248 3300026121 Bacteria 1645
408 Ga0207698_10306851 3300026142 Bacteria 1480
409 Ga0207698_10550747 3300026142 Bacteria 1130
410 Ga0209588_1070051 3300027671 Bacteria 1133
411 Ga0209813_10090174 3300027866 Bacteria 1028
412 Ga0207428_10080622 3300027907 Bacteria 2542
413 Ga0268266_10028431 3300028379 Bacteria 4753
414 Ga0268266_10055438 3300028379 Bacteria 3408
415 Ga0268266_10213170 3300028379 Bacteria 1772
416 Ga0268266_11476474 3300028379 Bacteria 655
417 Ga0268266_11643084 3300028379 Bacteria 618
418 Ga0268265_10434027 3300028380 Bacteria 1223
419 Ga0268265_10666653 3300028380 Bacteria 1001
420 Ga0307515_10251299 3300028794 Bacteria 1520
421 Ga0265762_1156078 3300030760 Bacteria 546
422 Ga0265770_1150115 3300030878 Bacteria 511
423 Ga0265332_10244876 3300031238 Bacteria 742
424 Ga0265339_10022463 3300031249 Bacteria 3657
425 Ga0307513_10301457 3300031456 Bacteria 1369
426 Ga0307408_100253444 3300031548 Bacteria 1453
427 Ga0265342_10139956 3300031712 Bacteria 1350
428 Ga0307516_10806824 3300031730 Bacteria 600
429 Ga0307406_11519571 3300031901 Bacteria 590
430 Ga0307412_10216717 3300031911 Bacteria 1465
431 Ga0307415_101173700 3300032126 Bacteria 722
432 Ga0373959_0213074 3300034820 Bacteria 515
433 Ga0373938_0253687 3300034957 Bacteria 504
434 Ga0373928_0143392 3300035084 Bacteria 656
435 Ga0373934_0062245 3300035086 Bacteria 1487
436 Ga0373934_0129502 3300035086 Bacteria 1029
437 Ga0373944_0262206 3300035089 Bacteria 640
438 Ga0373923_0079717 3300035111 Bacteria 1418
439 Ga0373936_0061464 3300035113 Bacteria 1534
440 Ga0373936_0379531 3300035113 Bacteria 647
441 Ga0373953_0272717 3300035117 Bacteria 737
442 Ga0373953_0435912 3300035117 Bacteria 578
443 Ga0373954_0474329 3300035118 Bacteria 620
444 Ga0373954_0560107 3300035118 Bacteria 566
445 Ga0373956_0065603 3300035119 Bacteria 1650
446 Ga0373957_0443319 3300035120 Bacteria 561
447 Ga0373943_0039448 3300035170 Bacteria 2275
448 Ga0373946_0042530 3300035171 Bacteria 1868
449 Ga0373955_0034691 3300035172 Bacteria 2667
450 Ga0373955_0145838 3300035172 Bacteria 1390
451 Ga0373924_0154898 3300035410 Bacteria 1003
452 Ga0373924_0222784 3300035410 Bacteria 833
453 Ga0373931_0109341 3300035691 Bacteria 1566
454 Ga0373931_0166718 3300035691 Bacteria 1295
455 Ga0373935_0109796 3300035692 Bacteria 1829
456 Ga0373935_0457001 3300035692 Bacteria 923
457 Ga0373927_0006772 3300035695 Bacteria 7798
458 Ga0373927_0027610 3300035695 Bacteria 3705
459 Ga0373933_0064857 3300035724 Bacteria 2210
460 Ga0373933_0114848 3300035724 Bacteria 1682
461 Ga0373933_0631711 3300035724 Bacteria 704
462 Ga0373947_0023422 3300035725 Bacteria 3591
463 Ga0373947_0290042 3300035725 Bacteria 1089
464 Ga0373937_0056118 3300036401 Bacteria 3616
465 Ga0373937_0204357 3300036401 Bacteria 1857
466 Ga0373925_0107124 3300037068 Bacteria 2155
467 Ga0373925_0464675 3300037068 Bacteria 1037
468 Ga0395900_0000502 3300037418 Bacteria 55040
469 Ga0395898_0132949 3300037466 Bacteria 2382
470 Ga0395905_0484648 3300037471 Bacteria 1136
471 Ga0436364_0607142 3300037853 Bacteria 2819
472 Ga0436364_0897060 3300037853 Bacteria 797
473 Ga0395901_0012010 3300038443 Bacteria 8786
474 Ga0436365_1727211 3300039437 Bacteria 1454
475 Ga0451797_1269366 3300041453 Bacteria 733
476 Ga0451798_0202254 3300041458 Bacteria 557
477 Ga0451853_2354594 3300041512 Bacteria 1216
478 Ga0466969_0201326 3300044656 Bacteria 908
479 Ga0466963_0169697 3300044694 Bacteria 1521
480 Ga0466967_0180388 3300045976 Bacteria 1991
481 Ga0466967_0374196 3300045976 Bacteria 1382
