F473861

General Info

Members Datasets Scaffolds Average Seq Length
667 277 1334 97

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0249017|Ga0495635_0249017_541_834
Length 97
Sequence MAEQRSGGGRPIAASQRPTGGDKAMGKKQYFRRKKMCRFCVEDINYNDVRLLSSFLSERGKITPRRISGVCAPHQRRLAESIKQARNIALITFTTTL

Samples

Sample ID Description Type Environment
1 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 2.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.25
Rhizosphere 84.41
Stem 0
Stem Tuber 0
Unclassified 35.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495635_0249017 3300046663 Unclassified 1198
2 Ga0058862_12769342 3300004803 Bacteria 1141
3 Ga0058862_12846478 3300004803 Unclassified 2041
4 Ga0070658_10426613 3300005327 Unclassified 1141
5 Ga0070683_100066846 3300005329 Bacteria 3348
6 Ga0070683_100211480 3300005329 Unclassified 1842
7 Ga0070683_100409748 3300005329 Bacteria 1293
8 Ga0070683_101299812 3300005329 Bacteria 699
9 Ga0068869_101863800 3300005334 Unclassified 538
10 Ga0070680_100053548 3300005336 Bacteria 3294
11 Ga0070680_100183589 3300005336 Bacteria 1762
12 Ga0070682_100274201 3300005337 Bacteria 1227
13 Ga0070682_100492566 3300005337 Unclassified 948
14 Ga0068868_100072786 3300005338 Bacteria 2742
15 Ga0068868_100275045 3300005338 Bacteria 1424
16 Ga0068868_101106442 3300005338 Bacteria 729
17 Ga0070660_100576321 3300005339 Bacteria 940
18 Ga0070689_100084030 3300005340 Bacteria 2502
19 Ga0070689_100419069 3300005340 Bacteria 1134
20 Ga0070689_100632964 3300005340 Bacteria 929
21 Ga0070692_10041886 3300005345 Bacteria 2348
22 Ga0070671_100197579 3300005355 Bacteria 1705
23 Ga0070671_101445990 3300005355 Unclassified 608
24 Ga0070671_101510729 3300005355 Unclassified 594
25 Ga0070673_102403685 3300005364 Unclassified 501
26 Ga0070659_100081584 3300005366 Bacteria 2583
27 Ga0070659_100446865 3300005366 Bacteria 1096
28 Ga0070659_100514863 3300005366 Bacteria 1021
29 Ga0070667_100049395 3300005367 Bacteria 3543
30 Ga0070667_100434375 3300005367 Bacteria 1198
31 Ga0070709_10620024 3300005434 Bacteria 835
32 Ga0070709_11087026 3300005434 Bacteria 639
33 Ga0070709_11783760 3300005434 Bacteria 503
34 Ga0070714_100067282 3300005435 Bacteria 3088
35 Ga0070714_100141607 3300005435 Bacteria 2160
36 Ga0070714_100207552 3300005435 Bacteria 1794
37 Ga0070714_100573498 3300005435 Bacteria 1082
38 Ga0070714_100849504 3300005435 Bacteria 885
39 Ga0070713_100121100 3300005436 Unclassified 2295
40 Ga0070713_100334976 3300005436 Unclassified 1401
41 Ga0070713_101115001 3300005436 Bacteria 763
42 Ga0070713_101705765 3300005436 Bacteria 611
43 Ga0070710_10238260 3300005437 Unclassified 1164
44 Ga0070701_10170856 3300005438 Bacteria 1266
45 Ga0070711_100212198 3300005439 Bacteria 1500
46 Ga0070711_101304529 3300005439 Bacteria 630
47 Ga0070705_100276861 3300005440 Unclassified 1191
48 Ga0070700_100967684 3300005441 Unclassified 698
49 Ga0070694_100384147 3300005444 Unclassified 1096
50 Ga0070708_100055671 3300005445 Bacteria 3517
51 Ga0070663_100033590 3300005455 Bacteria 3545
52 Ga0070663_100395683 3300005455 Unclassified 1128
53 Ga0070663_100694832 3300005455 Bacteria 864
54 Ga0070663_101151367 3300005455 Unclassified 680
55 Ga0070678_100046139 3300005456 Bacteria 3122
56 Ga0070662_100249098 3300005457 Bacteria 1427
57 Ga0070681_10046052 3300005458 Bacteria 4362
58 Ga0070681_10119474 3300005458 Bacteria 2572
59 Ga0070681_10127221 3300005458 Bacteria 2481
60 Ga0070681_10742757 3300005458 Bacteria 898
61 Ga0070706_100152926 3300005467 Unclassified 2154
62 Ga0070706_101296077 3300005467 Unclassified 668
63 Ga0070699_100033580 3300005518 Bacteria 4432
64 Ga0070699_101233864 3300005518 Bacteria 686
65 Ga0070679_100049582 3300005530 Bacteria 4181
66 Ga0070679_100399292 3300005530 Unclassified 1321
67 Ga0070679_100437992 3300005530 Bacteria 1252
68 Ga0070679_100467399 3300005530 Unclassified 1206
69 Ga0070679_100660922 3300005530 Bacteria 988
70 Ga0070679_100955283 3300005530 Unclassified 801
71 Ga0070684_100207530 3300005535 Bacteria 1785
72 Ga0070684_100284655 3300005535 Bacteria 1515
73 Ga0070697_100000266 3300005536 Bacteria 42492
74 Ga0070697_100016981 3300005536 Bacteria 5722
75 Ga0070697_100408550 3300005536 Bacteria 1179
76 Ga0068853_100041185 3300005539 Bacteria 3944
77 Ga0068853_100229656 3300005539 Bacteria 1697
78 Ga0068853_100510593 3300005539 Unclassified 1135
79 Ga0068853_101618226 3300005539 Bacteria 628
80 Ga0068853_102106453 3300005539 Bacteria 547
81 Ga0070672_100923081 3300005543 Unclassified 772
82 Ga0070695_100025319 3300005545 Bacteria 3663
83 Ga0070695_100417563 3300005545 Bacteria 1021
84 Ga0070696_100094269 3300005546 Unclassified 2136
85 Ga0070696_100586584 3300005546 Bacteria 897
86 Ga0070693_100143738 3300005547 Bacteria 1504
87 Ga0070665_100318952 3300005548 Bacteria 1558
88 Ga0070665_100446507 3300005548 Bacteria 1303
89 Ga0070665_102597989 3300005548 Unclassified 507
90 Ga0070704_100603799 3300005549 Unclassified 965
91 Ga0070704_100939558 3300005549 Bacteria 779
92 Ga0070704_101836865 3300005549 Unclassified 561
93 Ga0068855_100087433 3300005563 Bacteria 3602
94 Ga0068855_100155965 3300005563 Bacteria 2594
95 Ga0068855_100258887 3300005563 Bacteria 1939
96 Ga0068855_100315592 3300005563 Bacteria 1729
97 Ga0068855_101190303 3300005563 Unclassified 793
98 Ga0070664_100351996 3300005564 Bacteria 1340
99 Ga0068857_101940943 3300005577 Bacteria 577
100 Ga0068854_100043691 3300005578 Bacteria 3178
101 Ga0068854_100104793 3300005578 Bacteria 2125
102 Ga0068854_100238966 3300005578 Unclassified 1446
103 Ga0068854_100287448 3300005578 Bacteria 1326
104 Ga0068854_100749780 3300005578 Unclassified 847
105 Ga0068856_100024981 3300005614 Bacteria 5823
106 Ga0068856_100248374 3300005614 Bacteria 1794
107 Ga0068856_100540882 3300005614 Unclassified 1186
108 Ga0068856_100684407 3300005614 Unclassified 1046
109 Ga0068856_100704711 3300005614 Unclassified 1030
110 Ga0070702_100636664 3300005615 Bacteria 804
111 Ga0068852_100298539 3300005616 Unclassified 1558
112 Ga0068852_100760022 3300005616 Bacteria 982
113 Ga0068859_100527611 3300005617 Bacteria 1275
114 Ga0068859_101521524 3300005617 Bacteria 739
