F473861
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 667 | 277 | 1334 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300046663|Ga0495635_0249017|Ga0495635_0249017_541_834 |
| Length | 97 |
| Sequence | MAEQRSGGGRPIAASQRPTGGDKAMGKKQYFRRKKMCRFCVEDINYNDVRLLSSFLSERGKITPRRISGVCAPHQRRLAESIKQARNIALITFTTTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 97 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 101 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 102 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 106 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 203 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.15 |
| Metatranscriptomes | 2.85 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 2.25 |
| Rhizosphere | 84.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495635_0249017 | 3300046663 | Unclassified | 1198 |
| 2 | Ga0058862_12769342 | 3300004803 | Bacteria | 1141 |
| 3 | Ga0058862_12846478 | 3300004803 | Unclassified | 2041 |
| 4 | Ga0070658_10426613 | 3300005327 | Unclassified | 1141 |
| 5 | Ga0070683_100066846 | 3300005329 | Bacteria | 3348 |
| 6 | Ga0070683_100211480 | 3300005329 | Unclassified | 1842 |
| 7 | Ga0070683_100409748 | 3300005329 | Bacteria | 1293 |
| 8 | Ga0070683_101299812 | 3300005329 | Bacteria | 699 |
| 9 | Ga0068869_101863800 | 3300005334 | Unclassified | 538 |
| 10 | Ga0070680_100053548 | 3300005336 | Bacteria | 3294 |
| 11 | Ga0070680_100183589 | 3300005336 | Bacteria | 1762 |
| 12 | Ga0070682_100274201 | 3300005337 | Bacteria | 1227 |
| 13 | Ga0070682_100492566 | 3300005337 | Unclassified | 948 |
| 14 | Ga0068868_100072786 | 3300005338 | Bacteria | 2742 |
| 15 | Ga0068868_100275045 | 3300005338 | Bacteria | 1424 |
| 16 | Ga0068868_101106442 | 3300005338 | Bacteria | 729 |
| 17 | Ga0070660_100576321 | 3300005339 | Bacteria | 940 |
| 18 | Ga0070689_100084030 | 3300005340 | Bacteria | 2502 |
| 19 | Ga0070689_100419069 | 3300005340 | Bacteria | 1134 |
| 20 | Ga0070689_100632964 | 3300005340 | Bacteria | 929 |
| 21 | Ga0070692_10041886 | 3300005345 | Bacteria | 2348 |
| 22 | Ga0070671_100197579 | 3300005355 | Bacteria | 1705 |
| 23 | Ga0070671_101445990 | 3300005355 | Unclassified | 608 |
| 24 | Ga0070671_101510729 | 3300005355 | Unclassified | 594 |
| 25 | Ga0070673_102403685 | 3300005364 | Unclassified | 501 |
| 26 | Ga0070659_100081584 | 3300005366 | Bacteria | 2583 |
| 27 | Ga0070659_100446865 | 3300005366 | Bacteria | 1096 |
| 28 | Ga0070659_100514863 | 3300005366 | Bacteria | 1021 |
| 29 | Ga0070667_100049395 | 3300005367 | Bacteria | 3543 |
| 30 | Ga0070667_100434375 | 3300005367 | Bacteria | 1198 |
| 31 | Ga0070709_10620024 | 3300005434 | Bacteria | 835 |
| 32 | Ga0070709_11087026 | 3300005434 | Bacteria | 639 |
| 33 | Ga0070709_11783760 | 3300005434 | Bacteria | 503 |
| 34 | Ga0070714_100067282 | 3300005435 | Bacteria | 3088 |
| 35 | Ga0070714_100141607 | 3300005435 | Bacteria | 2160 |
| 36 | Ga0070714_100207552 | 3300005435 | Bacteria | 1794 |
| 37 | Ga0070714_100573498 | 3300005435 | Bacteria | 1082 |
| 38 | Ga0070714_100849504 | 3300005435 | Bacteria | 885 |
| 39 | Ga0070713_100121100 | 3300005436 | Unclassified | 2295 |
| 40 | Ga0070713_100334976 | 3300005436 | Unclassified | 1401 |
| 41 | Ga0070713_101115001 | 3300005436 | Bacteria | 763 |
| 42 | Ga0070713_101705765 | 3300005436 | Bacteria | 611 |
| 43 | Ga0070710_10238260 | 3300005437 | Unclassified | 1164 |
| 44 | Ga0070701_10170856 | 3300005438 | Bacteria | 1266 |
| 45 | Ga0070711_100212198 | 3300005439 | Bacteria | 1500 |
| 46 | Ga0070711_101304529 | 3300005439 | Bacteria | 630 |
| 47 | Ga0070705_100276861 | 3300005440 | Unclassified | 1191 |
| 48 | Ga0070700_100967684 | 3300005441 | Unclassified | 698 |
| 49 | Ga0070694_100384147 | 3300005444 | Unclassified | 1096 |
| 50 | Ga0070708_100055671 | 3300005445 | Bacteria | 3517 |
| 51 | Ga0070663_100033590 | 3300005455 | Bacteria | 3545 |
| 52 | Ga0070663_100395683 | 3300005455 | Unclassified | 1128 |
| 53 | Ga0070663_100694832 | 3300005455 | Bacteria | 864 |
| 54 | Ga0070663_101151367 | 3300005455 | Unclassified | 680 |
| 55 | Ga0070678_100046139 | 3300005456 | Bacteria | 3122 |
| 56 | Ga0070662_100249098 | 3300005457 | Bacteria | 1427 |
| 57 | Ga0070681_10046052 | 3300005458 | Bacteria | 4362 |
| 58 | Ga0070681_10119474 | 3300005458 | Bacteria | 2572 |
| 59 | Ga0070681_10127221 | 3300005458 | Bacteria | 2481 |
| 60 | Ga0070681_10742757 | 3300005458 | Bacteria | 898 |
| 61 | Ga0070706_100152926 | 3300005467 | Unclassified | 2154 |
| 62 | Ga0070706_101296077 | 3300005467 | Unclassified | 668 |
| 63 | Ga0070699_100033580 | 3300005518 | Bacteria | 4432 |
| 64 | Ga0070699_101233864 | 3300005518 | Bacteria | 686 |
| 65 | Ga0070679_100049582 | 3300005530 | Bacteria | 4181 |
| 66 | Ga0070679_100399292 | 3300005530 | Unclassified | 1321 |
| 67 | Ga0070679_100437992 | 3300005530 | Bacteria | 1252 |
| 68 | Ga0070679_100467399 | 3300005530 | Unclassified | 1206 |
| 69 | Ga0070679_100660922 | 3300005530 | Bacteria | 988 |
| 70 | Ga0070679_100955283 | 3300005530 | Unclassified | 801 |
| 71 | Ga0070684_100207530 | 3300005535 | Bacteria | 1785 |
| 72 | Ga0070684_100284655 | 3300005535 | Bacteria | 1515 |
| 73 | Ga0070697_100000266 | 3300005536 | Bacteria | 42492 |
| 74 | Ga0070697_100016981 | 3300005536 | Bacteria | 5722 |
| 75 | Ga0070697_100408550 | 3300005536 | Bacteria | 1179 |
| 76 | Ga0068853_100041185 | 3300005539 | Bacteria | 3944 |
| 77 | Ga0068853_100229656 | 3300005539 | Bacteria | 1697 |
| 78 | Ga0068853_100510593 | 3300005539 | Unclassified | 1135 |
| 79 | Ga0068853_101618226 | 3300005539 | Bacteria | 628 |
| 80 | Ga0068853_102106453 | 3300005539 | Bacteria | 547 |
| 81 | Ga0070672_100923081 | 3300005543 | Unclassified | 772 |
| 82 | Ga0070695_100025319 | 3300005545 | Bacteria | 3663 |
| 83 | Ga0070695_100417563 | 3300005545 | Bacteria | 1021 |
| 84 | Ga0070696_100094269 | 3300005546 | Unclassified | 2136 |
| 85 | Ga0070696_100586584 | 3300005546 | Bacteria | 897 |
| 86 | Ga0070693_100143738 | 3300005547 | Bacteria | 1504 |
| 87 | Ga0070665_100318952 | 3300005548 | Bacteria | 1558 |
| 88 | Ga0070665_100446507 | 3300005548 | Bacteria | 1303 |
| 89 | Ga0070665_102597989 | 3300005548 | Unclassified | 507 |
| 90 | Ga0070704_100603799 | 3300005549 | Unclassified | 965 |
| 91 | Ga0070704_100939558 | 3300005549 | Bacteria | 779 |
| 92 | Ga0070704_101836865 | 3300005549 | Unclassified | 561 |
| 93 | Ga0068855_100087433 | 3300005563 | Bacteria | 3602 |
| 94 | Ga0068855_100155965 | 3300005563 | Bacteria | 2594 |
| 95 | Ga0068855_100258887 | 3300005563 | Bacteria | 1939 |
| 96 | Ga0068855_100315592 | 3300005563 | Bacteria | 1729 |
| 97 | Ga0068855_101190303 | 3300005563 | Unclassified | 793 |
| 98 | Ga0070664_100351996 | 3300005564 | Bacteria | 1340 |
| 99 | Ga0068857_101940943 | 3300005577 | Bacteria | 577 |
| 100 | Ga0068854_100043691 | 3300005578 | Bacteria | 3178 |
| 101 | Ga0068854_100104793 | 3300005578 | Bacteria | 2125 |
| 102 | Ga0068854_100238966 | 3300005578 | Unclassified | 1446 |
| 103 | Ga0068854_100287448 | 3300005578 | Bacteria | 1326 |
| 104 | Ga0068854_100749780 | 3300005578 | Unclassified | 847 |
| 105 | Ga0068856_100024981 | 3300005614 | Bacteria | 5823 |
| 106 | Ga0068856_100248374 | 3300005614 | Bacteria | 1794 |
| 107 | Ga0068856_100540882 | 3300005614 | Unclassified | 1186 |
| 108 | Ga0068856_100684407 | 3300005614 | Unclassified | 1046 |
| 109 | Ga0068856_100704711 | 3300005614 | Unclassified | 1030 |
| 110 | Ga0070702_100636664 | 3300005615 | Bacteria | 804 |
| 111 | Ga0068852_100298539 | 3300005616 | Unclassified | 1558 |
| 112 | Ga0068852_100760022 | 3300005616 | Bacteria | 982 |
| 113 | Ga0068859_100527611 | 3300005617 | Bacteria | 1275 |
| 114 | Ga0068859_101521524 | 3300005617 | Bacteria | 739 |
| 115 | Ga0068864_100322714 | 3300005618 | Bacteria | 1451 |
| 116 | Ga0068864_101964353 | 3300005618 | Unclassified | 591 |
| 117 | Ga0068863_100050637 | 3300005841 | Bacteria | 3936 |
| 118 | Ga0068863_100460622 | 3300005841 | Bacteria | 1249 |