482 Ga0495592_0086856 3300046454 Bacteria 2252
483 Ga0495592_0106482 3300046454 Bacteria 1990
484 Ga0495603_0050884 3300046455 Bacteria 2463
485 Ga0495603_0055374 3300046455 Bacteria 2350
486 Ga0495629_0057901 3300046459 Bacteria 2709
487 Ga0495629_0789470 3300046459 Bacteria 627
488 Ga0495638_0136797 3300046460 Bacteria 1434
489 Ga0495653_0060529 3300046463 Bacteria 2868
490 Ga0495580_0037507 3300046472 Bacteria 3478
491 Ga0495580_0171803 3300046472 Bacteria 1498
492 Ga0495605_0401024 3300046474 Bacteria 570
493 Ga0495639_0144095 3300046475 Bacteria 1146
494 Ga0495639_0486293 3300046475 Bacteria 629
495 Ga0495662_0102921 3300046476 Bacteria 1397
496 Ga0495662_0581461 3300046476 Bacteria 548
497 Ga0495664_0049056 3300046477 Bacteria 2506
498 Ga0495664_0469993 3300046477 Bacteria 752
499 Ga0495594_0489557 3300046499 Bacteria 699
500 Ga0495608_0015738 3300046511 Bacteria 5235
501 Ga0495608_0068343 3300046511 Bacteria 2323
502 Ga0495616_0465403 3300046513 Bacteria 510
503 Ga0495618_0243082 3300046514 Bacteria 1131
504 Ga0495628_0148808 3300046516 Bacteria 1784
505 Ga0495628_0198322 3300046516 Bacteria 1513
506 Ga0495630_0050640 3300046517 Bacteria 3108
507 Ga0495630_0167565 3300046517 Bacteria 1673
508 Ga0495632_0181667 3300046519 Bacteria 964
509 Ga0495632_0347913 3300046519 Bacteria 652
510 Ga0495644_0375572 3300046523 Bacteria 561
511 Ga0495663_0087101 3300046525 Bacteria 1013
512 Ga0495642_0319007 3300046528 Bacteria 682
513 Ga0495652_0074715 3300046529 Bacteria 2818
514 Ga0495652_0154777 3300046529 Bacteria 1786
515 Ga0495665_0038042 3300046531 Bacteria 2566
516 Ga0495640_0024049 3300046533 Bacteria 4432
517 Ga0495640_0083202 3300046533 Bacteria 2124
518 Ga0495587_0073159 3300046536 Bacteria 1991
519 Ga0495598_0178293 3300046537 Bacteria 757
520 Ga0495645_0041306 3300046543 Bacteria 3363
521 Ga0495645_0078219 3300046543 Bacteria 2377
522 Ga0495633_0226968 3300046558 Bacteria 854
523 Ga0495656_0047488 3300046615 Bacteria 1821
524 Ga0495656_0392634 3300046615 Bacteria 725
525 Ga0495656_0816566 3300046615 Bacteria 504
526 Ga0495668_0082646 3300046616 Bacteria 1762
527 Ga0495668_0393221 3300046616 Bacteria 762
528 Ga0495668_0684422 3300046616 Bacteria 567
529 Ga0495634_0049361 3300046642 Bacteria 2830
530 Ga0495634_0501401 3300046642 Bacteria 711
531 Ga0495611_0117283 3300046648 Bacteria 1241
532 Ga0495635_0047715 3300046663 Bacteria 2953
533 Ga0495635_0060027 3300046663 Bacteria 2614
534 Ga0495657_0211953 3300046675 Bacteria 1177
535 Ga0495599_0053866 3300046678 Bacteria 2520
536 Ga0495599_0467627 3300046678 Bacteria 745
537 Ga0495623_0138417 3300046679 Bacteria 1451
538 Ga0495623_0142410 3300046679 Bacteria 1425
539 Ga0495623_0705596 3300046679 Bacteria 516
540 Ga0495646_0348738 3300046680 Bacteria 776
541 Ga0495647_0115238 3300046681 Bacteria 1125
542 Ga0495658_0012966 3300046683 Bacteria 4234
543 Ga0495658_0345252 3300046683 Bacteria 946
544 Ga0495669_0117053 3300046684 Bacteria 1247
545 Ga0495669_0200857 3300046684 Bacteria 953
546 Ga0495669_0401841 3300046684 Bacteria 664
547 Ga0495613_0183087 3300046689 Bacteria 1483
548 Ga0495624_0007585 3300046690 Bacteria 7615
549 Ga0495670_0357145 3300046691 Bacteria 787
550 Ga0495649_0452764 3300046694 Bacteria 641
551 Ga0495589_0206143 3300046794 Bacteria 927
552 Ga0495581_0377418 3300047315 Bacteria 827
553 Ga0495604_0086335 3300047317 Bacteria 2339
554 Ga0495674_0350771 3300047319 Bacteria 1198
555 Ga0495674_0383739 3300047319 Bacteria 1136
556 Ga0495674_0416094 3300047319 Bacteria 1083