115 Ga0068864_100322714 3300005618 Bacteria 1451
116 Ga0068864_101964353 3300005618 Unclassified 591
117 Ga0068863_100050637 3300005841 Bacteria 3936
118 Ga0068863_100460622 3300005841 Bacteria 1249
119 Ga0068863_100584215 3300005841 Bacteria 1105
120 Ga0068863_101633693 3300005841 Bacteria 654
121 Ga0068863_101682735 3300005841 Unclassified 644
122 Ga0068858_100030314 3300005842 Bacteria 5022
123 Ga0068858_100273219 3300005842 Bacteria 1608
124 Ga0068858_101628300 3300005842 Unclassified 637
125 Ga0068860_100324231 3300005843 Unclassified 1512
126 Ga0068860_100899063 3300005843 Bacteria 901
127 Ga0068862_100901398 3300005844 Bacteria 869
128 Ga0081455_10004184 3300005937 Bacteria 16266
129 Ga0070717_10068012 3300006028 Unclassified 2965
130 Ga0070717_10481493 3300006028 Unclassified 1121
131 Ga0070717_11593265 3300006028 Bacteria 592
132 Ga0070715_10335111 3300006163 Unclassified 821
133 Ga0070712_100075878 3300006175 Bacteria 2419
134 Ga0070712_100235822 3300006175 Unclassified 1455
135 Ga0070712_101042394 3300006175 Unclassified 709
136 Ga0097621_100007315 3300006237 Bacteria 7890
137 Ga0097621_100682690 3300006237 Bacteria 944
138 Ga0097621_100724618 3300006237 Bacteria 917
139 Ga0068871_100227225 3300006358 Bacteria 1619
140 Ga0075430_100297808 3300006846 Bacteria 1334
141 Ga0075430_100509003 3300006846 Bacteria 994
142 Ga0075431_100042438 3300006847 Bacteria 4692
143 Ga0075431_100085458 3300006847 Bacteria 3256
144 Ga0075433_10000203 3300006852 Bacteria 33282
145 Ga0075434_100000016 3300006871 Bacteria 75294
146 Ga0075434_101146878 3300006871 Bacteria 790
147 Ga0075429_100398463 3300006880 Bacteria 1205
148 Ga0075429_100542347 3300006880 Unclassified 1019
149 Ga0075436_100000459 3300006914 Bacteria 26338
150 Ga0075436_100002867 3300006914 Bacteria 11813
151 Ga0075436_100194387 3300006914 Unclassified 1436
152 Ga0075436_101155473 3300006914 Unclassified 584
153 Ga0097620_100527607 3300006931 Bacteria 1275
154 Ga0097620_101521486 3300006931 Bacteria 739
155 Ga0075435_100000506 3300007076 Bacteria 23788
156 Ga0075435_100635593 3300007076 Unclassified 926
157 Ga0105240_10002088 3300009093 Bacteria 32712
158 Ga0105240_10149958 3300009093 Bacteria 2778
159 Ga0105245_10450640 3300009098 Bacteria 1295
160 Ga0105245_11708203 3300009098 Unclassified 682
161 Ga0105245_12682055 3300009098 Bacteria 551
162 Ga0114129_10759829 3300009147 Bacteria 1240
163 Ga0105243_10145398 3300009148 Bacteria 2028
164 Ga0105243_11715446 3300009148 Unclassified 657
165 Ga0105241_10106337 3300009174 Bacteria 2239
166 Ga0105241_10187817 3300009174 Unclassified 1718
167 Ga0105241_10741515 3300009174 Unclassified 900
168 Ga0105241_11063385 3300009174 Unclassified 760
169 Ga0105242_10646886 3300009176 Bacteria 1028
170 Ga0105248_10077157 3300009177 Unclassified 3745
171 Ga0105248_10169672 3300009177 Bacteria 2459
172 Ga0105248_10474731 3300009177 Bacteria 1410
173 Ga0105248_10628412 3300009177 Bacteria 1212
174 Ga0105248_10795101 3300009177 Bacteria 1068
175 Ga0105248_11199708 3300009177 Unclassified 858
176 Ga0105248_11218921 3300009177 Bacteria 851
177 Ga0105248_11592660 3300009177 Unclassified 740
178 Ga0105248_12394612 3300009177 Bacteria 601
179 Ga0105237_10015531 3300009545 Bacteria 7921
180 Ga0105237_10030803 3300009545 Bacteria 5445
181 Ga0105237_11056578 3300009545 Unclassified 819
182 Ga0105237_12662997 3300009545 Bacteria 511
183 Ga0105238_10033919 3300009551 Bacteria 5194
184 Ga0105238_10452275 3300009551 Bacteria 1281
185 Ga0105238_10744848 3300009551 Bacteria 993
186 Ga0105238_11412438 3300009551 Unclassified 723
187 Ga0105239_10170611 3300010375 Unclassified 2433
188 Ga0105239_10534812 3300010375 Bacteria 1334
189 Ga0105246_10319173 3300011119 Bacteria 1262
190 Ga0157373_10147182 3300013100 Bacteria 1657
191 Ga0157371_10029385 3300013102 Bacteria 3976
192 Ga0157371_10157061 3300013102 Bacteria 1624
193 Ga0157371_11353919 3300013102 Bacteria 552
194 Ga0157370_10041967 3300013104 Bacteria 4410
195 Ga0157370_10226486 3300013104 Bacteria 1731
196 Ga0157370_10367084 3300013104 Bacteria 1326
197 Ga0157370_11105634 3300013104 Unclassified 716
198 Ga0157369_10009232 3300013105 Bacteria 11281
199 Ga0157369_10068636 3300013105 Bacteria 3809
200 Ga0157369_10154328 3300013105 Bacteria 2426
201 Ga0157369_10224820 3300013105 Unclassified 1964
202 Ga0157369_10255562 3300013105 Bacteria 1828
203 Ga0157369_10274695 3300013105 Unclassified 1755
204 Ga0157369_10564127 3300013105 Bacteria 1176
205 Ga0157369_10970255 3300013105 Unclassified 871
206 Ga0157369_11823365 3300013105 Unclassified 618
207 Ga0157369_12409023 3300013105 Unclassified 533
208 Ga0157374_10013550 3300013296 Bacteria 7119
209 Ga0157374_10030856 3300013296 Bacteria 4868
210 Ga0157374_10077725 3300013296 Unclassified 3141
211 Ga0157374_10239007 3300013296 Bacteria 1786
212 Ga0157378_10760313 3300013297 Bacteria 992
213 Ga0163162_10573224 3300013306 Bacteria 1256
214 Ga0163162_11053105 3300013306 Bacteria 921
215 Ga0163162_13424265 3300013306 Unclassified 506
216 Ga0157372_10128287 3300013307 Bacteria 2917
217 Ga0157372_10878519 3300013307 Bacteria 1040
218 Ga0157372_12844629 3300013307 Bacteria 555
219 Ga0157375_10775236 3300013308 Unclassified 1109
220 Ga0163163_10067044 3300014325 Bacteria 3567
221 Ga0163163_10219870 3300014325 Bacteria 1948
222 Ga0163163_10735028 3300014325 Bacteria 1050
223 Ga0163163_10781443 3300014325 Bacteria 1018
224 Ga0163163_12905139 3300014325 Bacteria 535
225 Ga0157380_12486401 3300014326 Bacteria 583
226 Ga0157377_10687905 3300014745 Bacteria 741
227 Ga0157377_10838956 3300014745 Bacteria 681
228 Ga0157377_11240071 3300014745 Unclassified 579
229 Ga0157379_10079032 3300014968 Unclassified 2946
230 Ga0157379_10231471 3300014968 Bacteria 1675
231 Ga0157379_12285972 3300014968 Unclassified 538
232 Ga0157376_10536721 3300014969 Bacteria 1155
233 Ga0197907_10117008 3300020069 Unclassified 2217
234 Ga0197907_10148484 3300020069 Unclassified 501
235 Ga0197907_11513990 3300020069 Bacteria 1049
236 Ga0206356_11763115 3300020070 Bacteria 2662
237 Ga0206355_1330800 3300020076 Unclassified 641
238 Ga0206352_10006240 3300020078 Bacteria 618