| 119 | Ga0068863_100584215 | 3300005841 | Bacteria | 1105 |
| 120 | Ga0068863_101633693 | 3300005841 | Bacteria | 654 |
| 121 | Ga0068863_101682735 | 3300005841 | Unclassified | 644 |
| 122 | Ga0068858_100030314 | 3300005842 | Bacteria | 5022 |
| 123 | Ga0068858_100273219 | 3300005842 | Bacteria | 1608 |
| 124 | Ga0068858_101628300 | 3300005842 | Unclassified | 637 |
| 125 | Ga0068860_100324231 | 3300005843 | Unclassified | 1512 |
| 126 | Ga0068860_100899063 | 3300005843 | Bacteria | 901 |
| 127 | Ga0068862_100901398 | 3300005844 | Bacteria | 869 |
| 128 | Ga0081455_10004184 | 3300005937 | Bacteria | 16266 |
| 129 | Ga0070717_10068012 | 3300006028 | Unclassified | 2965 |
| 130 | Ga0070717_10481493 | 3300006028 | Unclassified | 1121 |
| 131 | Ga0070717_11593265 | 3300006028 | Bacteria | 592 |
| 132 | Ga0070715_10335111 | 3300006163 | Unclassified | 821 |
| 133 | Ga0070712_100075878 | 3300006175 | Bacteria | 2419 |
| 134 | Ga0070712_100235822 | 3300006175 | Unclassified | 1455 |
| 135 | Ga0070712_101042394 | 3300006175 | Unclassified | 709 |
| 136 | Ga0097621_100007315 | 3300006237 | Bacteria | 7890 |
| 137 | Ga0097621_100682690 | 3300006237 | Bacteria | 944 |
| 138 | Ga0097621_100724618 | 3300006237 | Bacteria | 917 |
| 139 | Ga0068871_100227225 | 3300006358 | Bacteria | 1619 |
| 140 | Ga0075430_100297808 | 3300006846 | Bacteria | 1334 |
| 141 | Ga0075430_100509003 | 3300006846 | Bacteria | 994 |
| 142 | Ga0075431_100042438 | 3300006847 | Bacteria | 4692 |
| 143 | Ga0075431_100085458 | 3300006847 | Bacteria | 3256 |
| 144 | Ga0075433_10000203 | 3300006852 | Bacteria | 33282 |
| 145 | Ga0075434_100000016 | 3300006871 | Bacteria | 75294 |
| 146 | Ga0075434_101146878 | 3300006871 | Bacteria | 790 |
| 147 | Ga0075429_100398463 | 3300006880 | Bacteria | 1205 |
| 148 | Ga0075429_100542347 | 3300006880 | Unclassified | 1019 |
| 149 | Ga0075436_100000459 | 3300006914 | Bacteria | 26338 |
| 150 | Ga0075436_100002867 | 3300006914 | Bacteria | 11813 |
| 151 | Ga0075436_100194387 | 3300006914 | Unclassified | 1436 |
| 152 | Ga0075436_101155473 | 3300006914 | Unclassified | 584 |
| 153 | Ga0097620_100527607 | 3300006931 | Bacteria | 1275 |
| 154 | Ga0097620_101521486 | 3300006931 | Bacteria | 739 |
| 155 | Ga0075435_100000506 | 3300007076 | Bacteria | 23788 |
| 156 | Ga0075435_100635593 | 3300007076 | Unclassified | 926 |
| 157 | Ga0105240_10002088 | 3300009093 | Bacteria | 32712 |
| 158 | Ga0105240_10149958 | 3300009093 | Bacteria | 2778 |
| 159 | Ga0105245_10450640 | 3300009098 | Bacteria | 1295 |
| 160 | Ga0105245_11708203 | 3300009098 | Unclassified | 682 |
| 161 | Ga0105245_12682055 | 3300009098 | Bacteria | 551 |
| 162 | Ga0114129_10759829 | 3300009147 | Bacteria | 1240 |
| 163 | Ga0105243_10145398 | 3300009148 | Bacteria | 2028 |
| 164 | Ga0105243_11715446 | 3300009148 | Unclassified | 657 |
| 165 | Ga0105241_10106337 | 3300009174 | Bacteria | 2239 |
| 166 | Ga0105241_10187817 | 3300009174 | Unclassified | 1718 |
| 167 | Ga0105241_10741515 | 3300009174 | Unclassified | 900 |
| 168 | Ga0105241_11063385 | 3300009174 | Unclassified | 760 |
| 169 | Ga0105242_10646886 | 3300009176 | Bacteria | 1028 |
| 170 | Ga0105248_10077157 | 3300009177 | Unclassified | 3745 |
| 171 | Ga0105248_10169672 | 3300009177 | Bacteria | 2459 |
| 172 | Ga0105248_10474731 | 3300009177 | Bacteria | 1410 |
| 173 | Ga0105248_10628412 | 3300009177 | Bacteria | 1212 |
| 174 | Ga0105248_10795101 | 3300009177 | Bacteria | 1068 |
| 175 | Ga0105248_11199708 | 3300009177 | Unclassified | 858 |
| 176 | Ga0105248_11218921 | 3300009177 | Bacteria | 851 |
| 177 | Ga0105248_11592660 | 3300009177 | Unclassified | 740 |
| 178 | Ga0105248_12394612 | 3300009177 | Bacteria | 601 |
| 179 | Ga0105237_10015531 | 3300009545 | Bacteria | 7921 |
| 180 | Ga0105237_10030803 | 3300009545 | Bacteria | 5445 |
| 181 | Ga0105237_11056578 | 3300009545 | Unclassified | 819 |
| 182 | Ga0105237_12662997 | 3300009545 | Bacteria | 511 |
| 183 | Ga0105238_10033919 | 3300009551 | Bacteria | 5194 |
| 184 | Ga0105238_10452275 | 3300009551 | Bacteria | 1281 |
| 185 | Ga0105238_10744848 | 3300009551 | Bacteria | 993 |
| 186 | Ga0105238_11412438 | 3300009551 | Unclassified | 723 |
| 187 | Ga0105239_10170611 | 3300010375 | Unclassified | 2433 |
| 188 | Ga0105239_10534812 | 3300010375 | Bacteria | 1334 |
| 189 | Ga0105246_10319173 | 3300011119 | Bacteria | 1262 |
| 190 | Ga0157373_10147182 | 3300013100 | Bacteria | 1657 |
| 191 | Ga0157371_10029385 | 3300013102 | Bacteria | 3976 |
| 192 | Ga0157371_10157061 | 3300013102 | Bacteria | 1624 |
| 193 | Ga0157371_11353919 | 3300013102 | Bacteria | 552 |
| 194 | Ga0157370_10041967 | 3300013104 | Bacteria | 4410 |
| 195 | Ga0157370_10226486 | 3300013104 | Bacteria | 1731 |
| 196 | Ga0157370_10367084 | 3300013104 | Bacteria | 1326 |
| 197 | Ga0157370_11105634 | 3300013104 | Unclassified | 716 |
| 198 | Ga0157369_10009232 | 3300013105 | Bacteria | 11281 |
| 199 | Ga0157369_10068636 | 3300013105 | Bacteria | 3809 |
| 200 | Ga0157369_10154328 | 3300013105 | Bacteria | 2426 |
| 201 | Ga0157369_10224820 | 3300013105 | Unclassified | 1964 |
| 202 | Ga0157369_10255562 | 3300013105 | Bacteria | 1828 |
| 203 | Ga0157369_10274695 | 3300013105 | Unclassified | 1755 |
| 204 | Ga0157369_10564127 | 3300013105 | Bacteria | 1176 |
| 205 | Ga0157369_10970255 | 3300013105 | Unclassified | 871 |
| 206 | Ga0157369_11823365 | 3300013105 | Unclassified | 618 |
| 207 | Ga0157369_12409023 | 3300013105 | Unclassified | 533 |
| 208 | Ga0157374_10013550 | 3300013296 | Bacteria | 7119 |
| 209 | Ga0157374_10030856 | 3300013296 | Bacteria | 4868 |
| 210 | Ga0157374_10077725 | 3300013296 | Unclassified | 3141 |
| 211 | Ga0157374_10239007 | 3300013296 | Bacteria | 1786 |
| 212 | Ga0157378_10760313 | 3300013297 | Bacteria | 992 |
| 213 | Ga0163162_10573224 | 3300013306 | Bacteria | 1256 |
| 214 | Ga0163162_11053105 | 3300013306 | Bacteria | 921 |
| 215 | Ga0163162_13424265 | 3300013306 | Unclassified | 506 |
| 216 | Ga0157372_10128287 | 3300013307 | Bacteria | 2917 |
| 217 | Ga0157372_10878519 | 3300013307 | Bacteria | 1040 |
| 218 | Ga0157372_12844629 | 3300013307 | Bacteria | 555 |
| 219 | Ga0157375_10775236 | 3300013308 | Unclassified | 1109 |
| 220 | Ga0163163_10067044 | 3300014325 | Bacteria | 3567 |
| 221 | Ga0163163_10219870 | 3300014325 | Bacteria | 1948 |
| 222 | Ga0163163_10735028 | 3300014325 | Bacteria | 1050 |
| 223 | Ga0163163_10781443 | 3300014325 | Bacteria | 1018 |
| 224 | Ga0163163_12905139 | 3300014325 | Bacteria | 535 |
| 225 | Ga0157380_12486401 | 3300014326 | Bacteria | 583 |
| 226 | Ga0157377_10687905 | 3300014745 | Bacteria | 741 |
| 227 | Ga0157377_10838956 | 3300014745 | Bacteria | 681 |
| 228 | Ga0157377_11240071 | 3300014745 | Unclassified | 579 |
| 229 | Ga0157379_10079032 | 3300014968 | Unclassified | 2946 |
| 230 | Ga0157379_10231471 | 3300014968 | Bacteria | 1675 |
| 231 | Ga0157379_12285972 | 3300014968 | Unclassified | 538 |
| 232 | Ga0157376_10536721 | 3300014969 | Bacteria | 1155 |
| 233 | Ga0197907_10117008 | 3300020069 | Unclassified | 2217 |
| 234 | Ga0197907_10148484 | 3300020069 | Unclassified | 501 |
| 235 | Ga0197907_11513990 | 3300020069 | Bacteria | 1049 |
| 236 | Ga0206356_11763115 | 3300020070 | Bacteria | 2662 |
| 237 | Ga0206355_1330800 | 3300020076 | Unclassified | 641 |
| 238 | Ga0206352_10006240 | 3300020078 | Bacteria | 618 |
| 239 | Ga0206352_10237891 | 3300020078 | Unclassified | 810 |
| 240 | Ga0206352_10705776 | 3300020078 | Bacteria | 755 |
| 241 | Ga0206350_10396530 | 3300020080 | Bacteria | 703 |
| 242 | Ga0206350_11081444 | 3300020080 | Unclassified | 1440 |
| 243 | Ga0206350_11117227 | 3300020080 | Bacteria | 1217 |
| 244 | Ga0206350_11414327 | 3300020080 | Bacteria | 565 |
| 245 | Ga0206353_10687506 | 3300020082 | Bacteria | 599 |
| 246 | Ga0213873_10006946 | 3300021358 | Bacteria | 2248 |
| 247 | Ga0213873_10189651 | 3300021358 | Unclassified | 634 |
| 248 | Ga0213873_10310709 | 3300021358 | Unclassified | 510 |