557 Ga0495672_0522901 3300047320 Bacteria 524
558 Ga0495680_0037916 3300047322 Bacteria 3857
559 Ga0495687_012806 3300047443 Bacteria 4415
560 Ga0495675_0173910 3300047444 Bacteria 1321
561 Ga0495684_0134107 3300047471 Bacteria 1858
562 Ga0495684_0287903 3300047471 Bacteria 1183
563 Ga0495593_0046824 3300047673 Bacteria 2303
564 Ga0495593_0055402 3300047673 Bacteria 2087
565 Ga0495602_0075044 3300048088 Bacteria 2871
566 Ga0495602_0752118 3300048088 Bacteria 658
567 Ga0495602_0782372 3300048088 Bacteria 642
568 Ga0496100_0101859 3300048903 Bacteria 1980
569 Ga0496100_0329500 3300048903 Bacteria 1149
570 Ga0496100_0354138 3300048903 Bacteria 1109
571 Ga0496100_0938551 3300048903 Bacteria 680
572 Ga0496100_1044819 3300048903 Bacteria 643
573 Ga0496102_0018206 3300048905 Bacteria 6166
574 Ga0496102_0036660 3300048905 Bacteria 4419
575 Ga0496102_0126694 3300048905 Bacteria 2387
576 Ga0496102_0567353 3300048905 Bacteria 1058
577 Ga0496103_0010521 3300048906 Bacteria 5478
578 Ga0496103_0086441 3300048906 Bacteria 1976
579 Ga0496104_0045947 3300048907 Bacteria 4108
580 Ga0496104_0084218 3300048907 Bacteria 3034
581 Ga0496104_0121991 3300048907 Bacteria 2502
582 Ga0496105_0015008 3300048908 Bacteria 6164
583 Ga0496105_0022440 3300048908 Bacteria 5112
584 Ga0496106_0054459 3300048909 Bacteria 3022
585 Ga0496106_0450908 3300048909 Bacteria 1033
586 Ga0496107_0227333 3300048910 Bacteria 1388
587 Ga0496107_0559226 3300048910 Bacteria 847
588 Ga0496108_0030479 3300048911 Bacteria 4471
589 Ga0496108_0121648 3300048911 Bacteria 2239
590 Ga0496108_0227440 3300048911 Bacteria 1621
591 Ga0496109_0027009 3300048912 Bacteria 5121
592 Ga0496109_0275172 3300048912 Bacteria 1586
593 Ga0496110_0016079 3300048913 Bacteria 6239
594 Ga0496110_0057169 3300048913 Bacteria 3434
595 Ga0496111_0039170 3300048914 Bacteria 3397
596 Ga0496112_0003169 3300048915 Bacteria 13510
597 Ga0496112_0013997 3300048915 Bacteria 7424
598 Ga0496112_0045416 3300048915 Bacteria 4306
599 Ga0496112_0135497 3300048915 Bacteria 2433
600 Ga0496113_0202835 3300048916 Bacteria 1576
601 Ga0496114_0161838 3300048917 Bacteria 1947
602 Ga0496114_1401187 3300048917 Bacteria 586
603 Ga0496115_0006396 3300048918 Bacteria 8633
604 Ga0496115_0033146 3300048918 Bacteria 4077
605 Ga0496115_0753446 3300048918 Bacteria 761
606 Ga0496115_1063954 3300048918 Bacteria 615
607 Ga0496118_0072539 3300048921 Bacteria 2472
608 Ga0496119_0060376 3300048922 Bacteria 2270
609 Ga0496121_0092188 3300048924 Bacteria 2362
610 Ga0496121_0129785 3300048924 Bacteria 1889
611 Ga0496121_0314983 3300048924 Bacteria 1056
612 Ga0496122_0166835 3300048925 Bacteria 1334
613 Ga0496124_0130806 3300048927 Bacteria 1994
614 Ga0496124_0373591 3300048927 Bacteria 1000
615 Ga0496125_0105706 3300048928 Bacteria 2057
616 Ga0496125_0626174 3300048928 Bacteria 583
617 Ga0496126_0016471 3300048929 Bacteria 7390
618 Ga0496126_0033014 3300048929 Bacteria 4872
619 Ga0496126_0126655 3300048929 Bacteria 2210
620 Ga0496126_0297705 3300048929 Bacteria 1332
621 Ga0496126_0786128 3300048929 Bacteria 731
622 Ga0501037_0320298 3300049573 Bacteria 1074
623 Ga0501046_0118917 3300049580 Bacteria 2012
624 Ga0501047_0023628 3300049581 Bacteria 5901
625 Ga0501067_0069855 3300049583 Bacteria 1945
626 Ga0501067_0168436 3300049583 Bacteria 1220
627 Ga0501069_0090406 3300049585 Bacteria 1731
628 Ga0501070_0019443 3300049586 Bacteria 5696
629 Ga0501074_0024287 3300049590 Bacteria 4405
630 Ga0501079_0237961 3300049741 Bacteria 1422
631 Ga0501080_0006722 3300049742 Bacteria 10357