239 Ga0206352_10237891 3300020078 Unclassified 810
240 Ga0206352_10705776 3300020078 Bacteria 755
241 Ga0206350_10396530 3300020080 Bacteria 703
242 Ga0206350_11081444 3300020080 Unclassified 1440
243 Ga0206350_11117227 3300020080 Bacteria 1217
244 Ga0206350_11414327 3300020080 Bacteria 565
245 Ga0206353_10687506 3300020082 Bacteria 599
246 Ga0213873_10006946 3300021358 Bacteria 2248
247 Ga0213873_10189651 3300021358 Unclassified 634
248 Ga0213873_10310709 3300021358 Unclassified 510
249 Ga0213872_10000604 3300021361 Bacteria 27278
250 Ga0213872_10120067 3300021361 Bacteria 1163
251 Ga0213874_10133635 3300021377 Bacteria 854
252 Ga0213874_10259706 3300021377 Unclassified 643
253 Ga0213874_10362572 3300021377 Unclassified 557
254 Ga0213876_10005778 3300021384 Bacteria 6774
255 Ga0213876_10021829 3300021384 Bacteria 3386
256 Ga0213876_10033279 3300021384 Unclassified 2718
257 Ga0213876_10063857 3300021384 Bacteria 1944
258 Ga0213876_10124656 3300021384 Bacteria 1368
259 Ga0213876_10141655 3300021384 Bacteria 1279
260 Ga0213876_10176816 3300021384 Unclassified 1135
261 Ga0213875_10000008 3300021388 Bacteria 533344
262 Ga0213875_10000531 3300021388 Bacteria 31479
263 Ga0213875_10002973 3300021388 Bacteria 9876
264 Ga0213875_10006380 3300021388 Bacteria 6205
265 Ga0213875_10026139 3300021388 Unclassified 2778
266 Ga0213875_10029238 3300021388 Unclassified 2614
267 Ga0213875_10040709 3300021388 Bacteria 2188
268 Ga0213875_10048290 3300021388 Bacteria 1997
269 Ga0213875_10050327 3300021388 Bacteria 1952
270 Ga0213875_10050554 3300021388 Unclassified 1947
271 Ga0213875_10070112 3300021388 Bacteria 1636
272 Ga0213875_10204394 3300021388 Bacteria 929
273 Ga0213875_10277929 3300021388 Unclassified 791
274 Ga0213875_10340867 3300021388 Unclassified 711
275 Ga0213875_10521004 3300021388 Unclassified 572
276 Ga0213871_10000878 3300021441 Bacteria 4576
277 Ga0224712_10087153 3300022467 Unclassified 1300
278 Ga0224712_10227841 3300022467 Bacteria 855
279 Ga0224712_10251200 3300022467 Bacteria 817
280 Ga0207692_10175576 3300025898 Unclassified 1244
281 Ga0207680_10997884 3300025903 Bacteria 600
282 Ga0207647_10398610 3300025904 Unclassified 775
283 Ga0207647_10417034 3300025904 Bacteria 755
284 Ga0207685_10311850 3300025905 Unclassified 782
285 Ga0207685_10707993 3300025905 Unclassified 549
286 Ga0207699_10684579 3300025906 Unclassified 750
287 Ga0207699_10800115 3300025906 Bacteria 693
288 Ga0207699_11489142 3300025906 Unclassified 501
289 Ga0207705_10319983 3300025909 Unclassified 1192
290 Ga0207705_10426277 3300025909 Unclassified 1027
291 Ga0207684_10967241 3300025910 Unclassified 713
292 Ga0207684_11173509 3300025910 Unclassified 637
293 Ga0207654_10127800 3300025911 Unclassified 1605
294 Ga0207654_10277414 3300025911 Unclassified 1133
295 Ga0207707_10065705 3300025912 Bacteria 3159
296 Ga0207707_10172216 3300025912 Bacteria 1892
297 Ga0207707_11058017 3300025912 Bacteria 663
298 Ga0207707_11228223 3300025912 Bacteria 605
299 Ga0207695_10017373 3300025913 Bacteria 8371
300 Ga0207695_10030294 3300025913 Bacteria 5959
301 Ga0207695_10571630 3300025913 Unclassified 1012
302 Ga0207671_10026181 3300025914 Bacteria 4373
303 Ga0207671_10042048 3300025914 Unclassified 3383
304 Ga0207671_10356120 3300025914 Bacteria 1161
305 Ga0207671_11047018 3300025914 Bacteria 642
306 Ga0207671_11437839 3300025914 Bacteria 534
307 Ga0207693_10377397 3300025915 Bacteria 1109
308 Ga0207663_10145448 3300025916 Bacteria 1657
309 Ga0207663_10507055 3300025916 Unclassified 938
310 Ga0207663_10850619 3300025916 Bacteria 728
311 Ga0207660_10789145 3300025917 Unclassified 775
312 Ga0207660_10953229 3300025917 Bacteria 700
313 Ga0207660_11705533 3300025917 Unclassified 507
314 Ga0207657_10122027 3300025919 Bacteria 2143
315 Ga0207649_10135130 3300025920 Bacteria 1680
316 Ga0207652_10344626 3300025921 Bacteria 1345
317 Ga0207652_10484184 3300025921 Bacteria 1114
318 Ga0207652_10938019 3300025921 Unclassified 763
319 Ga0207694_10132043 3300025924 Bacteria 2002
320 Ga0207694_10991329 3300025924 Bacteria 711
321 Ga0207694_11144704 3300025924 Unclassified 658
322 Ga0207650_10293589 3300025925 Bacteria 1326
323 Ga0207687_10181335 3300025927 Bacteria 1632
324 Ga0207687_10769866 3300025927 Bacteria 820
325 Ga0207687_11041787 3300025927 Unclassified 702
326 Ga0207687_11819676 3300025927 Unclassified 521
327 Ga0207700_10244730 3300025928 Unclassified 1530
328 Ga0207664_10160959 3300025929 Bacteria 1914
329 Ga0207664_10322392 3300025929 Bacteria 1363
330 Ga0207664_10921324 3300025929 Unclassified 784
331 Ga0207664_10939507 3300025929 Bacteria 776
332 Ga0207664_11570491 3300025929 Unclassified 580
333 Ga0207644_10704564 3300025931 Bacteria 842
334 Ga0207644_11158081 3300025931 Unclassified 650
335 Ga0207690_10122664 3300025932 Bacteria 1890
336 Ga0207690_11575681 3300025932 Unclassified 549
337 Ga0207706_10581896 3300025933 Bacteria 962
338 Ga0207686_10039932 3300025934 Bacteria 2850
339 Ga0207670_10375465 3300025936 Bacteria 1131
340 Ga0207691_11409512 3300025940 Unclassified 572
341 Ga0207711_10123641 3300025941 Bacteria 2312
342 Ga0207711_10383884 3300025941 Bacteria 1304
343 Ga0207711_10701951 3300025941 Bacteria 944
344 Ga0207711_11034074 3300025941 Bacteria 761
345 Ga0207689_10535137 3300025942 Bacteria 983
346 Ga0207661_10005809 3300025944 Bacteria 8701
347 Ga0207661_10080738 3300025944 Unclassified 2684
348 Ga0207661_10239101 3300025944 Bacteria 1611
349 Ga0207679_10437280 3300025945 Bacteria 1158
350 Ga0207667_10134107 3300025949 Bacteria 2550
351 Ga0207667_10217214 3300025949 Bacteria 1959
352 Ga0207667_10389995 3300025949 Bacteria 1418
353 Ga0207667_10576894 3300025949 Unclassified 1136
354 Ga0207667_11322889 3300025949 Unclassified 696
355 Ga0207667_11708141 3300025949 Unclassified 596
356 Ga0207651_11131277 3300025960 Bacteria 702
357 Ga0207640_10223477 3300025981 Bacteria 1443
358 Ga0207640_10232897 3300025981 Bacteria 1418
359 Ga0207640_10717589 3300025981 Unclassified 859
360 Ga0207640_10946443 3300025981 Bacteria 755
361 Ga0207658_10399265 3300025986 Bacteria 1208
362 Ga0207658_10422848 3300025986 Bacteria 1175