| 249 | Ga0213872_10000604 | 3300021361 | Bacteria | 27278 |
| 250 | Ga0213872_10120067 | 3300021361 | Bacteria | 1163 |
| 251 | Ga0213874_10133635 | 3300021377 | Bacteria | 854 |
| 252 | Ga0213874_10259706 | 3300021377 | Unclassified | 643 |
| 253 | Ga0213874_10362572 | 3300021377 | Unclassified | 557 |
| 254 | Ga0213876_10005778 | 3300021384 | Bacteria | 6774 |
| 255 | Ga0213876_10021829 | 3300021384 | Bacteria | 3386 |
| 256 | Ga0213876_10033279 | 3300021384 | Unclassified | 2718 |
| 257 | Ga0213876_10063857 | 3300021384 | Bacteria | 1944 |
| 258 | Ga0213876_10124656 | 3300021384 | Bacteria | 1368 |
| 259 | Ga0213876_10141655 | 3300021384 | Bacteria | 1279 |
| 260 | Ga0213876_10176816 | 3300021384 | Unclassified | 1135 |
| 261 | Ga0213875_10000008 | 3300021388 | Bacteria | 533344 |
| 262 | Ga0213875_10000531 | 3300021388 | Bacteria | 31479 |
| 263 | Ga0213875_10002973 | 3300021388 | Bacteria | 9876 |
| 264 | Ga0213875_10006380 | 3300021388 | Bacteria | 6205 |
| 265 | Ga0213875_10026139 | 3300021388 | Unclassified | 2778 |
| 266 | Ga0213875_10029238 | 3300021388 | Unclassified | 2614 |
| 267 | Ga0213875_10040709 | 3300021388 | Bacteria | 2188 |
| 268 | Ga0213875_10048290 | 3300021388 | Bacteria | 1997 |
| 269 | Ga0213875_10050327 | 3300021388 | Bacteria | 1952 |
| 270 | Ga0213875_10050554 | 3300021388 | Unclassified | 1947 |
| 271 | Ga0213875_10070112 | 3300021388 | Bacteria | 1636 |
| 272 | Ga0213875_10204394 | 3300021388 | Bacteria | 929 |
| 273 | Ga0213875_10277929 | 3300021388 | Unclassified | 791 |
| 274 | Ga0213875_10340867 | 3300021388 | Unclassified | 711 |
| 275 | Ga0213875_10521004 | 3300021388 | Unclassified | 572 |
| 276 | Ga0213871_10000878 | 3300021441 | Bacteria | 4576 |
| 277 | Ga0224712_10087153 | 3300022467 | Unclassified | 1300 |
| 278 | Ga0224712_10227841 | 3300022467 | Bacteria | 855 |
| 279 | Ga0224712_10251200 | 3300022467 | Bacteria | 817 |
| 280 | Ga0207692_10175576 | 3300025898 | Unclassified | 1244 |
| 281 | Ga0207680_10997884 | 3300025903 | Bacteria | 600 |
| 282 | Ga0207647_10398610 | 3300025904 | Unclassified | 775 |
| 283 | Ga0207647_10417034 | 3300025904 | Bacteria | 755 |
| 284 | Ga0207685_10311850 | 3300025905 | Unclassified | 782 |
| 285 | Ga0207685_10707993 | 3300025905 | Unclassified | 549 |
| 286 | Ga0207699_10684579 | 3300025906 | Unclassified | 750 |
| 287 | Ga0207699_10800115 | 3300025906 | Bacteria | 693 |
| 288 | Ga0207699_11489142 | 3300025906 | Unclassified | 501 |
| 289 | Ga0207705_10319983 | 3300025909 | Unclassified | 1192 |
| 290 | Ga0207705_10426277 | 3300025909 | Unclassified | 1027 |
| 291 | Ga0207684_10967241 | 3300025910 | Unclassified | 713 |
| 292 | Ga0207684_11173509 | 3300025910 | Unclassified | 637 |
| 293 | Ga0207654_10127800 | 3300025911 | Unclassified | 1605 |
| 294 | Ga0207654_10277414 | 3300025911 | Unclassified | 1133 |
| 295 | Ga0207707_10065705 | 3300025912 | Bacteria | 3159 |
| 296 | Ga0207707_10172216 | 3300025912 | Bacteria | 1892 |
| 297 | Ga0207707_11058017 | 3300025912 | Bacteria | 663 |
| 298 | Ga0207707_11228223 | 3300025912 | Bacteria | 605 |
| 299 | Ga0207695_10017373 | 3300025913 | Bacteria | 8371 |
| 300 | Ga0207695_10030294 | 3300025913 | Bacteria | 5959 |
| 301 | Ga0207695_10571630 | 3300025913 | Unclassified | 1012 |
| 302 | Ga0207671_10026181 | 3300025914 | Bacteria | 4373 |
| 303 | Ga0207671_10042048 | 3300025914 | Unclassified | 3383 |
| 304 | Ga0207671_10356120 | 3300025914 | Bacteria | 1161 |
| 305 | Ga0207671_11047018 | 3300025914 | Bacteria | 642 |
| 306 | Ga0207671_11437839 | 3300025914 | Bacteria | 534 |
| 307 | Ga0207693_10377397 | 3300025915 | Bacteria | 1109 |
| 308 | Ga0207663_10145448 | 3300025916 | Bacteria | 1657 |
| 309 | Ga0207663_10507055 | 3300025916 | Unclassified | 938 |
| 310 | Ga0207663_10850619 | 3300025916 | Bacteria | 728 |
| 311 | Ga0207660_10789145 | 3300025917 | Unclassified | 775 |
| 312 | Ga0207660_10953229 | 3300025917 | Bacteria | 700 |
| 313 | Ga0207660_11705533 | 3300025917 | Unclassified | 507 |
| 314 | Ga0207657_10122027 | 3300025919 | Bacteria | 2143 |
| 315 | Ga0207649_10135130 | 3300025920 | Bacteria | 1680 |
| 316 | Ga0207652_10344626 | 3300025921 | Bacteria | 1345 |
| 317 | Ga0207652_10484184 | 3300025921 | Bacteria | 1114 |
| 318 | Ga0207652_10938019 | 3300025921 | Unclassified | 763 |
| 319 | Ga0207694_10132043 | 3300025924 | Bacteria | 2002 |
| 320 | Ga0207694_10991329 | 3300025924 | Bacteria | 711 |
| 321 | Ga0207694_11144704 | 3300025924 | Unclassified | 658 |
| 322 | Ga0207650_10293589 | 3300025925 | Bacteria | 1326 |
| 323 | Ga0207687_10181335 | 3300025927 | Bacteria | 1632 |
| 324 | Ga0207687_10769866 | 3300025927 | Bacteria | 820 |
| 325 | Ga0207687_11041787 | 3300025927 | Unclassified | 702 |
| 326 | Ga0207687_11819676 | 3300025927 | Unclassified | 521 |
| 327 | Ga0207700_10244730 | 3300025928 | Unclassified | 1530 |
| 328 | Ga0207664_10160959 | 3300025929 | Bacteria | 1914 |
| 329 | Ga0207664_10322392 | 3300025929 | Bacteria | 1363 |
| 330 | Ga0207664_10921324 | 3300025929 | Unclassified | 784 |
| 331 | Ga0207664_10939507 | 3300025929 | Bacteria | 776 |
| 332 | Ga0207664_11570491 | 3300025929 | Unclassified | 580 |
| 333 | Ga0207644_10704564 | 3300025931 | Bacteria | 842 |
| 334 | Ga0207644_11158081 | 3300025931 | Unclassified | 650 |
| 335 | Ga0207690_10122664 | 3300025932 | Bacteria | 1890 |
| 336 | Ga0207690_11575681 | 3300025932 | Unclassified | 549 |
| 337 | Ga0207706_10581896 | 3300025933 | Bacteria | 962 |
| 338 | Ga0207686_10039932 | 3300025934 | Bacteria | 2850 |
| 339 | Ga0207670_10375465 | 3300025936 | Bacteria | 1131 |
| 340 | Ga0207691_11409512 | 3300025940 | Unclassified | 572 |
| 341 | Ga0207711_10123641 | 3300025941 | Bacteria | 2312 |
| 342 | Ga0207711_10383884 | 3300025941 | Bacteria | 1304 |
| 343 | Ga0207711_10701951 | 3300025941 | Bacteria | 944 |
| 344 | Ga0207711_11034074 | 3300025941 | Bacteria | 761 |
| 345 | Ga0207689_10535137 | 3300025942 | Bacteria | 983 |
| 346 | Ga0207661_10005809 | 3300025944 | Bacteria | 8701 |
| 347 | Ga0207661_10080738 | 3300025944 | Unclassified | 2684 |
| 348 | Ga0207661_10239101 | 3300025944 | Bacteria | 1611 |
| 349 | Ga0207679_10437280 | 3300025945 | Bacteria | 1158 |
| 350 | Ga0207667_10134107 | 3300025949 | Bacteria | 2550 |
| 351 | Ga0207667_10217214 | 3300025949 | Bacteria | 1959 |
| 352 | Ga0207667_10389995 | 3300025949 | Bacteria | 1418 |
| 353 | Ga0207667_10576894 | 3300025949 | Unclassified | 1136 |
| 354 | Ga0207667_11322889 | 3300025949 | Unclassified | 696 |
| 355 | Ga0207667_11708141 | 3300025949 | Unclassified | 596 |
| 356 | Ga0207651_11131277 | 3300025960 | Bacteria | 702 |
| 357 | Ga0207640_10223477 | 3300025981 | Bacteria | 1443 |
| 358 | Ga0207640_10232897 | 3300025981 | Bacteria | 1418 |
| 359 | Ga0207640_10717589 | 3300025981 | Unclassified | 859 |
| 360 | Ga0207640_10946443 | 3300025981 | Bacteria | 755 |
| 361 | Ga0207658_10399265 | 3300025986 | Bacteria | 1208 |
| 362 | Ga0207658_10422848 | 3300025986 | Bacteria | 1175 |
| 363 | Ga0207658_12037209 | 3300025986 | Bacteria | 522 |
| 364 | Ga0207677_10030672 | 3300026023 | Bacteria | 3435 |
| 365 | Ga0207677_11058546 | 3300026023 | Bacteria | 738 |
| 366 | Ga0207703_10354122 | 3300026035 | Bacteria | 1352 |
| 367 | Ga0207703_11523215 | 3300026035 | Unclassified | 643 |
| 368 | Ga0207703_12329600 | 3300026035 | Unclassified | 511 |
| 369 | Ga0207639_10050423 | 3300026041 | Unclassified | 3161 |
| 370 | Ga0207639_10050924 | 3300026041 | Bacteria | 3147 |
| 371 | Ga0207639_10123213 | 3300026041 | Unclassified | 2133 |
| 372 | Ga0207639_11283546 | 3300026041 | Bacteria | 687 |
| 373 | Ga0207678_10118771 | 3300026067 | Unclassified | 2256 |
| 374 | Ga0207678_10754931 | 3300026067 | Bacteria | 858 |
| 375 | Ga0207678_11319866 | 3300026067 | Bacteria | 638 |
| 376 | Ga0207678_11655863 | 3300026067 | Unclassified | 563 |
| 377 | Ga0207678_11774546 | 3300026067 | Unclassified | 541 |
| 378 | Ga0207708_11148388 | 3300026075 | Bacteria | 678 |