632 Ga0501044_0088479 3300049823 Bacteria 3126
633 nmdc:mga03683_218674_c1 3300050489 Bacteria 878
634 nmdc:mga03683_222902_c1 3300050489 Bacteria 870
635 nmdc:mga03n38_159574_c1 3300050490 Bacteria 1141
636 nmdc:mga03n38_53874_c1 3300050490 Bacteria 1806
637 nmdc:mga00v17_83139_c1 3300050491 Bacteria 2002
638 nmdc:mga0yw44_63220_c1 3300050492 Bacteria 2276
639 nmdc:mga0k408_12340_c1 3300050493 Bacteria 4669
640 nmdc:mga06z11_872119_c1 3300050494 Bacteria 548
641 nmdc:mga04h51_25929_c1 3300050495 Bacteria 1809
642 nmdc:mga07m45_298292_c1 3300050496 Bacteria 937
643 nmdc:mga07m45_49674_c1 3300050496 Bacteria 2362
644 nmdc:mga07m45_674671_c1 3300050496 Bacteria 595
645 nmdc:mga08y16_557699_c1 3300050511 Bacteria 1159
646 nmdc:mga0n895_76229_c1 3300050512 Bacteria 3334
647 nmdc:mga0rr50_124663_c1 3300050513 Bacteria 2055
648 nmdc:mga08x19_1288644_c1 3300050514 Bacteria 517
649 nmdc:mga08x19_549054_c1 3300050514 Bacteria 817
650 Ga0495601_0130849 3300053077 Bacteria 1634
651 Ga0495601_0249327 3300053077 Bacteria 1159
652 Ga0495601_0478421 3300053077 Bacteria 804
653 Ga0495612_0015446 3300053078 Bacteria 3062
654 Ga0495612_0183641 3300053078 Bacteria 919
655 Ga0495612_0594882 3300053078 Bacteria 511
656 Ga0500635_0026146 3300053080 Bacteria 1845
657 Ga0495655_0014172 3300053083 Bacteria 1667
658 Ga0495655_0293936 3300053083 Bacteria 557
659 Ga0495619_0689793 3300053085 Bacteria 695
660 Ga0500578_0621367 3300053086 Bacteria 591
661 Ga0500566_0239069 3300053094 Bacteria 891
662 Ga0500603_010118 3300053150 Bacteria 2122
663 Ga0500603_013490 3300053150 Bacteria 1895
664 Ga0500637_0064352 3300053178 Bacteria 2103
665 Ga0500656_012013 3300053732 Bacteria 972
666 Ga0530510_1000651 3300061734 Bacteria 640
667 Ga0530510_1195995 3300061734 Bacteria 583
668 Ga0495602_0946112
669 JGI24739J22299_10119372
670 JGI25406J46586_10000070
671 JGI25406J46586_10007363
672 JGI25153J46596_10011885
673 rootL2_10063827
674 rootL2_10080860
675 rootH1_10168448
676 JGI25404J52841_10024281
677 JGI25404J52841_10038539
678 Ga0065715_10259137
679 Ga0070658_10060332
680 Ga0070683_100007111
681 Ga0070683_101574111
682 Ga0070670_101311100
683 Ga0068869_100234632
684 Ga0070666_10598102
685 Ga0070666_11423637
686 Ga0070680_100009263
687 Ga0070680_100080627
688 Ga0070680_100212985
689 Ga0070680_100243849
690 Ga0070680_100606523
691 Ga0070680_101853623
692 Ga0070682_100021597
693 Ga0070682_100112386
694 Ga0070682_101842100
695 Ga0068868_100029751
696 Ga0068868_100185571
697 Ga0068868_100673900
698 Ga0068868_101807054
699 Ga0070660_100012305
700 Ga0070660_100265234
701 Ga0070660_100736066
702 Ga0070660_100943657
703 Ga0070691_10743428
704 Ga0070661_100668570
705 Ga0070661_100769732
706 Ga0070668_100082789
707 Ga0070668_100760057
708 Ga0070668_101157194
709 Ga0070671_100012940
710 Ga0070671_100253825
711 Ga0070674_100031516
712 Ga0070674_100382311
713 Ga0070674_101396455
714 Ga0070674_101570727
715 Ga0070673_100167771
716 Ga0070673_100291603
717 Ga0070673_100609286
718 Ga0070659_101009731
719 Ga0070709_10005193
720 Ga0070709_10008083
721 Ga0070709_10012672
722 Ga0070709_10347816
723 Ga0070709_11437765
724 Ga0070714_100004264
725 Ga0070714_100046038
726 Ga0070714_100057490
727 Ga0070714_100194684
728 Ga0070713_100002430
729 Ga0070713_100054098
730 Ga0070713_100112874
731 Ga0070713_100216552
732 Ga0070713_100348408
733 Ga0070713_100387848
734 Ga0070710_10001162
735 Ga0070710_10001905
736 Ga0070710_10014272
737 Ga0070710_10555049
738 Ga0070711_100001657
739 Ga0070711_100102314