363 Ga0207658_12037209 3300025986 Bacteria 522
364 Ga0207677_10030672 3300026023 Bacteria 3435
365 Ga0207677_11058546 3300026023 Bacteria 738
366 Ga0207703_10354122 3300026035 Bacteria 1352
367 Ga0207703_11523215 3300026035 Unclassified 643
368 Ga0207703_12329600 3300026035 Unclassified 511
369 Ga0207639_10050423 3300026041 Unclassified 3161
370 Ga0207639_10050924 3300026041 Bacteria 3147
371 Ga0207639_10123213 3300026041 Unclassified 2133
372 Ga0207639_11283546 3300026041 Bacteria 687
373 Ga0207678_10118771 3300026067 Unclassified 2256
374 Ga0207678_10754931 3300026067 Bacteria 858
375 Ga0207678_11319866 3300026067 Bacteria 638
376 Ga0207678_11655863 3300026067 Unclassified 563
377 Ga0207678_11774546 3300026067 Unclassified 541
378 Ga0207708_11148388 3300026075 Bacteria 678
379 Ga0207702_10048176 3300026078 Bacteria 3593
380 Ga0207702_10257969 3300026078 Bacteria 1640
381 Ga0207702_10267560 3300026078 Unclassified 1611
382 Ga0207702_10668425 3300026078 Unclassified 1022
383 Ga0207641_10015837 3300026088 Bacteria 6174
384 Ga0207641_10400872 3300026088 Bacteria 1317
385 Ga0207641_10771996 3300026088 Unclassified 950
386 Ga0207648_10659225 3300026089 Bacteria 968
387 Ga0207676_10954141 3300026095 Unclassified 843
388 Ga0207674_10411370 3300026116 Bacteria 1307
389 Ga0207674_10835437 3300026116 Bacteria 888
390 Ga0207674_10944438 3300026116 Bacteria 831
391 Ga0207683_10360685 3300026121 Bacteria 1335
392 Ga0207683_10611024 3300026121 Bacteria 1009
393 Ga0207698_10080053 3300026142 Unclassified 2630
394 Ga0268266_10150356 3300028379 Unclassified 2098
395 Ga0268266_10752674 3300028379 Bacteria 940
396 Ga0268264_10231403 3300028381 Unclassified 1707
397 Ga0265326_10089837 3300028558 Unclassified 870
398 Ga0265319_1086758 3300028563 Unclassified 990
399 Ga0265318_10057093 3300028577 Unclassified 1459
400 Ga0265323_10241265 3300028653 Unclassified 563
401 Ga0265338_10012644 3300028800 Bacteria 9610
402 Ga0265338_10079554 3300028800 Unclassified 2758
403 Ga0265324_10023178 3300029957 Bacteria 2213
404 Ga0265760_10045693 3300031090 Archaea 1313
405 Ga0265330_10128943 3300031235 Unclassified 1077
406 Ga0265330_10348042 3300031235 Unclassified 626
407 Ga0265328_10009924 3300031239 Bacteria 3852
408 Ga0265320_10059887 3300031240 Bacteria 1819
409 Ga0265325_10015390 3300031241 Bacteria 4300
410 Ga0265325_10063391 3300031241 Unclassified 1870
411 Ga0265329_10036382 3300031242 Unclassified 1587
412 Ga0265340_10037949 3300031247 Bacteria 2385
413 Ga0265339_10102501 3300031249 Unclassified 1487
414 Ga0265331_10002235 3300031250 Bacteria 13252
415 Ga0265331_10048448 3300031250 Unclassified 2043
416 Ga0265316_10004839 3300031344 Bacteria 13275
417 Ga0265316_10005224 3300031344 Bacteria 12688
418 Ga0265316_10084938 3300031344 Unclassified 2423
419 Ga0265316_10203080 3300031344 Unclassified 1468
420 Ga0265316_10452537 3300031344 Unclassified 921
421 Ga0265316_10592430 3300031344 Bacteria 787
422 Ga0307408_100319692 3300031548 Bacteria 1307
423 Ga0265313_10056517 3300031595 Bacteria 1856
424 Ga0265314_10007710 3300031711 Bacteria 9307
425 Ga0265314_10032599 3300031711 Bacteria 3831
426 Ga0265342_10049946 3300031712 Bacteria 2501
427 Ga0265342_10576113 3300031712 Unclassified 569
428 Ga0265342_10602977 3300031712 Unclassified 554
429 Ga0307413_10923161 3300031824 Bacteria 743
430 Ga0307413_11746301 3300031824 Bacteria 556
431 Ga0307412_11741969 3300031911 Unclassified 572
432 Ga0307416_101929057 3300032002 Unclassified 694
433 Ga0373926_0063253 3300035083 Bacteria 1351
434 Ga0373926_0129638 3300035083 Unclassified 954
435 Ga0373923_0211049 3300035111 Unclassified 900
436 Ga0373923_0515056 3300035111 Bacteria 584
437 Ga0373936_0087822 3300035113 Unclassified 1301
438 Ga0373936_0241510 3300035113 Bacteria 805
439 Ga0373945_0149742 3300035116 Bacteria 945
440 Ga0373945_0278461 3300035116 Bacteria 712
441 Ga0373945_0430575 3300035116 Unclassified 581
442 Ga0373943_0009063 3300035170 Bacteria 4461
443 Ga0373946_0110327 3300035171 Bacteria 1244
444 Ga0373955_0317991 3300035172 Bacteria 940
445 Ga0373924_0211529 3300035410 Bacteria 856
446 Ga0373935_0051208 3300035692 Bacteria 2622
447 Ga0373927_0002368 3300035695 Bacteria 13732
448 Ga0373927_0002636 3300035695 Bacteria 13075
449 Ga0373927_0029363 3300035695 Bacteria 3584
450 Ga0373927_0172729 3300035695 Unclassified 1417
451 Ga0373927_0248307 3300035695 Unclassified 1170
452 Ga0373933_0684920 3300035724 Bacteria 674
453 Ga0373947_0011446 3300035725 Bacteria 5090
454 Ga0373947_0070285 3300035725 Unclassified 2145
455 Ga0373947_0198738 3300035725 Bacteria 1311
456 Ga0373937_0300286 3300036401 Unclassified 1518
457 Ga0373937_0665591 3300036401 Bacteria 987
458 Ga0373937_1017475 3300036401 Bacteria 777
459 Ga0373937_1130130 3300036401 Bacteria 732
460 Ga0373937_1668119 3300036401 Unclassified 584
461 Ga0373925_0097371 3300037068 Bacteria 2256
462 Ga0373925_0895357 3300037068 Unclassified 731
463 Ga0373925_1109395 3300037068 Bacteria 651
464 Ga0395900_1320565 3300037418 Unclassified 635
465 Ga0395900_1742780 3300037418 Unclassified 534
466 Ga0436364_0186735 3300037853 Bacteria 7242
467 Ga0436364_0189094 3300037853 Bacteria 1310
468 Ga0436364_0202477 3300037853 Unclassified 3008
469 Ga0436364_0232521 3300037853 Unclassified 556
470 Ga0436364_0232980 3300037853 Bacteria 4348
471 Ga0436364_0264121 3300037853 Bacteria 2719
472 Ga0436364_0302930 3300037853 Bacteria 2827
473 Ga0436364_0396555 3300037853 Bacteria 14391
474 Ga0436364_0421693 3300037853 Bacteria 3901
475 Ga0436364_0508356 3300037853 Unclassified 1276
476 Ga0436364_0625675 3300037853 Unclassified 3831
477 Ga0436364_0660048 3300037853 Unclassified 631
478 Ga0436364_0704934 3300037853 Bacteria 632
479 Ga0436364_0825238 3300037853 Bacteria 1284
480 Ga0436364_0845477 3300037853 Bacteria 3977
481 Ga0436364_0877214 3300037853 Bacteria 3174
482 Ga0436364_0877566 3300037853 Bacteria 12351
483 Ga0436364_0900019 3300037853 Bacteria 4884
484 Ga0436364_0929350 3300037853 Bacteria 660
485 Ga0436364_0968307 3300037853 Bacteria 1556
486 Ga0436364_1021072 3300037853 Unclassified 573
487 Ga0436364_1062827 3300037853 Bacteria 9205