| 379 | Ga0207702_10048176 | 3300026078 | Bacteria | 3593 |
| 380 | Ga0207702_10257969 | 3300026078 | Bacteria | 1640 |
| 381 | Ga0207702_10267560 | 3300026078 | Unclassified | 1611 |
| 382 | Ga0207702_10668425 | 3300026078 | Unclassified | 1022 |
| 383 | Ga0207641_10015837 | 3300026088 | Bacteria | 6174 |
| 384 | Ga0207641_10400872 | 3300026088 | Bacteria | 1317 |
| 385 | Ga0207641_10771996 | 3300026088 | Unclassified | 950 |
| 386 | Ga0207648_10659225 | 3300026089 | Bacteria | 968 |
| 387 | Ga0207676_10954141 | 3300026095 | Unclassified | 843 |
| 388 | Ga0207674_10411370 | 3300026116 | Bacteria | 1307 |
| 389 | Ga0207674_10835437 | 3300026116 | Bacteria | 888 |
| 390 | Ga0207674_10944438 | 3300026116 | Bacteria | 831 |
| 391 | Ga0207683_10360685 | 3300026121 | Bacteria | 1335 |
| 392 | Ga0207683_10611024 | 3300026121 | Bacteria | 1009 |
| 393 | Ga0207698_10080053 | 3300026142 | Unclassified | 2630 |
| 394 | Ga0268266_10150356 | 3300028379 | Unclassified | 2098 |
| 395 | Ga0268266_10752674 | 3300028379 | Bacteria | 940 |
| 396 | Ga0268264_10231403 | 3300028381 | Unclassified | 1707 |
| 397 | Ga0265326_10089837 | 3300028558 | Unclassified | 870 |
| 398 | Ga0265319_1086758 | 3300028563 | Unclassified | 990 |
| 399 | Ga0265318_10057093 | 3300028577 | Unclassified | 1459 |
| 400 | Ga0265323_10241265 | 3300028653 | Unclassified | 563 |
| 401 | Ga0265338_10012644 | 3300028800 | Bacteria | 9610 |
| 402 | Ga0265338_10079554 | 3300028800 | Unclassified | 2758 |
| 403 | Ga0265324_10023178 | 3300029957 | Bacteria | 2213 |
| 404 | Ga0265760_10045693 | 3300031090 | Archaea | 1313 |
| 405 | Ga0265330_10128943 | 3300031235 | Unclassified | 1077 |
| 406 | Ga0265330_10348042 | 3300031235 | Unclassified | 626 |
| 407 | Ga0265328_10009924 | 3300031239 | Bacteria | 3852 |
| 408 | Ga0265320_10059887 | 3300031240 | Bacteria | 1819 |
| 409 | Ga0265325_10015390 | 3300031241 | Bacteria | 4300 |
| 410 | Ga0265325_10063391 | 3300031241 | Unclassified | 1870 |
| 411 | Ga0265329_10036382 | 3300031242 | Unclassified | 1587 |
| 412 | Ga0265340_10037949 | 3300031247 | Bacteria | 2385 |
| 413 | Ga0265339_10102501 | 3300031249 | Unclassified | 1487 |
| 414 | Ga0265331_10002235 | 3300031250 | Bacteria | 13252 |
| 415 | Ga0265331_10048448 | 3300031250 | Unclassified | 2043 |
| 416 | Ga0265316_10004839 | 3300031344 | Bacteria | 13275 |
| 417 | Ga0265316_10005224 | 3300031344 | Bacteria | 12688 |
| 418 | Ga0265316_10084938 | 3300031344 | Unclassified | 2423 |
| 419 | Ga0265316_10203080 | 3300031344 | Unclassified | 1468 |
| 420 | Ga0265316_10452537 | 3300031344 | Unclassified | 921 |
| 421 | Ga0265316_10592430 | 3300031344 | Bacteria | 787 |
| 422 | Ga0307408_100319692 | 3300031548 | Bacteria | 1307 |
| 423 | Ga0265313_10056517 | 3300031595 | Bacteria | 1856 |
| 424 | Ga0265314_10007710 | 3300031711 | Bacteria | 9307 |
| 425 | Ga0265314_10032599 | 3300031711 | Bacteria | 3831 |
| 426 | Ga0265342_10049946 | 3300031712 | Bacteria | 2501 |
| 427 | Ga0265342_10576113 | 3300031712 | Unclassified | 569 |
| 428 | Ga0265342_10602977 | 3300031712 | Unclassified | 554 |
| 429 | Ga0307413_10923161 | 3300031824 | Bacteria | 743 |
| 430 | Ga0307413_11746301 | 3300031824 | Bacteria | 556 |
| 431 | Ga0307412_11741969 | 3300031911 | Unclassified | 572 |
| 432 | Ga0307416_101929057 | 3300032002 | Unclassified | 694 |
| 433 | Ga0373926_0063253 | 3300035083 | Bacteria | 1351 |
| 434 | Ga0373926_0129638 | 3300035083 | Unclassified | 954 |
| 435 | Ga0373923_0211049 | 3300035111 | Unclassified | 900 |
| 436 | Ga0373923_0515056 | 3300035111 | Bacteria | 584 |
| 437 | Ga0373936_0087822 | 3300035113 | Unclassified | 1301 |
| 438 | Ga0373936_0241510 | 3300035113 | Bacteria | 805 |
| 439 | Ga0373945_0149742 | 3300035116 | Bacteria | 945 |
| 440 | Ga0373945_0278461 | 3300035116 | Bacteria | 712 |
| 441 | Ga0373945_0430575 | 3300035116 | Unclassified | 581 |
| 442 | Ga0373943_0009063 | 3300035170 | Bacteria | 4461 |
| 443 | Ga0373946_0110327 | 3300035171 | Bacteria | 1244 |
| 444 | Ga0373955_0317991 | 3300035172 | Bacteria | 940 |
| 445 | Ga0373924_0211529 | 3300035410 | Bacteria | 856 |
| 446 | Ga0373935_0051208 | 3300035692 | Bacteria | 2622 |
| 447 | Ga0373927_0002368 | 3300035695 | Bacteria | 13732 |
| 448 | Ga0373927_0002636 | 3300035695 | Bacteria | 13075 |
| 449 | Ga0373927_0029363 | 3300035695 | Bacteria | 3584 |
| 450 | Ga0373927_0172729 | 3300035695 | Unclassified | 1417 |
| 451 | Ga0373927_0248307 | 3300035695 | Unclassified | 1170 |
| 452 | Ga0373933_0684920 | 3300035724 | Bacteria | 674 |
| 453 | Ga0373947_0011446 | 3300035725 | Bacteria | 5090 |
| 454 | Ga0373947_0070285 | 3300035725 | Unclassified | 2145 |
| 455 | Ga0373947_0198738 | 3300035725 | Bacteria | 1311 |
| 456 | Ga0373937_0300286 | 3300036401 | Unclassified | 1518 |
| 457 | Ga0373937_0665591 | 3300036401 | Bacteria | 987 |
| 458 | Ga0373937_1017475 | 3300036401 | Bacteria | 777 |
| 459 | Ga0373937_1130130 | 3300036401 | Bacteria | 732 |
| 460 | Ga0373937_1668119 | 3300036401 | Unclassified | 584 |
| 461 | Ga0373925_0097371 | 3300037068 | Bacteria | 2256 |
| 462 | Ga0373925_0895357 | 3300037068 | Unclassified | 731 |
| 463 | Ga0373925_1109395 | 3300037068 | Bacteria | 651 |
| 464 | Ga0395900_1320565 | 3300037418 | Unclassified | 635 |
| 465 | Ga0395900_1742780 | 3300037418 | Unclassified | 534 |
| 466 | Ga0436364_0186735 | 3300037853 | Bacteria | 7242 |
| 467 | Ga0436364_0189094 | 3300037853 | Bacteria | 1310 |
| 468 | Ga0436364_0202477 | 3300037853 | Unclassified | 3008 |
| 469 | Ga0436364_0232521 | 3300037853 | Unclassified | 556 |
| 470 | Ga0436364_0232980 | 3300037853 | Bacteria | 4348 |
| 471 | Ga0436364_0264121 | 3300037853 | Bacteria | 2719 |
| 472 | Ga0436364_0302930 | 3300037853 | Bacteria | 2827 |
| 473 | Ga0436364_0396555 | 3300037853 | Bacteria | 14391 |
| 474 | Ga0436364_0421693 | 3300037853 | Bacteria | 3901 |
| 475 | Ga0436364_0508356 | 3300037853 | Unclassified | 1276 |
| 476 | Ga0436364_0625675 | 3300037853 | Unclassified | 3831 |
| 477 | Ga0436364_0660048 | 3300037853 | Unclassified | 631 |
| 478 | Ga0436364_0704934 | 3300037853 | Bacteria | 632 |
| 479 | Ga0436364_0825238 | 3300037853 | Bacteria | 1284 |
| 480 | Ga0436364_0845477 | 3300037853 | Bacteria | 3977 |
| 481 | Ga0436364_0877214 | 3300037853 | Bacteria | 3174 |
| 482 | Ga0436364_0877566 | 3300037853 | Bacteria | 12351 |
| 483 | Ga0436364_0900019 | 3300037853 | Bacteria | 4884 |
| 484 | Ga0436364_0929350 | 3300037853 | Bacteria | 660 |
| 485 | Ga0436364_0968307 | 3300037853 | Bacteria | 1556 |
| 486 | Ga0436364_1021072 | 3300037853 | Unclassified | 573 |
| 487 | Ga0436364_1062827 | 3300037853 | Bacteria | 9205 |
| 488 | Ga0436364_1105375 | 3300037853 | Bacteria | 139847 |
| 489 | Ga0436364_1114375 | 3300037853 | Bacteria | 616 |
| 490 | Ga0436364_1243063 | 3300037853 | Unclassified | 719 |
| 491 | Ga0436364_1348537 | 3300037853 | Bacteria | 4316 |
| 492 | Ga0436364_1415525 | 3300037853 | Bacteria | 425173 |
| 493 | Ga0436364_1426312 | 3300037853 | Bacteria | 3513 |
| 494 | Ga0436364_1501008 | 3300037853 | Unclassified | 576 |
| 495 | Ga0436364_1521922 | 3300037853 | Unclassified | 556 |
| 496 | Ga0436364_1525817 | 3300037853 | Bacteria | 608 |
| 497 | Ga0436364_1528712 | 3300037853 | Bacteria | 1640 |
| 498 | Ga0395901_0314352 | 3300038443 | Unclassified | 1622 |
| 499 | Ga0436365_0188890 | 3300039437 | Bacteria | 1583 |
| 500 | Ga0436365_0346997 | 3300039437 | Bacteria | 4079 |
| 501 | Ga0436365_0397466 | 3300039437 | Bacteria | 16718 |
| 502 | Ga0436365_0447678 | 3300039437 | Unclassified | 2718 |
| 503 | Ga0436365_0625113 | 3300039437 | Bacteria | 2689 |
| 504 | Ga0436365_0632242 | 3300039437 | Unclassified | 780 |
| 505 | Ga0436365_0655522 | 3300039437 | Bacteria | 1586 |
| 506 | Ga0436365_0728868 | 3300039437 | Bacteria | 1714 |
| 507 | Ga0436365_0764285 | 3300039437 | Unclassified | 673 |
| 508 | Ga0436365_1117349 | 3300039437 | Bacteria | 1266 |
| 509 | Ga0436365_1140671 | 3300039437 | Bacteria | 5316 |