740 Ga0070711_100111388
741 Ga0070711_100144564
742 Ga0070711_100244751
743 Ga0070711_100754766
744 Ga0070711_100875060
745 Ga0070705_100442242
746 Ga0070700_101573584
747 Ga0070663_100050500
748 Ga0070663_100060347
749 Ga0070663_100242508
750 Ga0070663_100563980
751 Ga0070678_100009855
752 Ga0070678_100305849
753 Ga0070662_100333550
754 Ga0070681_10013524
755 Ga0070681_10031130
756 Ga0070681_10036529
757 Ga0070681_10045367
758 Ga0070681_10319064
759 Ga0070681_10347956
760 Ga0068867_101285470
761 Ga0070679_100025706
762 Ga0070679_100157259
763 Ga0070679_100310289
764 Ga0070679_100321207
765 Ga0070679_101415599
766 Ga0070684_100002967
767 Ga0070684_100018135
768 Ga0070684_100192396
769 Ga0070684_102245289
770 Ga0068853_100007871
771 Ga0068853_100179788
772 Ga0068853_100186538
773 Ga0068853_100312636
774 Ga0070672_100238944
775 Ga0070672_100436978
776 Ga0070686_100453103
777 Ga0070696_100302873
778 Ga0070693_100097628
779 Ga0070693_100578453
780 Ga0070665_100060805
781 Ga0070665_100098860
782 Ga0070665_100227651
783 Ga0070665_101683513
784 Ga0068855_100068264
785 Ga0068855_100116894
786 Ga0068855_100263113
787 Ga0068855_100270497
788 Ga0068855_101291775
789 Ga0070664_102211649
790 Ga0068857_100016728
791 Ga0068857_100133965
792 Ga0068857_100194164
793 Ga0068857_101137817
794 Ga0068854_100201393
795 Ga0068854_100465816
796 Ga0068854_101530827
797 Ga0068856_100000206
798 Ga0068856_100059030
799 Ga0068856_100161705
800 Ga0068856_101195143
801 Ga0070702_100644687
802 Ga0068852_100590724
803 Ga0068852_101102977
804 Ga0068852_101838811
805 Ga0068852_101868710
806 Ga0068864_100092049
807 Ga0068864_100172287
808 Ga0068861_100141141
809 Ga0068861_100328286
810 Ga0068863_100378669
811 Ga0068858_102075014
812 Ga0068862_100675133
813 Ga0081455_10009281
814 Ga0081455_10029702
815 Ga0081455_10032712
816 Ga0081540_1004794
817 Ga0081540_1004926
818 Ga0081540_1019543
819 Ga0081540_1026736
820 Ga0081540_1089067
821 Ga0081539_10000250
822 Ga0081539_10000269
823 Ga0070717_10166382
824 Ga0070717_10462095
825 Ga0070717_10531086
826 Ga0070717_12088442
827 Ga0075365_10142388
828 Ga0075365_10143927
829 Ga0075368_10000872
830 Ga0075363_100045604
831 Ga0070715_10000380
832 Ga0070715_10594503
833 Ga0070716_100001573
834 Ga0070716_100006338
835 Ga0070716_100108961
836 Ga0070716_100121137
837 Ga0070716_100860027
838 Ga0070712_100064121
839 Ga0070712_100081277
840 Ga0070712_100101802
841 Ga0070712_100364613
842 Ga0075362_10358562
843 Ga0075367_10142957
844 Ga0075369_10110312
845 Ga0075366_10032477
846 Ga0097621_100190770
847 Ga0097621_100993411
848 Ga0075370_10031584
849 Ga0075370_10248278
850 Ga0068871_100059511
851 Ga0068871_101251611
852 Ga0075428_100809483
853 Ga0075434_100102289
854 Ga0068865_101998907
855 Ga0075435_100278089
856 Ga0099795_10022093
857 Ga0105250_10189532
858 Ga0105240_10051150
859 Ga0105240_10112558
860 Ga0105240_10240744
861 Ga0111539_10153547
862 Ga0111539_11603346
863 Ga0105245_10017389
864 Ga0105245_12188693
865 Ga0105247_10286199
866 Ga0105247_10312066
867 Ga0105247_10363650
868 Ga0114129_13052041
869 Ga0105243_10413284
870 Ga0105243_10626434
871 Ga0105243_12217192
872 Ga0105241_10698117
873 Ga0105241_10802861
874 Ga0105241_12576868
875 Ga0105242_10637251
876 Ga0105242_12596644
877 Ga0105242_13157167
878 Ga0105248_10132660
879 Ga0105248_10259375
880 Ga0105248_10409230
881 Ga0105248_10756810
882 Ga0105237_10240037
883 Ga0105237_10504180
884 Ga0105237_10631729
885 Ga0105237_10824583
886 Ga0105237_11536315
887 Ga0105237_11636887
888 Ga0105238_10017117