488 Ga0436364_1105375 3300037853 Bacteria 139847
489 Ga0436364_1114375 3300037853 Bacteria 616
490 Ga0436364_1243063 3300037853 Unclassified 719
491 Ga0436364_1348537 3300037853 Bacteria 4316
492 Ga0436364_1415525 3300037853 Bacteria 425173
493 Ga0436364_1426312 3300037853 Bacteria 3513
494 Ga0436364_1501008 3300037853 Unclassified 576
495 Ga0436364_1521922 3300037853 Unclassified 556
496 Ga0436364_1525817 3300037853 Bacteria 608
497 Ga0436364_1528712 3300037853 Bacteria 1640
498 Ga0395901_0314352 3300038443 Unclassified 1622
499 Ga0436365_0188890 3300039437 Bacteria 1583
500 Ga0436365_0346997 3300039437 Bacteria 4079
501 Ga0436365_0397466 3300039437 Bacteria 16718
502 Ga0436365_0447678 3300039437 Unclassified 2718
503 Ga0436365_0625113 3300039437 Bacteria 2689
504 Ga0436365_0632242 3300039437 Unclassified 780
505 Ga0436365_0655522 3300039437 Bacteria 1586
506 Ga0436365_0728868 3300039437 Bacteria 1714
507 Ga0436365_0764285 3300039437 Unclassified 673
508 Ga0436365_1117349 3300039437 Bacteria 1266
509 Ga0436365_1140671 3300039437 Bacteria 5316
510 Ga0436365_1271429 3300039437 Unclassified 797
511 Ga0436365_1466075 3300039437 Bacteria 1087
512 Ga0436365_1536530 3300039437 Bacteria 2875
513 Ga0436365_1560696 3300039437 Bacteria 2388
514 Ga0436365_1826930 3300039437 Unclassified 724
515 Ga0436360_0040295 3300039438 Bacteria 1366
516 Ga0436360_0076998 3300039438 Bacteria 538
517 Ga0436360_1047605 3300039438 Unclassified 533
518 Ga0436360_1169859 3300039438 Bacteria 10148
519 Ga0436360_1369303 3300039438 Unclassified 980
520 Ga0436361_0001003 3300039447 Unclassified 592
521 Ga0436361_0092626 3300039447 Bacteria 5612
522 Ga0436361_0434431 3300039447 Bacteria 90700
523 Ga0436363_0040787 3300039450 Bacteria 843
524 Ga0436363_0107334 3300039450 Bacteria 4652
525 Ga0436363_0145412 3300039450 Unclassified 504
526 Ga0436363_0439413 3300039450 Bacteria 573
527 Ga0436363_0565568 3300039450 Unclassified 826
528 Ga0436363_0588470 3300039450 Unclassified 500
529 Ga0436363_0667533 3300039450 Unclassified 757
530 Ga0436363_0771817 3300039450 Bacteria 1115
531 Ga0436363_0778100 3300039450 Bacteria 4035
532 Ga0436363_0839432 3300039450 Bacteria 821
533 Ga0436363_1076290 3300039450 Bacteria 1161
534 Ga0436363_1439406 3300039450 Bacteria 3289
535 Ga0436363_1523540 3300039450 Unclassified 1304
536 Ga0436362_0197304 3300039453 Bacteria 828
537 Ga0436362_0584771 3300039453 Bacteria 812
538 Ga0436362_0609058 3300039453 Bacteria 1854
539 Ga0436362_0611735 3300039453 Bacteria 628
540 Ga0436362_0925983 3300039453 Unclassified 637
541 Ga0436362_0940117 3300039453 Bacteria 502
542 Ga0436362_1094764 3300039453 Bacteria 4941
543 Ga0436362_1194511 3300039453 Bacteria 1059
544 Ga0451849_1097332 3300041505 Unclassified 562
545 Ga0466963_0090704 3300044694 Unclassified 2081
546 Ga0466963_0329008 3300044694 Bacteria 1076
547 Ga0466963_0614836 3300044694 Unclassified 767
548 Ga0466963_0696924 3300044694 Bacteria 717
549 Ga0453684_0815050 3300044712 Bacteria 1006
550 Ga0453684_0958256 3300044712 Unclassified 913
551 Ga0453684_1341098 3300044712 Unclassified 744
552 Ga0466971_0381689 3300044719 Bacteria 685
553 Ga0466957_0226645 3300044842 Unclassified 1236
554 Ga0466957_0689319 3300044842 Bacteria 720
555 Ga0466959_0949401 3300045049 Bacteria 573
556 Ga0451576_0019383 3300045051 Bacteria 7427
557 Ga0451576_1773790 3300045051 Unclassified 638
558 Ga0451576_2405092 3300045051 Bacteria 539
559 Ga0451576_2717614 3300045051 Unclassified 504
560 Ga0466958_0194804 3300045836 Bacteria 1289
561 Ga0466958_0556474 3300045836 Unclassified 745
562 Ga0466958_0568806 3300045836 Bacteria 737
563 Ga0466967_0119153 3300045976 Bacteria 2436
564 Ga0466967_0219752 3300045976 Bacteria 1805
565 Ga0466967_1031975 3300045976 Bacteria 819
566 Ga0466967_1713329 3300045976 Unclassified 626
567 Ga0495592_0142639 3300046454 Bacteria 1664
568 Ga0495592_0370459 3300046454 Unclassified 914
569 Ga0495651_0104732 3300046462 Bacteria 2100
570 Ga0495651_0142291 3300046462 Bacteria 1738
571 Ga0495651_0563055 3300046462 Unclassified 723
572 Ga0495653_0467396 3300046463 Bacteria 791
573 Ga0495580_0192186 3300046472 Bacteria 1408
574 Ga0495580_0309199 3300046472 Bacteria 1075
575 Ga0495639_0403804 3300046475 Bacteria 690
576 Ga0495664_0096465 3300046477 Unclassified 1780
577 Ga0495664_0232409 3300046477 Bacteria 1116
578 Ga0495594_0633626 3300046499 Unclassified 606
579 Ga0495618_0639952 3300046514 Unclassified 630
580 Ga0495628_0383871 3300046516 Bacteria 1028
581 Ga0495665_0014059 3300046531 Bacteria 4323
582 Ga0495586_0096949 3300046535 Bacteria 1634
583 Ga0495587_0483414 3300046536 Unclassified 685
584 Ga0495667_0977330 3300046559 Unclassified 517
585 Ga0495635_0029277 3300046663 Bacteria 3829
586 Ga0495635_0276827 3300046663 Bacteria 1128
587 Ga0495599_0058453 3300046678 Bacteria 2412
588 Ga0495623_0066551 3300046679 Bacteria 2251
589 Ga0495646_0189166 3300046680 Bacteria 1126
590 Ga0495658_0428027 3300046683 Bacteria 845
591 Ga0495669_0029992 3300046684 Bacteria 2387
592 Ga0495600_0173754 3300046809 Bacteria 1390
593 Ga0495581_0088528 3300047315 Bacteria 1795
594 Ga0495636_0054735 3300047318 Unclassified 1677
595 Ga0495674_0221808 3300047319 Bacteria 1562
596 Ga0495676_0782637 3300047321 Unclassified 615
597 Ga0495675_0449985 3300047444 Bacteria 745
598 Ga0495675_0471298 3300047444 Bacteria 724
599 Ga0495684_0451504 3300047471 Unclassified 893
600 Ga0495686_0534139 3300047472 Unclassified 614
601 Ga0495602_0854175 3300048088 Unclassified 608
602 Ga0495602_0913619 3300048088 Bacteria 583
603 Ga0496100_0788431 3300048903 Bacteria 744
604 Ga0496100_1444960 3300048903 Bacteria 543
605 Ga0496102_0160184 3300048905 Bacteria 2117
606 Ga0496102_0614572 3300048905 Bacteria 1010
607 Ga0496104_0955344 3300048907 Bacteria 761
608 Ga0496104_1075320 3300048907 Unclassified 708
609 Ga0496105_0623090 3300048908 Bacteria 835
610 Ga0496108_0750646 3300048911 Unclassified 844
611 Ga0496109_0733366 3300048912 Bacteria 926
612 Ga0496109_1339649 3300048912 Bacteria 652
613 Ga0496110_0304780 3300048913 Bacteria 1451
614 Ga0496112_0009787 3300048915 Bacteria 8657
615 Ga0496112_0030443 3300048915 Bacteria 5224