| 510 | Ga0436365_1271429 | 3300039437 | Unclassified | 797 |
| 511 | Ga0436365_1466075 | 3300039437 | Bacteria | 1087 |
| 512 | Ga0436365_1536530 | 3300039437 | Bacteria | 2875 |
| 513 | Ga0436365_1560696 | 3300039437 | Bacteria | 2388 |
| 514 | Ga0436365_1826930 | 3300039437 | Unclassified | 724 |
| 515 | Ga0436360_0040295 | 3300039438 | Bacteria | 1366 |
| 516 | Ga0436360_0076998 | 3300039438 | Bacteria | 538 |
| 517 | Ga0436360_1047605 | 3300039438 | Unclassified | 533 |
| 518 | Ga0436360_1169859 | 3300039438 | Bacteria | 10148 |
| 519 | Ga0436360_1369303 | 3300039438 | Unclassified | 980 |
| 520 | Ga0436361_0001003 | 3300039447 | Unclassified | 592 |
| 521 | Ga0436361_0092626 | 3300039447 | Bacteria | 5612 |
| 522 | Ga0436361_0434431 | 3300039447 | Bacteria | 90700 |
| 523 | Ga0436363_0040787 | 3300039450 | Bacteria | 843 |
| 524 | Ga0436363_0107334 | 3300039450 | Bacteria | 4652 |
| 525 | Ga0436363_0145412 | 3300039450 | Unclassified | 504 |
| 526 | Ga0436363_0439413 | 3300039450 | Bacteria | 573 |
| 527 | Ga0436363_0565568 | 3300039450 | Unclassified | 826 |
| 528 | Ga0436363_0588470 | 3300039450 | Unclassified | 500 |
| 529 | Ga0436363_0667533 | 3300039450 | Unclassified | 757 |
| 530 | Ga0436363_0771817 | 3300039450 | Bacteria | 1115 |
| 531 | Ga0436363_0778100 | 3300039450 | Bacteria | 4035 |
| 532 | Ga0436363_0839432 | 3300039450 | Bacteria | 821 |
| 533 | Ga0436363_1076290 | 3300039450 | Bacteria | 1161 |
| 534 | Ga0436363_1439406 | 3300039450 | Bacteria | 3289 |
| 535 | Ga0436363_1523540 | 3300039450 | Unclassified | 1304 |
| 536 | Ga0436362_0197304 | 3300039453 | Bacteria | 828 |
| 537 | Ga0436362_0584771 | 3300039453 | Bacteria | 812 |
| 538 | Ga0436362_0609058 | 3300039453 | Bacteria | 1854 |
| 539 | Ga0436362_0611735 | 3300039453 | Bacteria | 628 |
| 540 | Ga0436362_0925983 | 3300039453 | Unclassified | 637 |
| 541 | Ga0436362_0940117 | 3300039453 | Bacteria | 502 |
| 542 | Ga0436362_1094764 | 3300039453 | Bacteria | 4941 |
| 543 | Ga0436362_1194511 | 3300039453 | Bacteria | 1059 |
| 544 | Ga0451849_1097332 | 3300041505 | Unclassified | 562 |
| 545 | Ga0466963_0090704 | 3300044694 | Unclassified | 2081 |
| 546 | Ga0466963_0329008 | 3300044694 | Bacteria | 1076 |
| 547 | Ga0466963_0614836 | 3300044694 | Unclassified | 767 |
| 548 | Ga0466963_0696924 | 3300044694 | Bacteria | 717 |
| 549 | Ga0453684_0815050 | 3300044712 | Bacteria | 1006 |
| 550 | Ga0453684_0958256 | 3300044712 | Unclassified | 913 |
| 551 | Ga0453684_1341098 | 3300044712 | Unclassified | 744 |
| 552 | Ga0466971_0381689 | 3300044719 | Bacteria | 685 |
| 553 | Ga0466957_0226645 | 3300044842 | Unclassified | 1236 |
| 554 | Ga0466957_0689319 | 3300044842 | Bacteria | 720 |
| 555 | Ga0466959_0949401 | 3300045049 | Bacteria | 573 |
| 556 | Ga0451576_0019383 | 3300045051 | Bacteria | 7427 |
| 557 | Ga0451576_1773790 | 3300045051 | Unclassified | 638 |
| 558 | Ga0451576_2405092 | 3300045051 | Bacteria | 539 |
| 559 | Ga0451576_2717614 | 3300045051 | Unclassified | 504 |
| 560 | Ga0466958_0194804 | 3300045836 | Bacteria | 1289 |
| 561 | Ga0466958_0556474 | 3300045836 | Unclassified | 745 |
| 562 | Ga0466958_0568806 | 3300045836 | Bacteria | 737 |
| 563 | Ga0466967_0119153 | 3300045976 | Bacteria | 2436 |
| 564 | Ga0466967_0219752 | 3300045976 | Bacteria | 1805 |
| 565 | Ga0466967_1031975 | 3300045976 | Bacteria | 819 |
| 566 | Ga0466967_1713329 | 3300045976 | Unclassified | 626 |
| 567 | Ga0495592_0142639 | 3300046454 | Bacteria | 1664 |
| 568 | Ga0495592_0370459 | 3300046454 | Unclassified | 914 |
| 569 | Ga0495651_0104732 | 3300046462 | Bacteria | 2100 |
| 570 | Ga0495651_0142291 | 3300046462 | Bacteria | 1738 |
| 571 | Ga0495651_0563055 | 3300046462 | Unclassified | 723 |
| 572 | Ga0495653_0467396 | 3300046463 | Bacteria | 791 |
| 573 | Ga0495580_0192186 | 3300046472 | Bacteria | 1408 |
| 574 | Ga0495580_0309199 | 3300046472 | Bacteria | 1075 |
| 575 | Ga0495639_0403804 | 3300046475 | Bacteria | 690 |
| 576 | Ga0495664_0096465 | 3300046477 | Unclassified | 1780 |
| 577 | Ga0495664_0232409 | 3300046477 | Bacteria | 1116 |
| 578 | Ga0495594_0633626 | 3300046499 | Unclassified | 606 |
| 579 | Ga0495618_0639952 | 3300046514 | Unclassified | 630 |
| 580 | Ga0495628_0383871 | 3300046516 | Bacteria | 1028 |
| 581 | Ga0495665_0014059 | 3300046531 | Bacteria | 4323 |
| 582 | Ga0495586_0096949 | 3300046535 | Bacteria | 1634 |
| 583 | Ga0495587_0483414 | 3300046536 | Unclassified | 685 |
| 584 | Ga0495667_0977330 | 3300046559 | Unclassified | 517 |
| 585 | Ga0495635_0029277 | 3300046663 | Bacteria | 3829 |
| 586 | Ga0495635_0276827 | 3300046663 | Bacteria | 1128 |
| 587 | Ga0495599_0058453 | 3300046678 | Bacteria | 2412 |
| 588 | Ga0495623_0066551 | 3300046679 | Bacteria | 2251 |
| 589 | Ga0495646_0189166 | 3300046680 | Bacteria | 1126 |
| 590 | Ga0495658_0428027 | 3300046683 | Bacteria | 845 |
| 591 | Ga0495669_0029992 | 3300046684 | Bacteria | 2387 |
| 592 | Ga0495600_0173754 | 3300046809 | Bacteria | 1390 |
| 593 | Ga0495581_0088528 | 3300047315 | Bacteria | 1795 |
| 594 | Ga0495636_0054735 | 3300047318 | Unclassified | 1677 |
| 595 | Ga0495674_0221808 | 3300047319 | Bacteria | 1562 |
| 596 | Ga0495676_0782637 | 3300047321 | Unclassified | 615 |
| 597 | Ga0495675_0449985 | 3300047444 | Bacteria | 745 |
| 598 | Ga0495675_0471298 | 3300047444 | Bacteria | 724 |
| 599 | Ga0495684_0451504 | 3300047471 | Unclassified | 893 |
| 600 | Ga0495686_0534139 | 3300047472 | Unclassified | 614 |
| 601 | Ga0495602_0854175 | 3300048088 | Unclassified | 608 |
| 602 | Ga0495602_0913619 | 3300048088 | Bacteria | 583 |
| 603 | Ga0496100_0788431 | 3300048903 | Bacteria | 744 |
| 604 | Ga0496100_1444960 | 3300048903 | Bacteria | 543 |
| 605 | Ga0496102_0160184 | 3300048905 | Bacteria | 2117 |
| 606 | Ga0496102_0614572 | 3300048905 | Bacteria | 1010 |
| 607 | Ga0496104_0955344 | 3300048907 | Bacteria | 761 |
| 608 | Ga0496104_1075320 | 3300048907 | Unclassified | 708 |
| 609 | Ga0496105_0623090 | 3300048908 | Bacteria | 835 |
| 610 | Ga0496108_0750646 | 3300048911 | Unclassified | 844 |
| 611 | Ga0496109_0733366 | 3300048912 | Bacteria | 926 |
| 612 | Ga0496109_1339649 | 3300048912 | Bacteria | 652 |
| 613 | Ga0496110_0304780 | 3300048913 | Bacteria | 1451 |
| 614 | Ga0496112_0009787 | 3300048915 | Bacteria | 8657 |
| 615 | Ga0496112_0030443 | 3300048915 | Bacteria | 5224 |
| 616 | Ga0496113_0143534 | 3300048916 | Bacteria | 1880 |
| 617 | Ga0496115_0331042 | 3300048918 | Bacteria | 1244 |
| 618 | Ga0496126_0123113 | 3300048929 | Bacteria | 2247 |
| 619 | Ga0501031_0654999 | 3300049568 | Unclassified | 675 |
| 620 | Ga0501032_0805269 | 3300049569 | Unclassified | 593 |
| 621 | Ga0501033_0211176 | 3300049570 | Unclassified | 1384 |
| 622 | Ga0501033_0232774 | 3300049570 | Bacteria | 1308 |
| 623 | Ga0501034_0014605 | 3300049571 | Bacteria | 8086 |
| 624 | Ga0501034_0136916 | 3300049571 | Unclassified | 2429 |
| 625 | Ga0501034_1047578 | 3300049571 | Unclassified | 698 |
| 626 | Ga0501036_0027378 | 3300049572 | Unclassified | 4817 |
| 627 | Ga0501038_0127904 | 3300049574 | Unclassified | 2089 |
| 628 | Ga0501038_0629748 | 3300049574 | Unclassified | 809 |
| 629 | Ga0501043_0006526 | 3300049579 | Bacteria | 9359 |
| 630 | Ga0501046_0175306 | 3300049580 | Unclassified | 1606 |
| 631 | Ga0501046_0222225 | 3300049580 | Bacteria | 1398 |
| 632 | Ga0501046_0828742 | 3300049580 | Unclassified | 647 |
| 633 | Ga0501047_0023118 | 3300049581 | Bacteria | 5968 |
| 634 | Ga0501047_0120492 | 3300049581 | Unclassified | 2506 |
| 635 | Ga0501047_0266968 | 3300049581 | Bacteria | 1558 |
| 636 | Ga0501067_0658660 | 3300049583 | Unclassified | 588 |
| 637 | Ga0501070_0162096 | 3300049586 | Bacteria | 1843 |
| 638 | Ga0501070_0436745 | 3300049586 | Bacteria | 1056 |
| 639 | Ga0501073_0099139 | 3300049589 | Bacteria | 2023 |
| 640 | Ga0501075_0757145 | 3300049591 | Bacteria | 739 |
| 641 | Ga0501076_0198197 | 3300049592 | Bacteria | 1639 |
| 642 | Ga0501243_070303 | 3300049675 | Bacteria | 664 |