889 Ga0105238_10155671
890 Ga0105238_10511777
891 Ga0105238_10920438
892 Ga0105238_10927806
893 Ga0105238_11264448
894 Ga0105238_11438283
895 Ga0105249_10078047
896 Ga0105249_10862154
897 Ga0099796_10011904
898 Ga0105239_10192647
899 Ga0105239_10194966
900 Ga0105239_10224669
901 Ga0105239_10248574
902 Ga0105239_10363206
903 Ga0105239_10393826
904 Ga0105246_10099947
905 Ga0105246_10588822
906 Ga0105246_12377237
907 Ga0157338_1057347
908 Ga0157370_10100545
909 Ga0157370_10123516
910 Ga0157370_10227945
911 Ga0157370_10688321
912 Ga0157369_10019069
913 Ga0157369_10082565
914 Ga0157369_10285189
915 Ga0157369_11146239
916 Ga0157374_10175590
917 Ga0157374_10603985
918 Ga0157378_12635823
919 Ga0157378_12718709
920 Ga0163162_10029891
921 Ga0163162_10039165
922 Ga0163162_10374159
923 Ga0163162_10628459
924 Ga0157372_10116199
925 Ga0157372_10224132
926 Ga0157372_10631149
927 Ga0157375_10535645
928 Ga0157375_11780676
929 Ga0157375_13059708
930 Ga0163163_10018251
931 Ga0163163_10118688
932 Ga0163163_10180822
933 Ga0157380_10204169
934 Ga0157380_10582089
935 Ga0157380_10637625
936 Ga0157380_10793139
937 Ga0157380_10843869
938 Ga0157377_10541501
939 Ga0157379_10108391
940 Ga0157379_10268179
941 Ga0157379_10418075
942 Ga0157379_11236898
943 Ga0157379_11268465
944 Ga0157376_10060648
945 Ga0157376_10208515
946 Ga0157376_10272855
947 Ga0163161_11209867
948 Ga0213875_10061024
949 Ga0209758_1013601
950 Ga0207692_10004221
951 Ga0207642_10411537
952 Ga0207710_10158108
953 Ga0207688_10437797
954 Ga0207680_10247866
955 Ga0207680_10271816
956 Ga0207647_10002405
957 Ga0207685_10088083
958 Ga0207699_10005494
959 Ga0207699_10014797
960 Ga0207699_10348101
961 Ga0207699_10922439
962 Ga0207705_11342551
963 Ga0207705_11362738
964 Ga0207684_10051772
965 Ga0207684_10773239
966 Ga0207654_10108080
967 Ga0207707_10000811
968 Ga0207707_10009415
969 Ga0207707_10065238
970 Ga0207707_10136748
971 Ga0207707_10503564
972 Ga0207707_10905232
973 Ga0207695_10028180
974 Ga0207695_10209077
975 Ga0207695_10314929
976 Ga0207671_10334433
977 Ga0207671_10370029
978 Ga0207671_10614501
979 Ga0207671_11039137
980 Ga0207693_10000941
981 Ga0207693_10028476
982 Ga0207693_10123355
983 Ga0207663_10000377
984 Ga0207663_10087292
985 Ga0207663_10153260
986 Ga0207663_10168847
987 Ga0207663_10714742
988 Ga0207663_10823181
989 Ga0207663_10892140
990 Ga0207660_10034871
991 Ga0207657_10003989
992 Ga0207657_10723340
993 Ga0207657_10882365
994 Ga0207652_10012855
995 Ga0207652_10025754
996 Ga0207652_10028346
997 Ga0207652_10929128
998 Ga0207681_10711186
999 Ga0207694_10041206
1000 Ga0207694_10047652
1001 Ga0207694_10296959
1002 Ga0207694_10340238
1003 Ga0207650_10389146
1004 Ga0207650_10903585
1005 Ga0207659_10371545
1006 Ga0207687_10081124
1007 Ga0207687_10419965
1008 Ga0207700_10017487
1009 Ga0207700_10178456
1010 Ga0207700_10229427
1011 Ga0207700_10239254
1012 Ga0207700_10326700
1013 Ga0207700_10705860
1014 Ga0207664_10039762
1015 Ga0207664_10325932
1016 Ga0207664_10449353
1017 Ga0207664_10465804
1018 Ga0207644_10222443
1019 Ga0207690_10109429
1020 Ga0207706_10370441
1021 Ga0207709_10014780
1022 Ga0207669_11239698
1023 Ga0207704_10365549
1024 Ga0207704_10445258
1025 Ga0207704_10629645
1026 Ga0207665_10000175
1027 Ga0207665_10011239
1028 Ga0207665_10132023
1029 Ga0207665_10159347
1030 Ga0207691_10197004
1031 Ga0207691_10412379
1032 Ga0207711_10136012
1033 Ga0207711_10173476
1034 Ga0207689_10343812
1035 Ga0207689_11314663
1036 Ga0207661_10146204
1037 Ga0207679_10453964
1038 Ga0207667_10045088