616 Ga0496113_0143534 3300048916 Bacteria 1880
617 Ga0496115_0331042 3300048918 Bacteria 1244
618 Ga0496126_0123113 3300048929 Bacteria 2247
619 Ga0501031_0654999 3300049568 Unclassified 675
620 Ga0501032_0805269 3300049569 Unclassified 593
621 Ga0501033_0211176 3300049570 Unclassified 1384
622 Ga0501033_0232774 3300049570 Bacteria 1308
623 Ga0501034_0014605 3300049571 Bacteria 8086
624 Ga0501034_0136916 3300049571 Unclassified 2429
625 Ga0501034_1047578 3300049571 Unclassified 698
626 Ga0501036_0027378 3300049572 Unclassified 4817
627 Ga0501038_0127904 3300049574 Unclassified 2089
628 Ga0501038_0629748 3300049574 Unclassified 809
629 Ga0501043_0006526 3300049579 Bacteria 9359
630 Ga0501046_0175306 3300049580 Unclassified 1606
631 Ga0501046_0222225 3300049580 Bacteria 1398
632 Ga0501046_0828742 3300049580 Unclassified 647
633 Ga0501047_0023118 3300049581 Bacteria 5968
634 Ga0501047_0120492 3300049581 Unclassified 2506
635 Ga0501047_0266968 3300049581 Bacteria 1558
636 Ga0501067_0658660 3300049583 Unclassified 588
637 Ga0501070_0162096 3300049586 Bacteria 1843
638 Ga0501070_0436745 3300049586 Bacteria 1056
639 Ga0501073_0099139 3300049589 Bacteria 2023
640 Ga0501075_0757145 3300049591 Bacteria 739
641 Ga0501076_0198197 3300049592 Bacteria 1639
642 Ga0501243_070303 3300049675 Bacteria 664
643 Ga0501080_0251297 3300049742 Unclassified 1612
644 Ga0501080_0513174 3300049742 Bacteria 1070
645 Ga0501083_0361203 3300049744 Bacteria 944
646 Ga0501083_0477184 3300049744 Unclassified 812
647 Ga0501035_0012051 3300049822 Bacteria 7998
648 Ga0501035_0158028 3300049822 Bacteria 1964
649 Ga0501035_1539857 3300049822 Unclassified 506
650 Ga0501044_0001806 3300049823 Bacteria 24933
651 Ga0501044_0002981 3300049823 Bacteria 19200
652 Ga0501044_0034509 3300049823 Bacteria 5304
653 Ga0501044_0061261 3300049823 Unclassified 3850
654 nmdc:mga09592_501462_c1 3300050508 Unclassified 1045
655 nmdc:mga0qj67_13897_c2 3300050509 Bacteria 3115
656 nmdc:mga06r32_16670_c1 3300050510 Bacteria 6695
657 nmdc:mga08y16_579630_c1 3300050511 Unclassified 1133
658 nmdc:mga0n895_825817_c1 3300050512 Bacteria 916
659 nmdc:mga0rr50_182698_c1 3300050513 Bacteria 1715
660 nmdc:mga08x19_1203887_c1 3300050514 Unclassified 537
661 nmdc:mga08x19_178915_c1 3300050514 Bacteria 1447
662 nmdc:mga08x19_798033_c1 3300050514 Bacteria 670
663 nmdc:mga08x19_9104_c1 3300050514 Bacteria 5928
664 Ga0495601_0437730 3300053077 Unclassified 846
665 Ga0495601_0934930 3300053077 Bacteria 547
666 Ga0500568_0002007 3300053139 Bacteria 12388
667 Ga0466962_0321335 3300061719 Unclassified 768
668 Ga0495635_0249017
669 Ga0058862_12769342
670 Ga0058862_12846478
671 Ga0070658_10426613
672 Ga0070683_100066846
673 Ga0070683_100211480
674 Ga0070683_100409748
675 Ga0070683_101299812
676 Ga0068869_101863800
677 Ga0070680_100053548
678 Ga0070680_100183589
679 Ga0070682_100274201
680 Ga0070682_100492566
681 Ga0068868_100072786
682 Ga0068868_100275045
683 Ga0068868_101106442
684 Ga0070660_100576321
685 Ga0070689_100084030
686 Ga0070689_100419069
687 Ga0070689_100632964
688 Ga0070692_10041886
689 Ga0070671_100197579
690 Ga0070671_101445990
691 Ga0070671_101510729
692 Ga0070673_102403685
693 Ga0070659_100081584
694 Ga0070659_100446865
695 Ga0070659_100514863
696 Ga0070667_100049395
697 Ga0070667_100434375
698 Ga0070709_10620024
699 Ga0070709_11087026
700 Ga0070709_11783760
701 Ga0070714_100067282
702 Ga0070714_100141607
703 Ga0070714_100207552
704 Ga0070714_100573498
705 Ga0070714_100849504
706 Ga0070713_100121100
707 Ga0070713_100334976
708 Ga0070713_101115001
709 Ga0070713_101705765
710 Ga0070710_10238260
711 Ga0070701_10170856
712 Ga0070711_100212198
713 Ga0070711_101304529
714 Ga0070705_100276861
715 Ga0070700_100967684
716 Ga0070694_100384147
717 Ga0070708_100055671
718 Ga0070663_100033590
719 Ga0070663_100395683
720 Ga0070663_100694832
721 Ga0070663_101151367
722 Ga0070678_100046139
723 Ga0070662_100249098
724 Ga0070681_10046052
725 Ga0070681_10119474
726 Ga0070681_10127221
727 Ga0070681_10742757
728 Ga0070706_100152926
729 Ga0070706_101296077
730 Ga0070699_100033580
731 Ga0070699_101233864
732 Ga0070679_100049582
733 Ga0070679_100399292
734 Ga0070679_100437992
735 Ga0070679_100467399
736 Ga0070679_100660922
737 Ga0070679_100955283
738 Ga0070684_100207530
739 Ga0070684_100284655
740 Ga0070697_100000266
741 Ga0070697_100016981
742 Ga0070697_100408550
743 Ga0068853_100041185
744 Ga0068853_100229656
745 Ga0068853_100510593
746 Ga0068853_101618226
747 Ga0068853_102106453
748 Ga0070672_100923081
749 Ga0070695_100025319
750 Ga0070695_100417563
751 Ga0070696_100094269
752 Ga0070696_100586584
753 Ga0070693_100143738
754 Ga0070665_100318952
755 Ga0070665_100446507
756 Ga0070665_102597989
757 Ga0070704_100603799
758 Ga0070704_100939558
759 Ga0070704_101836865
760 Ga0068855_100087433
761 Ga0068855_100155965
762 Ga0068855_100258887
763 Ga0068855_100315592
764 Ga0068855_101190303
765 Ga0070664_100351996
766 Ga0068857_101940943
767 Ga0068854_100043691
768 Ga0068854_100104793
769 Ga0068854_100238966
770 Ga0068854_100287448
771 Ga0068854_100749780
772 Ga0068856_100024981
773 Ga0068856_100248374
774 Ga0068856_100540882
775 Ga0068856_100684407
776 Ga0068856_100704711
777 Ga0070702_100636664
778 Ga0068852_100298539
779 Ga0068852_100760022
780 Ga0068859_100527611
781 Ga0068859_101521524
782 Ga0068864_100322714
783 Ga0068864_101964353
784 Ga0068863_100050637
785 Ga0068863_100460622
786 Ga0068863_100584215
787 Ga0068863_101633693
788 Ga0068863_101682735
789 Ga0068858_100030314
790 Ga0068858_100273219
791 Ga0068858_101628300
792 Ga0068860_100324231
793 Ga0068860_100899063
794 Ga0068862_100901398
795 Ga0081455_10004184
796 Ga0070717_10068012
797 Ga0070717_10481493
798 Ga0070717_11593265
799 Ga0070715_10335111
800 Ga0070712_100075878
801 Ga0070712_100235822
802 Ga0070712_101042394
803 Ga0097621_100007315
804 Ga0097621_100682690
805 Ga0097621_100724618
806 Ga0068871_100227225
807 Ga0075430_100297808
808 Ga0075430_100509003
809 Ga0075431_100042438
810 Ga0075431_100085458
811 Ga0075433_10000203
812 Ga0075434_100000016
813 Ga0075434_101146878
814 Ga0075429_100398463
815 Ga0075429_100542347