| 643 | Ga0501080_0251297 | 3300049742 | Unclassified | 1612 |
| 644 | Ga0501080_0513174 | 3300049742 | Bacteria | 1070 |
| 645 | Ga0501083_0361203 | 3300049744 | Bacteria | 944 |
| 646 | Ga0501083_0477184 | 3300049744 | Unclassified | 812 |
| 647 | Ga0501035_0012051 | 3300049822 | Bacteria | 7998 |
| 648 | Ga0501035_0158028 | 3300049822 | Bacteria | 1964 |
| 649 | Ga0501035_1539857 | 3300049822 | Unclassified | 506 |
| 650 | Ga0501044_0001806 | 3300049823 | Bacteria | 24933 |
| 651 | Ga0501044_0002981 | 3300049823 | Bacteria | 19200 |
| 652 | Ga0501044_0034509 | 3300049823 | Bacteria | 5304 |
| 653 | Ga0501044_0061261 | 3300049823 | Unclassified | 3850 |
| 654 | nmdc:mga09592_501462_c1 | 3300050508 | Unclassified | 1045 |
| 655 | nmdc:mga0qj67_13897_c2 | 3300050509 | Bacteria | 3115 |
| 656 | nmdc:mga06r32_16670_c1 | 3300050510 | Bacteria | 6695 |
| 657 | nmdc:mga08y16_579630_c1 | 3300050511 | Unclassified | 1133 |
| 658 | nmdc:mga0n895_825817_c1 | 3300050512 | Bacteria | 916 |
| 659 | nmdc:mga0rr50_182698_c1 | 3300050513 | Bacteria | 1715 |
| 660 | nmdc:mga08x19_1203887_c1 | 3300050514 | Unclassified | 537 |
| 661 | nmdc:mga08x19_178915_c1 | 3300050514 | Bacteria | 1447 |
| 662 | nmdc:mga08x19_798033_c1 | 3300050514 | Bacteria | 670 |
| 663 | nmdc:mga08x19_9104_c1 | 3300050514 | Bacteria | 5928 |
| 664 | Ga0495601_0437730 | 3300053077 | Unclassified | 846 |
| 665 | Ga0495601_0934930 | 3300053077 | Bacteria | 547 |
| 666 | Ga0500568_0002007 | 3300053139 | Bacteria | 12388 |
| 667 | Ga0466962_0321335 | 3300061719 | Unclassified | 768 |
| 668 | Ga0495635_0249017 | |||
| 669 | Ga0058862_12769342 | |||
| 670 | Ga0058862_12846478 | |||
| 671 | Ga0070658_10426613 | |||
| 672 | Ga0070683_100066846 | |||
| 673 | Ga0070683_100211480 | |||
| 674 | Ga0070683_100409748 | |||
| 675 | Ga0070683_101299812 | |||
| 676 | Ga0068869_101863800 | |||
| 677 | Ga0070680_100053548 | |||
| 678 | Ga0070680_100183589 | |||
| 679 | Ga0070682_100274201 | |||
| 680 | Ga0070682_100492566 | |||
| 681 | Ga0068868_100072786 | |||
| 682 | Ga0068868_100275045 | |||
| 683 | Ga0068868_101106442 | |||
| 684 | Ga0070660_100576321 | |||
| 685 | Ga0070689_100084030 | |||
| 686 | Ga0070689_100419069 | |||
| 687 | Ga0070689_100632964 | |||
| 688 | Ga0070692_10041886 | |||
| 689 | Ga0070671_100197579 | |||
| 690 | Ga0070671_101445990 | |||
| 691 | Ga0070671_101510729 | |||
| 692 | Ga0070673_102403685 | |||
| 693 | Ga0070659_100081584 | |||
| 694 | Ga0070659_100446865 | |||
| 695 | Ga0070659_100514863 | |||
| 696 | Ga0070667_100049395 | |||
| 697 | Ga0070667_100434375 | |||
| 698 | Ga0070709_10620024 | |||
| 699 | Ga0070709_11087026 | |||
| 700 | Ga0070709_11783760 | |||
| 701 | Ga0070714_100067282 | |||
| 702 | Ga0070714_100141607 | |||
| 703 | Ga0070714_100207552 | |||
| 704 | Ga0070714_100573498 | |||
| 705 | Ga0070714_100849504 | |||
| 706 | Ga0070713_100121100 | |||
| 707 | Ga0070713_100334976 | |||
| 708 | Ga0070713_101115001 | |||
| 709 | Ga0070713_101705765 | |||
| 710 | Ga0070710_10238260 | |||
| 711 | Ga0070701_10170856 | |||
| 712 | Ga0070711_100212198 | |||
| 713 | Ga0070711_101304529 | |||
| 714 | Ga0070705_100276861 | |||
| 715 | Ga0070700_100967684 | |||
| 716 | Ga0070694_100384147 | |||
| 717 | Ga0070708_100055671 | |||
| 718 | Ga0070663_100033590 | |||
| 719 | Ga0070663_100395683 | |||
| 720 | Ga0070663_100694832 | |||
| 721 | Ga0070663_101151367 | |||
| 722 | Ga0070678_100046139 | |||
| 723 | Ga0070662_100249098 | |||
| 724 | Ga0070681_10046052 | |||
| 725 | Ga0070681_10119474 | |||
| 726 | Ga0070681_10127221 | |||
| 727 | Ga0070681_10742757 | |||
| 728 | Ga0070706_100152926 | |||
| 729 | Ga0070706_101296077 | |||
| 730 | Ga0070699_100033580 | |||
| 731 | Ga0070699_101233864 | |||
| 732 | Ga0070679_100049582 | |||
| 733 | Ga0070679_100399292 | |||
| 734 | Ga0070679_100437992 | |||
| 735 | Ga0070679_100467399 | |||
| 736 | Ga0070679_100660922 | |||
| 737 | Ga0070679_100955283 | |||
| 738 | Ga0070684_100207530 | |||
| 739 | Ga0070684_100284655 | |||
| 740 | Ga0070697_100000266 | |||
| 741 | Ga0070697_100016981 | |||
| 742 | Ga0070697_100408550 | |||
| 743 | Ga0068853_100041185 | |||
| 744 | Ga0068853_100229656 | |||
| 745 | Ga0068853_100510593 | |||
| 746 | Ga0068853_101618226 | |||
| 747 | Ga0068853_102106453 | |||
| 748 | Ga0070672_100923081 | |||
| 749 | Ga0070695_100025319 | |||
| 750 | Ga0070695_100417563 | |||
| 751 | Ga0070696_100094269 | |||
| 752 | Ga0070696_100586584 | |||
| 753 | Ga0070693_100143738 | |||
| 754 | Ga0070665_100318952 | |||
| 755 | Ga0070665_100446507 | |||
| 756 | Ga0070665_102597989 | |||
| 757 | Ga0070704_100603799 | |||
| 758 | Ga0070704_100939558 | |||
| 759 | Ga0070704_101836865 | |||
| 760 | Ga0068855_100087433 | |||
| 761 | Ga0068855_100155965 | |||
| 762 | Ga0068855_100258887 | |||
| 763 | Ga0068855_100315592 | |||
| 764 | Ga0068855_101190303 | |||
| 765 | Ga0070664_100351996 | |||
| 766 | Ga0068857_101940943 | |||
| 767 | Ga0068854_100043691 | |||
| 768 | Ga0068854_100104793 | |||
| 769 | Ga0068854_100238966 | |||
| 770 | Ga0068854_100287448 | |||
| 771 | Ga0068854_100749780 | |||
| 772 | Ga0068856_100024981 | |||
| 773 | Ga0068856_100248374 | |||
| 774 | Ga0068856_100540882 | |||
| 775 | Ga0068856_100684407 | |||
| 776 | Ga0068856_100704711 | |||
| 777 | Ga0070702_100636664 | |||
| 778 | Ga0068852_100298539 | |||
| 779 | Ga0068852_100760022 | |||
| 780 | Ga0068859_100527611 | |||
| 781 | Ga0068859_101521524 | |||
| 782 | Ga0068864_100322714 | |||
| 783 | Ga0068864_101964353 | |||
| 784 | Ga0068863_100050637 | |||
| 785 | Ga0068863_100460622 | |||
| 786 | Ga0068863_100584215 | |||
| 787 | Ga0068863_101633693 | |||
| 788 | Ga0068863_101682735 | |||
| 789 | Ga0068858_100030314 | |||
| 790 | Ga0068858_100273219 | |||
| 791 | Ga0068858_101628300 | |||
| 792 | Ga0068860_100324231 | |||
| 793 | Ga0068860_100899063 | |||
| 794 | Ga0068862_100901398 | |||
| 795 | Ga0081455_10004184 | |||
| 796 | Ga0070717_10068012 | |||
| 797 | Ga0070717_10481493 | |||
| 798 | Ga0070717_11593265 | |||
| 799 | Ga0070715_10335111 | |||
| 800 | Ga0070712_100075878 | |||
| 801 | Ga0070712_100235822 | |||
| 802 | Ga0070712_101042394 | |||
| 803 | Ga0097621_100007315 | |||
| 804 | Ga0097621_100682690 | |||
| 805 | Ga0097621_100724618 | |||
| 806 | Ga0068871_100227225 | |||
| 807 | Ga0075430_100297808 | |||
| 808 | Ga0075430_100509003 | |||
| 809 | Ga0075431_100042438 | |||
| 810 | Ga0075431_100085458 | |||
| 811 | Ga0075433_10000203 | |||
| 812 | Ga0075434_100000016 | |||
| 813 | Ga0075434_101146878 | |||
| 814 | Ga0075429_100398463 | |||
| 815 | Ga0075429_100542347 | |||
| 816 | Ga0075436_100000459 | |||
| 817 | Ga0075436_100002867 | |||
| 818 | Ga0075436_100194387 | |||
| 819 | Ga0075436_101155473 | |||
| 820 | Ga0097620_100527607 | |||
| 821 | Ga0097620_101521486 | |||
| 822 | Ga0075435_100000506 | |||
| 823 | Ga0075435_100635593 | |||
| 824 | Ga0105240_10002088 | |||
| 825 | Ga0105240_10149958 | |||
| 826 | Ga0105245_10450640 | |||
| 827 | Ga0105245_11708203 | |||
| 828 | Ga0105245_12682055 | |||
| 829 | Ga0114129_10759829 | |||
| 830 | Ga0105243_10145398 | |||
| 831 | Ga0105243_11715446 | |||
| 832 | Ga0105241_10106337 | |||
| 833 | Ga0105241_10187817 | |||
| 834 | Ga0105241_10741515 | |||
| 835 | Ga0105241_11063385 | |||
| 836 | Ga0105242_10646886 | |||
| 837 | Ga0105248_10077157 | |||
| 838 | Ga0105248_10169672 | |||
| 839 | Ga0105248_10474731 | |||
| 840 | Ga0105248_10628412 | |||
| 841 | Ga0105248_10795101 | |||
| 842 | Ga0105248_11199708 | |||
| 843 | Ga0105248_11218921 | |||
| 844 | Ga0105248_11592660 | |||
| 845 | Ga0105248_12394612 | |||
| 846 | Ga0105237_10015531 | |||
| 847 | Ga0105237_10030803 | |||
| 848 | Ga0105237_11056578 | |||
| 849 | Ga0105237_12662997 | |||
| 850 | Ga0105238_10033919 | |||
| 851 | Ga0105238_10452275 | |||
| 852 | Ga0105238_10744848 | |||
| 853 | Ga0105238_11412438 | |||
| 854 | Ga0105239_10170611 | |||
| 855 | Ga0105239_10534812 | |||
| 856 | Ga0105246_10319173 | |||
| 857 | Ga0157373_10147182 | |||