1039 Ga0207667_10105498
1040 Ga0207667_10626624
1041 Ga0207651_10113676
1042 Ga0207651_10265610
1043 Ga0207712_10087687
1044 Ga0207668_10076630
1045 Ga0207668_10936013
1046 Ga0207640_10274662
1047 Ga0207640_10290644
1048 Ga0207640_10461480
1049 Ga0207677_10077800
1050 Ga0207677_10521676
1051 Ga0207703_11250110
1052 Ga0207703_11515542
1053 Ga0207639_10005362
1054 Ga0207639_10132049
1055 Ga0207678_10039371
1056 Ga0207678_10054458
1057 Ga0207678_10129834
1058 Ga0207678_10249902
1059 Ga0207678_10368037
1060 Ga0207702_10000075
1061 Ga0207702_10105796
1062 Ga0207702_11351763
1063 Ga0207641_10656984
1064 Ga0207648_10040321
1065 Ga0207676_10076353
1066 Ga0207674_10024558
1067 Ga0207674_10060529
1068 Ga0207674_10215218
1069 Ga0207674_10497062
1070 Ga0207675_100100936
1071 Ga0207675_100270817
1072 Ga0207675_101428565
1073 Ga0207683_10019107
1074 Ga0207683_10242248
1075 Ga0207698_10306851
1076 Ga0207698_10550747
1077 Ga0209588_1070051
1078 Ga0209813_10090174
1079 Ga0207428_10080622
1080 Ga0268266_10028431
1081 Ga0268266_10055438
1082 Ga0268266_10213170
1083 Ga0268266_11476474
1084 Ga0268266_11643084
1085 Ga0268265_10434027
1086 Ga0268265_10666653
1087 Ga0307515_10251299
1088 Ga0265762_1156078
1089 Ga0265770_1150115
1090 Ga0265332_10244876
1091 Ga0265339_10022463
1092 Ga0307513_10301457
1093 Ga0307408_100253444
1094 Ga0265342_10139956
1095 Ga0307516_10806824
1096 Ga0307406_11519571
1097 Ga0307412_10216717
1098 Ga0307415_101173700
1099 Ga0373959_0213074
1100 Ga0373938_0253687
1101 Ga0373928_0143392
1102 Ga0373934_0062245
1103 Ga0373934_0129502
1104 Ga0373944_0262206
1105 Ga0373923_0079717
1106 Ga0373936_0061464
1107 Ga0373936_0379531
1108 Ga0373953_0272717
1109 Ga0373953_0435912
1110 Ga0373954_0474329
1111 Ga0373954_0560107
1112 Ga0373956_0065603
1113 Ga0373957_0443319
1114 Ga0373943_0039448
1115 Ga0373946_0042530
1116 Ga0373955_0034691
1117 Ga0373955_0145838
1118 Ga0373924_0154898
1119 Ga0373924_0222784
1120 Ga0373931_0109341
1121 Ga0373931_0166718
1122 Ga0373935_0109796
1123 Ga0373935_0457001
1124 Ga0373927_0006772
1125 Ga0373927_0027610
1126 Ga0373933_0064857
1127 Ga0373933_0114848
1128 Ga0373933_0631711
1129 Ga0373947_0023422
1130 Ga0373947_0290042
1131 Ga0373937_0056118
1132 Ga0373937_0204357
1133 Ga0373925_0107124
1134 Ga0373925_0464675
1135 Ga0395900_0000502
1136 Ga0395898_0132949
1137 Ga0395905_0484648
1138 Ga0436364_0607142
1139 Ga0436364_0897060
1140 Ga0395901_0012010
1141 Ga0436365_1727211
1142 Ga0451797_1269366
1143 Ga0451798_0202254
1144 Ga0451853_2354594
1145 Ga0466969_0201326
1146 Ga0466963_0169697
1147 Ga0466967_0180388
1148 Ga0466967_0374196
1149 Ga0495592_0086856
1150 Ga0495592_0106482
1151 Ga0495603_0050884
1152 Ga0495603_0055374
1153 Ga0495629_0057901
1154 Ga0495629_0789470
1155 Ga0495638_0136797
1156 Ga0495653_0060529
1157 Ga0495580_0037507
1158 Ga0495580_0171803
1159 Ga0495605_0401024
1160 Ga0495639_0144095
1161 Ga0495639_0486293
1162 Ga0495662_0102921
1163 Ga0495662_0581461
1164 Ga0495664_0049056
1165 Ga0495664_0469993
1166 Ga0495594_0489557
1167 Ga0495608_0015738
1168 Ga0495608_0068343
1169 Ga0495616_0465403
1170 Ga0495618_0243082
1171 Ga0495628_0148808
1172 Ga0495628_0198322
1173 Ga0495630_0050640
1174 Ga0495630_0167565
1175 Ga0495632_0181667
1176 Ga0495632_0347913
1177 Ga0495644_0375572
1178 Ga0495663_0087101
1179 Ga0495642_0319007
1180 Ga0495652_0074715
1181 Ga0495652_0154777
1182 Ga0495665_0038042
1183 Ga0495640_0024049
1184 Ga0495640_0083202
1185 Ga0495587_0073159
1186 Ga0495598_0178293
1187 Ga0495645_0041306
1188 Ga0495645_0078219