816 Ga0075436_100000459
817 Ga0075436_100002867
818 Ga0075436_100194387
819 Ga0075436_101155473
820 Ga0097620_100527607
821 Ga0097620_101521486
822 Ga0075435_100000506
823 Ga0075435_100635593
824 Ga0105240_10002088
825 Ga0105240_10149958
826 Ga0105245_10450640
827 Ga0105245_11708203
828 Ga0105245_12682055
829 Ga0114129_10759829
830 Ga0105243_10145398
831 Ga0105243_11715446
832 Ga0105241_10106337
833 Ga0105241_10187817
834 Ga0105241_10741515
835 Ga0105241_11063385
836 Ga0105242_10646886
837 Ga0105248_10077157
838 Ga0105248_10169672
839 Ga0105248_10474731
840 Ga0105248_10628412
841 Ga0105248_10795101
842 Ga0105248_11199708
843 Ga0105248_11218921
844 Ga0105248_11592660
845 Ga0105248_12394612
846 Ga0105237_10015531
847 Ga0105237_10030803
848 Ga0105237_11056578
849 Ga0105237_12662997
850 Ga0105238_10033919
851 Ga0105238_10452275
852 Ga0105238_10744848
853 Ga0105238_11412438
854 Ga0105239_10170611
855 Ga0105239_10534812
856 Ga0105246_10319173
857 Ga0157373_10147182
858 Ga0157371_10029385
859 Ga0157371_10157061
860 Ga0157371_11353919
861 Ga0157370_10041967
862 Ga0157370_10226486
863 Ga0157370_10367084
864 Ga0157370_11105634
865 Ga0157369_10009232
866 Ga0157369_10068636
867 Ga0157369_10154328
868 Ga0157369_10224820
869 Ga0157369_10255562
870 Ga0157369_10274695
871 Ga0157369_10564127
872 Ga0157369_10970255
873 Ga0157369_11823365
874 Ga0157369_12409023
875 Ga0157374_10013550
876 Ga0157374_10030856
877 Ga0157374_10077725
878 Ga0157374_10239007
879 Ga0157378_10760313
880 Ga0163162_10573224
881 Ga0163162_11053105
882 Ga0163162_13424265
883 Ga0157372_10128287
884 Ga0157372_10878519
885 Ga0157372_12844629
886 Ga0157375_10775236
887 Ga0163163_10067044
888 Ga0163163_10219870
889 Ga0163163_10735028
890 Ga0163163_10781443
891 Ga0163163_12905139
892 Ga0157380_12486401
893 Ga0157377_10687905
894 Ga0157377_10838956
895 Ga0157377_11240071
896 Ga0157379_10079032
897 Ga0157379_10231471
898 Ga0157379_12285972
899 Ga0157376_10536721
900 Ga0197907_10117008
901 Ga0197907_10148484
902 Ga0197907_11513990
903 Ga0206356_11763115
904 Ga0206355_1330800
905 Ga0206352_10006240
906 Ga0206352_10237891
907 Ga0206352_10705776
908 Ga0206350_10396530
909 Ga0206350_11081444
910 Ga0206350_11117227
911 Ga0206350_11414327
912 Ga0206353_10687506
913 Ga0213873_10006946
914 Ga0213873_10189651
915 Ga0213873_10310709
916 Ga0213872_10000604
917 Ga0213872_10120067
918 Ga0213874_10133635
919 Ga0213874_10259706
920 Ga0213874_10362572
921 Ga0213876_10005778
922 Ga0213876_10021829
923 Ga0213876_10033279
924 Ga0213876_10063857
925 Ga0213876_10124656
926 Ga0213876_10141655
927 Ga0213876_10176816
928 Ga0213875_10000008
929 Ga0213875_10000531
930 Ga0213875_10002973
931 Ga0213875_10006380
932 Ga0213875_10026139
933 Ga0213875_10029238
934 Ga0213875_10040709
935 Ga0213875_10048290
936 Ga0213875_10050327
937 Ga0213875_10050554
938 Ga0213875_10070112
939 Ga0213875_10204394
940 Ga0213875_10277929
941 Ga0213875_10340867
942 Ga0213875_10521004
943 Ga0213871_10000878
944 Ga0224712_10087153
945 Ga0224712_10227841
946 Ga0224712_10251200
947 Ga0207692_10175576
948 Ga0207680_10997884
949 Ga0207647_10398610
950 Ga0207647_10417034
951 Ga0207685_10311850
952 Ga0207685_10707993
953 Ga0207699_10684579
954 Ga0207699_10800115
955 Ga0207699_11489142
956 Ga0207705_10319983
957 Ga0207705_10426277
958 Ga0207684_10967241
959 Ga0207684_11173509
960 Ga0207654_10127800
961 Ga0207654_10277414
962 Ga0207707_10065705
963 Ga0207707_10172216
964 Ga0207707_11058017
965 Ga0207707_11228223
966 Ga0207695_10017373
967 Ga0207695_10030294
968 Ga0207695_10571630
969 Ga0207671_10026181
970 Ga0207671_10042048
971 Ga0207671_10356120
972 Ga0207671_11047018
973 Ga0207671_11437839
974 Ga0207693_10377397
975 Ga0207663_10145448
976 Ga0207663_10507055
977 Ga0207663_10850619
978 Ga0207660_10789145
979 Ga0207660_10953229
980 Ga0207660_11705533
981 Ga0207657_10122027
982 Ga0207649_10135130
983 Ga0207652_10344626
984 Ga0207652_10484184
985 Ga0207652_10938019
986 Ga0207694_10132043
987 Ga0207694_10991329
988 Ga0207694_11144704
989 Ga0207650_10293589
990 Ga0207687_10181335
991 Ga0207687_10769866
992 Ga0207687_11041787
993 Ga0207687_11819676
994 Ga0207700_10244730
995 Ga0207664_10160959
996 Ga0207664_10322392
997 Ga0207664_10921324
998 Ga0207664_10939507
999 Ga0207664_11570491
1000 Ga0207644_10704564
1001 Ga0207644_11158081
1002 Ga0207690_10122664
1003 Ga0207690_11575681
1004 Ga0207706_10581896
1005 Ga0207686_10039932
1006 Ga0207670_10375465
1007 Ga0207691_11409512
1008 Ga0207711_10123641
1009 Ga0207711_10383884
1010 Ga0207711_10701951
1011 Ga0207711_11034074
1012 Ga0207689_10535137
1013 Ga0207661_10005809
1014 Ga0207661_10080738
1015 Ga0207661_10239101
1016 Ga0207679_10437280
1017 Ga0207667_10134107
1018 Ga0207667_10217214
1019 Ga0207667_10389995
1020 Ga0207667_10576894
1021 Ga0207667_11322889
1022 Ga0207667_11708141
1023 Ga0207651_11131277
1024 Ga0207640_10223477
1025 Ga0207640_10232897
1026 Ga0207640_10717589
1027 Ga0207640_10946443
1028 Ga0207658_10399265
1029 Ga0207658_10422848
1030 Ga0207658_12037209
1031 Ga0207677_10030672
1032 Ga0207677_11058546
1033 Ga0207703_10354122
1034 Ga0207703_11523215
1035 Ga0207703_12329600
1036 Ga0207639_10050423
1037 Ga0207639_10050924
1038 Ga0207639_10123213
1039 Ga0207639_11283546
1040 Ga0207678_10118771
1041 Ga0207678_10754931
1042 Ga0207678_11319866
1043 Ga0207678_11655863
1044 Ga0207678_11774546
1045 Ga0207708_11148388
1046 Ga0207702_10048176
1047 Ga0207702_10257969
1048 Ga0207702_10267560
1049 Ga0207702_10668425
1050 Ga0207641_10015837
1051 Ga0207641_10400872
1052 Ga0207641_10771996
1053 Ga0207648_10659225
1054 Ga0207676_10954141
1055 Ga0207674_10411370
1056 Ga0207674_10835437
1057 Ga0207674_10944438
1058 Ga0207683_10360685
1059 Ga0207683_10611024
1060 Ga0207698_10080053
1061 Ga0268266_10150356
1062 Ga0268266_10752674
1063 Ga0268264_10231403
1064 Ga0265326_10089837
1065 Ga0265319_1086758
1066 Ga0265318_10057093
1067 Ga0265323_10241265
1068 Ga0265338_10012644
1069 Ga0265338_10079554
1070 Ga0265324_10023178
1071 Ga0265760_10045693
1072 Ga0265330_10128943
1073 Ga0265330_10348042
1074 Ga0265328_10009924
1075 Ga0265320_10059887
1076 Ga0265325_10015390
1077 Ga0265325_10063391