| 858 | Ga0157371_10029385 | |||
| 859 | Ga0157371_10157061 | |||
| 860 | Ga0157371_11353919 | |||
| 861 | Ga0157370_10041967 | |||
| 862 | Ga0157370_10226486 | |||
| 863 | Ga0157370_10367084 | |||
| 864 | Ga0157370_11105634 | |||
| 865 | Ga0157369_10009232 | |||
| 866 | Ga0157369_10068636 | |||
| 867 | Ga0157369_10154328 | |||
| 868 | Ga0157369_10224820 | |||
| 869 | Ga0157369_10255562 | |||
| 870 | Ga0157369_10274695 | |||
| 871 | Ga0157369_10564127 | |||
| 872 | Ga0157369_10970255 | |||
| 873 | Ga0157369_11823365 | |||
| 874 | Ga0157369_12409023 | |||
| 875 | Ga0157374_10013550 | |||
| 876 | Ga0157374_10030856 | |||
| 877 | Ga0157374_10077725 | |||
| 878 | Ga0157374_10239007 | |||
| 879 | Ga0157378_10760313 | |||
| 880 | Ga0163162_10573224 | |||
| 881 | Ga0163162_11053105 | |||
| 882 | Ga0163162_13424265 | |||
| 883 | Ga0157372_10128287 | |||
| 884 | Ga0157372_10878519 | |||
| 885 | Ga0157372_12844629 | |||
| 886 | Ga0157375_10775236 | |||
| 887 | Ga0163163_10067044 | |||
| 888 | Ga0163163_10219870 | |||
| 889 | Ga0163163_10735028 | |||
| 890 | Ga0163163_10781443 | |||
| 891 | Ga0163163_12905139 | |||
| 892 | Ga0157380_12486401 | |||
| 893 | Ga0157377_10687905 | |||
| 894 | Ga0157377_10838956 | |||
| 895 | Ga0157377_11240071 | |||
| 896 | Ga0157379_10079032 | |||
| 897 | Ga0157379_10231471 | |||
| 898 | Ga0157379_12285972 | |||
| 899 | Ga0157376_10536721 | |||
| 900 | Ga0197907_10117008 | |||
| 901 | Ga0197907_10148484 | |||
| 902 | Ga0197907_11513990 | |||
| 903 | Ga0206356_11763115 | |||
| 904 | Ga0206355_1330800 | |||
| 905 | Ga0206352_10006240 | |||
| 906 | Ga0206352_10237891 | |||
| 907 | Ga0206352_10705776 | |||
| 908 | Ga0206350_10396530 | |||
| 909 | Ga0206350_11081444 | |||
| 910 | Ga0206350_11117227 | |||
| 911 | Ga0206350_11414327 | |||
| 912 | Ga0206353_10687506 | |||
| 913 | Ga0213873_10006946 | |||
| 914 | Ga0213873_10189651 | |||
| 915 | Ga0213873_10310709 | |||
| 916 | Ga0213872_10000604 | |||
| 917 | Ga0213872_10120067 | |||
| 918 | Ga0213874_10133635 | |||
| 919 | Ga0213874_10259706 | |||
| 920 | Ga0213874_10362572 | |||
| 921 | Ga0213876_10005778 | |||
| 922 | Ga0213876_10021829 | |||
| 923 | Ga0213876_10033279 | |||
| 924 | Ga0213876_10063857 | |||
| 925 | Ga0213876_10124656 | |||
| 926 | Ga0213876_10141655 | |||
| 927 | Ga0213876_10176816 | |||
| 928 | Ga0213875_10000008 | |||
| 929 | Ga0213875_10000531 | |||
| 930 | Ga0213875_10002973 | |||
| 931 | Ga0213875_10006380 | |||
| 932 | Ga0213875_10026139 | |||
| 933 | Ga0213875_10029238 | |||
| 934 | Ga0213875_10040709 | |||
| 935 | Ga0213875_10048290 | |||
| 936 | Ga0213875_10050327 | |||
| 937 | Ga0213875_10050554 | |||
| 938 | Ga0213875_10070112 | |||
| 939 | Ga0213875_10204394 | |||
| 940 | Ga0213875_10277929 | |||
| 941 | Ga0213875_10340867 | |||
| 942 | Ga0213875_10521004 | |||
| 943 | Ga0213871_10000878 | |||
| 944 | Ga0224712_10087153 | |||
| 945 | Ga0224712_10227841 | |||
| 946 | Ga0224712_10251200 | |||
| 947 | Ga0207692_10175576 | |||
| 948 | Ga0207680_10997884 | |||
| 949 | Ga0207647_10398610 | |||
| 950 | Ga0207647_10417034 | |||
| 951 | Ga0207685_10311850 | |||
| 952 | Ga0207685_10707993 | |||
| 953 | Ga0207699_10684579 | |||
| 954 | Ga0207699_10800115 | |||
| 955 | Ga0207699_11489142 | |||
| 956 | Ga0207705_10319983 | |||
| 957 | Ga0207705_10426277 | |||
| 958 | Ga0207684_10967241 | |||
| 959 | Ga0207684_11173509 | |||
| 960 | Ga0207654_10127800 | |||
| 961 | Ga0207654_10277414 | |||
| 962 | Ga0207707_10065705 | |||
| 963 | Ga0207707_10172216 | |||
| 964 | Ga0207707_11058017 | |||
| 965 | Ga0207707_11228223 | |||
| 966 | Ga0207695_10017373 | |||
| 967 | Ga0207695_10030294 | |||
| 968 | Ga0207695_10571630 | |||
| 969 | Ga0207671_10026181 | |||
| 970 | Ga0207671_10042048 | |||
| 971 | Ga0207671_10356120 | |||
| 972 | Ga0207671_11047018 | |||
| 973 | Ga0207671_11437839 | |||
| 974 | Ga0207693_10377397 | |||
| 975 | Ga0207663_10145448 | |||
| 976 | Ga0207663_10507055 | |||
| 977 | Ga0207663_10850619 | |||
| 978 | Ga0207660_10789145 | |||
| 979 | Ga0207660_10953229 | |||
| 980 | Ga0207660_11705533 | |||
| 981 | Ga0207657_10122027 | |||
| 982 | Ga0207649_10135130 | |||
| 983 | Ga0207652_10344626 | |||
| 984 | Ga0207652_10484184 | |||
| 985 | Ga0207652_10938019 | |||
| 986 | Ga0207694_10132043 | |||
| 987 | Ga0207694_10991329 | |||
| 988 | Ga0207694_11144704 | |||
| 989 | Ga0207650_10293589 | |||
| 990 | Ga0207687_10181335 | |||
| 991 | Ga0207687_10769866 | |||
| 992 | Ga0207687_11041787 | |||
| 993 | Ga0207687_11819676 | |||
| 994 | Ga0207700_10244730 | |||
| 995 | Ga0207664_10160959 | |||
| 996 | Ga0207664_10322392 | |||
| 997 | Ga0207664_10921324 | |||
| 998 | Ga0207664_10939507 | |||
| 999 | Ga0207664_11570491 | |||
| 1000 | Ga0207644_10704564 | |||
| 1001 | Ga0207644_11158081 | |||
| 1002 | Ga0207690_10122664 | |||
| 1003 | Ga0207690_11575681 | |||
| 1004 | Ga0207706_10581896 | |||
| 1005 | Ga0207686_10039932 | |||
| 1006 | Ga0207670_10375465 | |||
| 1007 | Ga0207691_11409512 | |||
| 1008 | Ga0207711_10123641 | |||
| 1009 | Ga0207711_10383884 | |||
| 1010 | Ga0207711_10701951 | |||
| 1011 | Ga0207711_11034074 | |||
| 1012 | Ga0207689_10535137 | |||
| 1013 | Ga0207661_10005809 | |||
| 1014 | Ga0207661_10080738 | |||
| 1015 | Ga0207661_10239101 | |||
| 1016 | Ga0207679_10437280 | |||
| 1017 | Ga0207667_10134107 | |||
| 1018 | Ga0207667_10217214 | |||
| 1019 | Ga0207667_10389995 | |||
| 1020 | Ga0207667_10576894 | |||
| 1021 | Ga0207667_11322889 | |||
| 1022 | Ga0207667_11708141 | |||
| 1023 | Ga0207651_11131277 | |||
| 1024 | Ga0207640_10223477 | |||
| 1025 | Ga0207640_10232897 | |||
| 1026 | Ga0207640_10717589 | |||
| 1027 | Ga0207640_10946443 | |||
| 1028 | Ga0207658_10399265 | |||
| 1029 | Ga0207658_10422848 | |||
| 1030 | Ga0207658_12037209 | |||
| 1031 | Ga0207677_10030672 | |||
| 1032 | Ga0207677_11058546 | |||
| 1033 | Ga0207703_10354122 | |||
| 1034 | Ga0207703_11523215 | |||
| 1035 | Ga0207703_12329600 | |||
| 1036 | Ga0207639_10050423 | |||
| 1037 | Ga0207639_10050924 | |||
| 1038 | Ga0207639_10123213 | |||
| 1039 | Ga0207639_11283546 | |||
| 1040 | Ga0207678_10118771 | |||
| 1041 | Ga0207678_10754931 | |||
| 1042 | Ga0207678_11319866 | |||
| 1043 | Ga0207678_11655863 | |||
| 1044 | Ga0207678_11774546 | |||
| 1045 | Ga0207708_11148388 | |||
| 1046 | Ga0207702_10048176 | |||
| 1047 | Ga0207702_10257969 | |||
| 1048 | Ga0207702_10267560 | |||
| 1049 | Ga0207702_10668425 | |||
| 1050 | Ga0207641_10015837 | |||
| 1051 | Ga0207641_10400872 | |||
| 1052 | Ga0207641_10771996 | |||
| 1053 | Ga0207648_10659225 | |||
| 1054 | Ga0207676_10954141 | |||
| 1055 | Ga0207674_10411370 | |||
| 1056 | Ga0207674_10835437 | |||
| 1057 | Ga0207674_10944438 | |||
| 1058 | Ga0207683_10360685 | |||
| 1059 | Ga0207683_10611024 | |||
| 1060 | Ga0207698_10080053 | |||
| 1061 | Ga0268266_10150356 | |||
| 1062 | Ga0268266_10752674 | |||
| 1063 | Ga0268264_10231403 | |||
| 1064 | Ga0265326_10089837 | |||
| 1065 | Ga0265319_1086758 | |||
| 1066 | Ga0265318_10057093 | |||
| 1067 | Ga0265323_10241265 | |||
| 1068 | Ga0265338_10012644 | |||
| 1069 | Ga0265338_10079554 | |||
| 1070 | Ga0265324_10023178 | |||
| 1071 | Ga0265760_10045693 | |||
| 1072 | Ga0265330_10128943 | |||
| 1073 | Ga0265330_10348042 | |||
| 1074 | Ga0265328_10009924 | |||
| 1075 | Ga0265320_10059887 | |||
| 1076 | Ga0265325_10015390 | |||
| 1077 | Ga0265325_10063391 | |||
| 1078 | Ga0265329_10036382 | |||
| 1079 | Ga0265340_10037949 | |||
| 1080 | Ga0265339_10102501 | |||
| 1081 | Ga0265331_10002235 | |||
| 1082 | Ga0265331_10048448 | |||
| 1083 | Ga0265316_10004839 | |||
| 1084 | Ga0265316_10005224 | |||
| 1085 | Ga0265316_10084938 | |||
| 1086 | Ga0265316_10203080 | |||
| 1087 | Ga0265316_10452537 | |||
| 1088 | Ga0265316_10592430 | |||
| 1089 | Ga0307408_100319692 | |||
| 1090 | Ga0265313_10056517 | |||
| 1091 | Ga0265314_10007710 | |||
| 1092 | Ga0265314_10032599 | |||
| 1093 | Ga0265342_10049946 | |||
| 1094 | Ga0265342_10576113 | |||
| 1095 | Ga0265342_10602977 | |||
| 1096 | Ga0307413_10923161 | |||