1189 Ga0495633_0226968
1190 Ga0495656_0047488
1191 Ga0495656_0392634
1192 Ga0495656_0816566
1193 Ga0495668_0082646
1194 Ga0495668_0393221
1195 Ga0495668_0684422
1196 Ga0495634_0049361
1197 Ga0495634_0501401
1198 Ga0495611_0117283
1199 Ga0495635_0047715
1200 Ga0495635_0060027
1201 Ga0495657_0211953
1202 Ga0495599_0053866
1203 Ga0495599_0467627
1204 Ga0495623_0138417
1205 Ga0495623_0142410
1206 Ga0495623_0705596
1207 Ga0495646_0348738
1208 Ga0495647_0115238
1209 Ga0495658_0012966
1210 Ga0495658_0345252
1211 Ga0495669_0117053
1212 Ga0495669_0200857
1213 Ga0495669_0401841
1214 Ga0495613_0183087
1215 Ga0495624_0007585
1216 Ga0495670_0357145
1217 Ga0495649_0452764
1218 Ga0495589_0206143
1219 Ga0495581_0377418
1220 Ga0495604_0086335
1221 Ga0495674_0350771
1222 Ga0495674_0383739
1223 Ga0495674_0416094
1224 Ga0495672_0522901
1225 Ga0495680_0037916
1226 Ga0495687_012806
1227 Ga0495675_0173910
1228 Ga0495684_0134107
1229 Ga0495684_0287903
1230 Ga0495593_0046824
1231 Ga0495593_0055402
1232 Ga0495602_0075044
1233 Ga0495602_0752118
1234 Ga0495602_0782372
1235 Ga0496100_0101859
1236 Ga0496100_0329500
1237 Ga0496100_0354138
1238 Ga0496100_0938551
1239 Ga0496100_1044819
1240 Ga0496102_0018206
1241 Ga0496102_0036660
1242 Ga0496102_0126694
1243 Ga0496102_0567353
1244 Ga0496103_0010521
1245 Ga0496103_0086441
1246 Ga0496104_0045947
1247 Ga0496104_0084218
1248 Ga0496104_0121991
1249 Ga0496105_0015008
1250 Ga0496105_0022440
1251 Ga0496106_0054459
1252 Ga0496106_0450908
1253 Ga0496107_0227333
1254 Ga0496107_0559226
1255 Ga0496108_0030479
1256 Ga0496108_0121648
1257 Ga0496108_0227440
1258 Ga0496109_0027009
1259 Ga0496109_0275172
1260 Ga0496110_0016079
1261 Ga0496110_0057169
1262 Ga0496111_0039170
1263 Ga0496112_0003169
1264 Ga0496112_0013997
1265 Ga0496112_0045416
1266 Ga0496112_0135497
1267 Ga0496113_0202835
1268 Ga0496114_0161838
1269 Ga0496114_1401187
1270 Ga0496115_0006396
1271 Ga0496115_0033146
1272 Ga0496115_0753446
1273 Ga0496115_1063954
1274 Ga0496118_0072539
1275 Ga0496119_0060376
1276 Ga0496121_0092188
1277 Ga0496121_0129785
1278 Ga0496121_0314983
1279 Ga0496122_0166835
1280 Ga0496124_0130806
1281 Ga0496124_0373591
1282 Ga0496125_0105706
1283 Ga0496125_0626174
1284 Ga0496126_0016471
1285 Ga0496126_0033014
1286 Ga0496126_0126655
1287 Ga0496126_0297705
1288 Ga0496126_0786128
1289 Ga0501037_0320298
1290 Ga0501046_0118917
1291 Ga0501047_0023628
1292 Ga0501067_0069855
1293 Ga0501067_0168436
1294 Ga0501069_0090406
1295 Ga0501070_0019443
1296 Ga0501074_0024287
1297 Ga0501079_0237961
1298 Ga0501080_0006722
1299 Ga0501044_0088479
1300 nmdc:mga03683_218674_c1
1301 nmdc:mga03683_222902_c1
1302 nmdc:mga03n38_159574_c1
1303 nmdc:mga03n38_53874_c1
1304 nmdc:mga00v17_83139_c1
1305 nmdc:mga0yw44_63220_c1
1306 nmdc:mga0k408_12340_c1
1307 nmdc:mga06z11_872119_c1
1308 nmdc:mga04h51_25929_c1
1309 nmdc:mga07m45_298292_c1
1310 nmdc:mga07m45_49674_c1
1311 nmdc:mga07m45_674671_c1
1312 nmdc:mga08y16_557699_c1
1313 nmdc:mga0n895_76229_c1
1314 nmdc:mga0rr50_124663_c1
1315 nmdc:mga08x19_1288644_c1
1316 nmdc:mga08x19_549054_c1
1317 Ga0495601_0130849
1318 Ga0495601_0249327
1319 Ga0495601_0478421
1320 Ga0495612_0015446
1321 Ga0495612_0183641
1322 Ga0495612_0594882
1323 Ga0500635_0026146
1324 Ga0495655_0014172
1325 Ga0495655_0293936
1326 Ga0495619_0689793
1327 Ga0500578_0621367
1328 Ga0500566_0239069
1329 Ga0500603_010118
1330 Ga0500603_013490
1331 Ga0500637_0064352
1332 Ga0500656_012013
1333 Ga0530510_1000651
1334 Ga0530510_1195995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map