1078 Ga0265329_10036382
1079 Ga0265340_10037949
1080 Ga0265339_10102501
1081 Ga0265331_10002235
1082 Ga0265331_10048448
1083 Ga0265316_10004839
1084 Ga0265316_10005224
1085 Ga0265316_10084938
1086 Ga0265316_10203080
1087 Ga0265316_10452537
1088 Ga0265316_10592430
1089 Ga0307408_100319692
1090 Ga0265313_10056517
1091 Ga0265314_10007710
1092 Ga0265314_10032599
1093 Ga0265342_10049946
1094 Ga0265342_10576113
1095 Ga0265342_10602977
1096 Ga0307413_10923161
1097 Ga0307413_11746301
1098 Ga0307412_11741969
1099 Ga0307416_101929057
1100 Ga0373926_0063253
1101 Ga0373926_0129638
1102 Ga0373923_0211049
1103 Ga0373923_0515056
1104 Ga0373936_0087822
1105 Ga0373936_0241510
1106 Ga0373945_0149742
1107 Ga0373945_0278461
1108 Ga0373945_0430575
1109 Ga0373943_0009063
1110 Ga0373946_0110327
1111 Ga0373955_0317991
1112 Ga0373924_0211529
1113 Ga0373935_0051208
1114 Ga0373927_0002368
1115 Ga0373927_0002636
1116 Ga0373927_0029363
1117 Ga0373927_0172729
1118 Ga0373927_0248307
1119 Ga0373933_0684920
1120 Ga0373947_0011446
1121 Ga0373947_0070285
1122 Ga0373947_0198738
1123 Ga0373937_0300286
1124 Ga0373937_0665591
1125 Ga0373937_1017475
1126 Ga0373937_1130130
1127 Ga0373937_1668119
1128 Ga0373925_0097371
1129 Ga0373925_0895357
1130 Ga0373925_1109395
1131 Ga0395900_1320565
1132 Ga0395900_1742780
1133 Ga0436364_0186735
1134 Ga0436364_0189094
1135 Ga0436364_0202477
1136 Ga0436364_0232521
1137 Ga0436364_0232980
1138 Ga0436364_0264121
1139 Ga0436364_0302930
1140 Ga0436364_0396555
1141 Ga0436364_0421693
1142 Ga0436364_0508356
1143 Ga0436364_0625675
1144 Ga0436364_0660048
1145 Ga0436364_0704934
1146 Ga0436364_0825238
1147 Ga0436364_0845477
1148 Ga0436364_0877214
1149 Ga0436364_0877566
1150 Ga0436364_0900019
1151 Ga0436364_0929350
1152 Ga0436364_0968307
1153 Ga0436364_1021072
1154 Ga0436364_1062827
1155 Ga0436364_1105375
1156 Ga0436364_1114375
1157 Ga0436364_1243063
1158 Ga0436364_1348537
1159 Ga0436364_1415525
1160 Ga0436364_1426312
1161 Ga0436364_1501008
1162 Ga0436364_1521922
1163 Ga0436364_1525817
1164 Ga0436364_1528712
1165 Ga0395901_0314352
1166 Ga0436365_0188890
1167 Ga0436365_0346997
1168 Ga0436365_0397466
1169 Ga0436365_0447678
1170 Ga0436365_0625113
1171 Ga0436365_0632242
1172 Ga0436365_0655522
1173 Ga0436365_0728868
1174 Ga0436365_0764285
1175 Ga0436365_1117349
1176 Ga0436365_1140671
1177 Ga0436365_1271429
1178 Ga0436365_1466075
1179 Ga0436365_1536530
1180 Ga0436365_1560696
1181 Ga0436365_1826930
1182 Ga0436360_0040295
1183 Ga0436360_0076998
1184 Ga0436360_1047605
1185 Ga0436360_1169859
1186 Ga0436360_1369303
1187 Ga0436361_0001003
1188 Ga0436361_0092626
1189 Ga0436361_0434431
1190 Ga0436363_0040787
1191 Ga0436363_0107334
1192 Ga0436363_0145412
1193 Ga0436363_0439413
1194 Ga0436363_0565568
1195 Ga0436363_0588470
1196 Ga0436363_0667533
1197 Ga0436363_0771817
1198 Ga0436363_0778100
1199 Ga0436363_0839432
1200 Ga0436363_1076290
1201 Ga0436363_1439406
1202 Ga0436363_1523540
1203 Ga0436362_0197304
1204 Ga0436362_0584771
1205 Ga0436362_0609058
1206 Ga0436362_0611735
1207 Ga0436362_0925983
1208 Ga0436362_0940117
1209 Ga0436362_1094764
1210 Ga0436362_1194511
1211 Ga0451849_1097332
1212 Ga0466963_0090704
1213 Ga0466963_0329008
1214 Ga0466963_0614836
1215 Ga0466963_0696924
1216 Ga0453684_0815050
1217 Ga0453684_0958256
1218 Ga0453684_1341098
1219 Ga0466971_0381689
1220 Ga0466957_0226645
1221 Ga0466957_0689319
1222 Ga0466959_0949401
1223 Ga0451576_0019383
1224 Ga0451576_1773790
1225 Ga0451576_2405092
1226 Ga0451576_2717614
1227 Ga0466958_0194804
1228 Ga0466958_0556474
1229 Ga0466958_0568806
1230 Ga0466967_0119153
1231 Ga0466967_0219752
1232 Ga0466967_1031975
1233 Ga0466967_1713329
1234 Ga0495592_0142639
1235 Ga0495592_0370459
1236 Ga0495651_0104732
1237 Ga0495651_0142291
1238 Ga0495651_0563055
1239 Ga0495653_0467396
1240 Ga0495580_0192186
1241 Ga0495580_0309199
1242 Ga0495639_0403804
1243 Ga0495664_0096465
1244 Ga0495664_0232409
1245 Ga0495594_0633626
1246 Ga0495618_0639952
1247 Ga0495628_0383871
1248 Ga0495665_0014059
1249 Ga0495586_0096949
1250 Ga0495587_0483414
1251 Ga0495667_0977330
1252 Ga0495635_0029277
1253 Ga0495635_0276827
1254 Ga0495599_0058453
1255 Ga0495623_0066551
1256 Ga0495646_0189166
1257 Ga0495658_0428027
1258 Ga0495669_0029992
1259 Ga0495600_0173754
1260 Ga0495581_0088528
1261 Ga0495636_0054735
1262 Ga0495674_0221808
1263 Ga0495676_0782637
1264 Ga0495675_0449985
1265 Ga0495675_0471298
1266 Ga0495684_0451504
1267 Ga0495686_0534139
1268 Ga0495602_0854175
1269 Ga0495602_0913619
1270 Ga0496100_0788431
1271 Ga0496100_1444960
1272 Ga0496102_0160184
1273 Ga0496102_0614572
1274 Ga0496104_0955344
1275 Ga0496104_1075320
1276 Ga0496105_0623090
1277 Ga0496108_0750646
1278 Ga0496109_0733366
1279 Ga0496109_1339649
1280 Ga0496110_0304780
1281 Ga0496112_0009787
1282 Ga0496112_0030443
1283 Ga0496113_0143534
1284 Ga0496115_0331042
1285 Ga0496126_0123113
1286 Ga0501031_0654999
1287 Ga0501032_0805269
1288 Ga0501033_0211176
1289 Ga0501033_0232774
1290 Ga0501034_0014605
1291 Ga0501034_0136916
1292 Ga0501034_1047578
1293 Ga0501036_0027378
1294 Ga0501038_0127904
1295 Ga0501038_0629748
1296 Ga0501043_0006526
1297 Ga0501046_0175306
1298 Ga0501046_0222225
1299 Ga0501046_0828742
1300 Ga0501047_0023118
1301 Ga0501047_0120492
1302 Ga0501047_0266968
1303 Ga0501067_0658660
1304 Ga0501070_0162096
1305 Ga0501070_0436745
1306 Ga0501073_0099139
1307 Ga0501075_0757145
1308 Ga0501076_0198197
1309 Ga0501243_070303
1310 Ga0501080_0251297
1311 Ga0501080_0513174
1312 Ga0501083_0361203
1313 Ga0501083_0477184
1314 Ga0501035_0012051
1315 Ga0501035_0158028
1316 Ga0501035_1539857
1317 Ga0501044_0001806
1318 Ga0501044_0002981
1319 Ga0501044_0034509
1320 Ga0501044_0061261
1321 nmdc:mga09592_501462_c1
1322 nmdc:mga0qj67_13897_c2
1323 nmdc:mga06r32_16670_c1
1324 nmdc:mga08y16_579630_c1
1325 nmdc:mga0n895_825817_c1
1326 nmdc:mga0rr50_182698_c1
1327 nmdc:mga08x19_1203887_c1
1328 nmdc:mga08x19_178915_c1
1329 nmdc:mga08x19_798033_c1
1330 nmdc:mga08x19_9104_c1
1331 Ga0495601_0437730
1332 Ga0495601_0934930
1333 Ga0500568_0002007
1334 Ga0466962_0321335

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01084

Ribosomal_S18

Ribosomal protein S18

40

91

0.97

Map