| 1097 | Ga0307413_11746301 | |||
| 1098 | Ga0307412_11741969 | |||
| 1099 | Ga0307416_101929057 | |||
| 1100 | Ga0373926_0063253 | |||
| 1101 | Ga0373926_0129638 | |||
| 1102 | Ga0373923_0211049 | |||
| 1103 | Ga0373923_0515056 | |||
| 1104 | Ga0373936_0087822 | |||
| 1105 | Ga0373936_0241510 | |||
| 1106 | Ga0373945_0149742 | |||
| 1107 | Ga0373945_0278461 | |||
| 1108 | Ga0373945_0430575 | |||
| 1109 | Ga0373943_0009063 | |||
| 1110 | Ga0373946_0110327 | |||
| 1111 | Ga0373955_0317991 | |||
| 1112 | Ga0373924_0211529 | |||
| 1113 | Ga0373935_0051208 | |||
| 1114 | Ga0373927_0002368 | |||
| 1115 | Ga0373927_0002636 | |||
| 1116 | Ga0373927_0029363 | |||
| 1117 | Ga0373927_0172729 | |||
| 1118 | Ga0373927_0248307 | |||
| 1119 | Ga0373933_0684920 | |||
| 1120 | Ga0373947_0011446 | |||
| 1121 | Ga0373947_0070285 | |||
| 1122 | Ga0373947_0198738 | |||
| 1123 | Ga0373937_0300286 | |||
| 1124 | Ga0373937_0665591 | |||
| 1125 | Ga0373937_1017475 | |||
| 1126 | Ga0373937_1130130 | |||
| 1127 | Ga0373937_1668119 | |||
| 1128 | Ga0373925_0097371 | |||
| 1129 | Ga0373925_0895357 | |||
| 1130 | Ga0373925_1109395 | |||
| 1131 | Ga0395900_1320565 | |||
| 1132 | Ga0395900_1742780 | |||
| 1133 | Ga0436364_0186735 | |||
| 1134 | Ga0436364_0189094 | |||
| 1135 | Ga0436364_0202477 | |||
| 1136 | Ga0436364_0232521 | |||
| 1137 | Ga0436364_0232980 | |||
| 1138 | Ga0436364_0264121 | |||
| 1139 | Ga0436364_0302930 | |||
| 1140 | Ga0436364_0396555 | |||
| 1141 | Ga0436364_0421693 | |||
| 1142 | Ga0436364_0508356 | |||
| 1143 | Ga0436364_0625675 | |||
| 1144 | Ga0436364_0660048 | |||
| 1145 | Ga0436364_0704934 | |||
| 1146 | Ga0436364_0825238 | |||
| 1147 | Ga0436364_0845477 | |||
| 1148 | Ga0436364_0877214 | |||
| 1149 | Ga0436364_0877566 | |||
| 1150 | Ga0436364_0900019 | |||
| 1151 | Ga0436364_0929350 | |||
| 1152 | Ga0436364_0968307 | |||
| 1153 | Ga0436364_1021072 | |||
| 1154 | Ga0436364_1062827 | |||
| 1155 | Ga0436364_1105375 | |||
| 1156 | Ga0436364_1114375 | |||
| 1157 | Ga0436364_1243063 | |||
| 1158 | Ga0436364_1348537 | |||
| 1159 | Ga0436364_1415525 | |||
| 1160 | Ga0436364_1426312 | |||
| 1161 | Ga0436364_1501008 | |||
| 1162 | Ga0436364_1521922 | |||
| 1163 | Ga0436364_1525817 | |||
| 1164 | Ga0436364_1528712 | |||
| 1165 | Ga0395901_0314352 | |||
| 1166 | Ga0436365_0188890 | |||
| 1167 | Ga0436365_0346997 | |||
| 1168 | Ga0436365_0397466 | |||
| 1169 | Ga0436365_0447678 | |||
| 1170 | Ga0436365_0625113 | |||
| 1171 | Ga0436365_0632242 | |||
| 1172 | Ga0436365_0655522 | |||
| 1173 | Ga0436365_0728868 | |||
| 1174 | Ga0436365_0764285 | |||
| 1175 | Ga0436365_1117349 | |||
| 1176 | Ga0436365_1140671 | |||
| 1177 | Ga0436365_1271429 | |||
| 1178 | Ga0436365_1466075 | |||
| 1179 | Ga0436365_1536530 | |||
| 1180 | Ga0436365_1560696 | |||
| 1181 | Ga0436365_1826930 | |||
| 1182 | Ga0436360_0040295 | |||
| 1183 | Ga0436360_0076998 | |||
| 1184 | Ga0436360_1047605 | |||
| 1185 | Ga0436360_1169859 | |||
| 1186 | Ga0436360_1369303 | |||
| 1187 | Ga0436361_0001003 | |||
| 1188 | Ga0436361_0092626 | |||
| 1189 | Ga0436361_0434431 | |||
| 1190 | Ga0436363_0040787 | |||
| 1191 | Ga0436363_0107334 | |||
| 1192 | Ga0436363_0145412 | |||
| 1193 | Ga0436363_0439413 | |||
| 1194 | Ga0436363_0565568 | |||
| 1195 | Ga0436363_0588470 | |||
| 1196 | Ga0436363_0667533 | |||
| 1197 | Ga0436363_0771817 | |||
| 1198 | Ga0436363_0778100 | |||
| 1199 | Ga0436363_0839432 | |||
| 1200 | Ga0436363_1076290 | |||
| 1201 | Ga0436363_1439406 | |||
| 1202 | Ga0436363_1523540 | |||
| 1203 | Ga0436362_0197304 | |||
| 1204 | Ga0436362_0584771 | |||
| 1205 | Ga0436362_0609058 | |||
| 1206 | Ga0436362_0611735 | |||
| 1207 | Ga0436362_0925983 | |||
| 1208 | Ga0436362_0940117 | |||
| 1209 | Ga0436362_1094764 | |||
| 1210 | Ga0436362_1194511 | |||
| 1211 | Ga0451849_1097332 | |||
| 1212 | Ga0466963_0090704 | |||
| 1213 | Ga0466963_0329008 | |||
| 1214 | Ga0466963_0614836 | |||
| 1215 | Ga0466963_0696924 | |||
| 1216 | Ga0453684_0815050 | |||
| 1217 | Ga0453684_0958256 | |||
| 1218 | Ga0453684_1341098 | |||
| 1219 | Ga0466971_0381689 | |||
| 1220 | Ga0466957_0226645 | |||
| 1221 | Ga0466957_0689319 | |||
| 1222 | Ga0466959_0949401 | |||
| 1223 | Ga0451576_0019383 | |||
| 1224 | Ga0451576_1773790 | |||
| 1225 | Ga0451576_2405092 | |||
| 1226 | Ga0451576_2717614 | |||
| 1227 | Ga0466958_0194804 | |||
| 1228 | Ga0466958_0556474 | |||
| 1229 | Ga0466958_0568806 | |||
| 1230 | Ga0466967_0119153 | |||
| 1231 | Ga0466967_0219752 | |||
| 1232 | Ga0466967_1031975 | |||
| 1233 | Ga0466967_1713329 | |||
| 1234 | Ga0495592_0142639 | |||
| 1235 | Ga0495592_0370459 | |||
| 1236 | Ga0495651_0104732 | |||
| 1237 | Ga0495651_0142291 | |||
| 1238 | Ga0495651_0563055 | |||
| 1239 | Ga0495653_0467396 | |||
| 1240 | Ga0495580_0192186 | |||
| 1241 | Ga0495580_0309199 | |||
| 1242 | Ga0495639_0403804 | |||
| 1243 | Ga0495664_0096465 | |||
| 1244 | Ga0495664_0232409 | |||
| 1245 | Ga0495594_0633626 | |||
| 1246 | Ga0495618_0639952 | |||
| 1247 | Ga0495628_0383871 | |||
| 1248 | Ga0495665_0014059 | |||
| 1249 | Ga0495586_0096949 | |||
| 1250 | Ga0495587_0483414 | |||
| 1251 | Ga0495667_0977330 | |||
| 1252 | Ga0495635_0029277 | |||
| 1253 | Ga0495635_0276827 | |||
| 1254 | Ga0495599_0058453 | |||
| 1255 | Ga0495623_0066551 | |||
| 1256 | Ga0495646_0189166 | |||
| 1257 | Ga0495658_0428027 | |||
| 1258 | Ga0495669_0029992 | |||
| 1259 | Ga0495600_0173754 | |||
| 1260 | Ga0495581_0088528 | |||
| 1261 | Ga0495636_0054735 | |||
| 1262 | Ga0495674_0221808 | |||
| 1263 | Ga0495676_0782637 | |||
| 1264 | Ga0495675_0449985 | |||
| 1265 | Ga0495675_0471298 | |||
| 1266 | Ga0495684_0451504 | |||
| 1267 | Ga0495686_0534139 | |||
| 1268 | Ga0495602_0854175 | |||
| 1269 | Ga0495602_0913619 | |||
| 1270 | Ga0496100_0788431 | |||
| 1271 | Ga0496100_1444960 | |||
| 1272 | Ga0496102_0160184 | |||
| 1273 | Ga0496102_0614572 | |||
| 1274 | Ga0496104_0955344 | |||
| 1275 | Ga0496104_1075320 | |||
| 1276 | Ga0496105_0623090 | |||
| 1277 | Ga0496108_0750646 | |||
| 1278 | Ga0496109_0733366 | |||
| 1279 | Ga0496109_1339649 | |||
| 1280 | Ga0496110_0304780 | |||
| 1281 | Ga0496112_0009787 | |||
| 1282 | Ga0496112_0030443 | |||
| 1283 | Ga0496113_0143534 | |||
| 1284 | Ga0496115_0331042 | |||
| 1285 | Ga0496126_0123113 | |||
| 1286 | Ga0501031_0654999 | |||
| 1287 | Ga0501032_0805269 | |||
| 1288 | Ga0501033_0211176 | |||
| 1289 | Ga0501033_0232774 | |||
| 1290 | Ga0501034_0014605 | |||
| 1291 | Ga0501034_0136916 | |||
| 1292 | Ga0501034_1047578 | |||
| 1293 | Ga0501036_0027378 | |||
| 1294 | Ga0501038_0127904 | |||
| 1295 | Ga0501038_0629748 | |||
| 1296 | Ga0501043_0006526 | |||
| 1297 | Ga0501046_0175306 | |||
| 1298 | Ga0501046_0222225 | |||
| 1299 | Ga0501046_0828742 | |||
| 1300 | Ga0501047_0023118 | |||
| 1301 | Ga0501047_0120492 | |||
| 1302 | Ga0501047_0266968 | |||
| 1303 | Ga0501067_0658660 | |||
| 1304 | Ga0501070_0162096 | |||
| 1305 | Ga0501070_0436745 | |||
| 1306 | Ga0501073_0099139 | |||
| 1307 | Ga0501075_0757145 | |||
| 1308 | Ga0501076_0198197 | |||
| 1309 | Ga0501243_070303 | |||
| 1310 | Ga0501080_0251297 | |||
| 1311 | Ga0501080_0513174 | |||
| 1312 | Ga0501083_0361203 | |||
| 1313 | Ga0501083_0477184 | |||
| 1314 | Ga0501035_0012051 | |||
| 1315 | Ga0501035_0158028 | |||
| 1316 | Ga0501035_1539857 | |||
| 1317 | Ga0501044_0001806 | |||
| 1318 | Ga0501044_0002981 | |||
| 1319 | Ga0501044_0034509 | |||
| 1320 | Ga0501044_0061261 | |||
| 1321 | nmdc:mga09592_501462_c1 | |||
| 1322 | nmdc:mga0qj67_13897_c2 | |||
| 1323 | nmdc:mga06r32_16670_c1 | |||
| 1324 | nmdc:mga08y16_579630_c1 | |||
| 1325 | nmdc:mga0n895_825817_c1 | |||
| 1326 | nmdc:mga0rr50_182698_c1 | |||
| 1327 | nmdc:mga08x19_1203887_c1 | |||
| 1328 | nmdc:mga08x19_178915_c1 | |||
| 1329 | nmdc:mga08x19_798033_c1 | |||
| 1330 | nmdc:mga08x19_9104_c1 | |||
| 1331 | Ga0495601_0437730 | |||
| 1332 | Ga0495601_0934930 | |||
| 1333 | Ga0500568_0002007 | |||
| 1334 | Ga0466962_0321335 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy