F473789

General Info

Members Datasets Scaffolds Average Seq Length
666 628 170 396

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10139761|Ga0207674_101397612
Length 478
Sequence MLARLNSKHVVFGLIGIMSAYVLYHNERFLVEPTNPIWEHYQPFKWWLLPHGIFGAIVLLLAPMQFSDRLRRRFTRGHRILGRIYVVGTADTKGEELAFLADAVAKAGGAVIRVDIGTRGATVPVDIPASEVAAHHSKGAGAVLGIDDRGAAVAGMGAAFANFIQSRSDIAGVVGIGXXXXTSIVTAGMRALPLGLPKLMVSTLASGDTAPYVDVSDIIMMPSVTDMAGLNRLSRTVLHNAAQAIAGMAAKPASTAAGKPALGLTMFGVTTPCVTAIVEQVRTGYDCMVFHATGTGGRSMEKLTDSGLLAGVLDITTTEVCDFLFGGVLPSTEDRFGAIARTKLPYVGSVGALDMVNFWAPPTIPEKYRGRLFYEHNPNVTLMRTTAEECHKIGEWIGGRLARCDGPVRFLIPEKGVSALDIEGGAFFDPDADAALFDAIERTIEPTRNRTVTRLPLHINDPAFAKAAASAFLDIAKK

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
13 2512875024 Mesorhizobium loti R88b Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
29 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
30 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
36 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
37 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
38 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
39 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
40 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
41 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
42 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
43 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
44 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
45 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
46 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
47 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
48 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
49 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
50 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
51 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
52 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
53 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
54 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
55 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
56 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
57 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
58 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
59 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
60 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
61 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
62 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
63 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
64 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
65 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
66 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
67 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
68 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
69 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
70 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
71 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
72 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
73 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
74 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
75 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
76 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
77 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
78 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
79 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
80 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
81 2847085930 Erwinia persicina B64 Isolate Bulb
82 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
83 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
84 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
85 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
86 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
87 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
88 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
89 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
90 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
91 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
92 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
93 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
94 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
95 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
96 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
97 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
98 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
99 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
100 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
101 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
102 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
103 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
104 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
105 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
106 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
107 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
108 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
109 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
110 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
111 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
112 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
113 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
114 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
115 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
116 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
117 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
118 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
119 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
120 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
121 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
122 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
123 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
124 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
125 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
126 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
127 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
128 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
129 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
130 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
131 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
132 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
133 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
134 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
135 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
136 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
137 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
138 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
139 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
140 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
141 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
142 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
143 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
144 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
145 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
146 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
147 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
148 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
149 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
150 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
151 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
152 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
153 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
154 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
155 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
156 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
157 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
158 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
159 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
160 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
161 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
162 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
163 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
164 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
165 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
166 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
167 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
168 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
169 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
170 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
171 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
172 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
173 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
174 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
175 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
176 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
177 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
178 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
179 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
180 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
181 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
182 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
183 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
184 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
185 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
186 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
187 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
188 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
189 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
190 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
191 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
192 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
193 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
194 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
195 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
196 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
197 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
198 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
199 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
200 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
201 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
202 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
203 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
204 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
205 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
206 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
207 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
208 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
209 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
210 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
211 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
212 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
213 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
214 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
215 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
216 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
217 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
218 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
219 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
220 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
221 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
222 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
223 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
224 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
225 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
226 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
227 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
228 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
229 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
230 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
231 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
232 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
233 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
234 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
235 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
236 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
237 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
238 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
239 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
240 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
241 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
242 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
243 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
244 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
245 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
246 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
247 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
248 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
249 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
250 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
251 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
252 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
253 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
254 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
255 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
256 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
257 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
258 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
259 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
260 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
261 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
262 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
263 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
264 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
265 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
266 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
267 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
268 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
269 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
270 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
271 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
272 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
273 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
274 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
275 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
276 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
277 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
278 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
279 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
280 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
281 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
282 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
283 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
284 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
285 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
286 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
287 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
288 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
289 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
290 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
291 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
292 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
293 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
294 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
295 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
296 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
297 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
298 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
299 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
300 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
301 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
302 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
303 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
304 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
305 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
306 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
307 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
308 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
309 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
310 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
311 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
312 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
313 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
314 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
315 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
316 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
317 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
318 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
319 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
320 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
321 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
322 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
323 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
324 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
325 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
326 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
327 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
328 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
329 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
330 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
331 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
332 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
333 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
334 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
335 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
336 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
337 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
338 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
339 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
340 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
341 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
342 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
343 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
344 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
345 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
346 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
347 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
348 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
349 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
350 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
351 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
352 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
353 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
354 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
355 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
356 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
357 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
358 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
359 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
360 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
361 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
362 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
363 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
364 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
365 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
366 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
367 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
368 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
369 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
370 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
371 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
372 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
373 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
374 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
375 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
376 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
377 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
378 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
379 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
380 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
381 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
382 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
383 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
384 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
385 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
386 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
387 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
388 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
389 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
390 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
391 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
392 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
393 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
394 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
395 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
396 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
397 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
398 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
399 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
400 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
401 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
402 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
403 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
404 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
405 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
406 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
407 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
408 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
409 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
410 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
411 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
412 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
413 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
414 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
415 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
416 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
417 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
418 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
419 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
420 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
421 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
422 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
423 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
424 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
425 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
426 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
427 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
428 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
429 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
430 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
431 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
432 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
433 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
434 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
435 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
436 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
437 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
438 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
439 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
440 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
441 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
442 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
443 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
444 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
445 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
446 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
447 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
448 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
449 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
450 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
451 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
452 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
453 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
454 3004167301 Mesorhizobium loti 582 Isolate Unclassified
455 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
456 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
457 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
458 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
459 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
460 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
461 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
462 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
463 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
464 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
465 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
466 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
467 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
468 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
469 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
470 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
471 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
472 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
473 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
474 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
475 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
476 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
477 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
478 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
479 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
480 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
481 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
482 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
483 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
484 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
485 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
486 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
487 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
488 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
489 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
490 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
491 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
492 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
493 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
494 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
495 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
496 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
497 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
498 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
499 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
500 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
501 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
502 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
503 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
504 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
505 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
506 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
507 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
519 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
522 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
523 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
524 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
526 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
527 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
528 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
529 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
530 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
531 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
532 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
533 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
534 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
535 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
536 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
537 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
538 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
539 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
540 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
541 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
542 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
543 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
544 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
545 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
546 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
547 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
548 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
549 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
550 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
551 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
552 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
553 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
554 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
555 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
556 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
557 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
558 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
559 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
560 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
561 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
562 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
563 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
564 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
565 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
566 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
567 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
568 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
569 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
570 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
571 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
572 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
573 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
574 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
575 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
576 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
577 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
578 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
581 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
582 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
583 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
584 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
586 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
588 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
589 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
590 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
591 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
592 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
593 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
595 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
596 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
597 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
598 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
599 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
600 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
601 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
602 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
603 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
604 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
605 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
606 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
607 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
608 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
609 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
610 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
611 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
612 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
613 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
614 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
615 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
616 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
617 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
618 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
619 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
620 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
621 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
622 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
623 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
624 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
625 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
626 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
627 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
628 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 25.53
Metatranscriptomes 0
Isolates 74.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.15
Endosphere 2.25
Nodule 68.02
Rhizoplane 0.9
Rhizosphere 18.32
Stem 0
Stem Tuber 0.6
Unclassified 9.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000034 3300003214 Bacteria 292458
2 Ga0070658_10028903 3300005327 Bacteria 4451
3 Ga0070658_10293856 3300005327 Bacteria 1385
4 Ga0070661_100001089 3300005344 Bacteria 19198
5 Ga0068853_100006106 3300005539 Bacteria 9539
6 Ga0068853_100009175 3300005539 Bacteria 7968
7 Ga0070665_100099653 3300005548 Bacteria 2910
8 Ga0068854_100046419 3300005578 Bacteria 3092
9 Ga0068856_100034379 3300005614 Bacteria 4964
10 Ga0068852_100007354 3300005616 Bacteria 8035
11 Ga0068851_10000365 3300005834 Bacteria 20408
12 Ga0081455_10036446 3300005937 Bacteria 4379
13 Ga0075365_10002114 3300006038 Bacteria 9514
14 Ga0075365_10049506 3300006038 Bacteria 2769
15 Ga0075365_10056039 3300006038 Bacteria 2619
16 Ga0075364_10131028 3300006051 Bacteria 1683
17 Ga0075367_10032589 3300006178 Bacteria 3000
18 Ga0075428_100110698 3300006844 Bacteria 2992
19 Ga0075431_100008602 3300006847 Bacteria 10219
20 Ga0105251_10023093 3300009011 Bacteria 3217
21 Ga0105244_10000008 3300009036 Bacteria 302297
22 Ga0105240_10066593 3300009093 Bacteria 4467
23 Ga0105241_10036083 3300009174 Bacteria 3720
24 Ga0105237_10019781 3300009545 Bacteria 6951
25 Ga0105238_10038235 3300009551 Bacteria 4874
26 Ga0105239_10005658 3300010375 Bacteria 14604
27 Ga0105239_10050615 3300010375 Bacteria 4556
28 Ga0105239_10081665 3300010375 Bacteria 3558
29 Ga0105239_10092996 3300010375 Bacteria 3329
30 Ga0157370_10009932 3300013104 Bacteria 10080
31 Ga0157370_10266875 3300013104 Bacteria 1581
32 Ga0157369_10250223 3300013105 Bacteria 1849
33 Ga0157372_10002996 3300013307 Bacteria 18212
34 Ga0157375_10075429 3300013308 Bacteria 3397
35 Ga0163161_10000375 3300017792 Bacteria 37352
36 Ga0214544_1000010 3300021320 Bacteria 270164
37 Ga0214542_1000023 3300021321 Bacteria 191557
38 Ga0214542_1019114 3300021321 Bacteria 5520
39 Ga0214543_1000019 3300021327 Bacteria 267908
40 Ga0214543_1000156 3300021327 Bacteria 96889
41 Ga0213872_10025047 3300021361 Bacteria 2744
42 Ga0213876_10000660 3300021384 Bacteria 24722
43 Ga0228711_1000056 3300022739 Bacteria 78987
44 Ga0228710_1000229 3300022740 Bacteria 58988
45 Ga0209026_1000100 3300025250 Bacteria 156131
46 Ga0209148_1000069 3300025254 Bacteria 334444
47 Ga0209759_1000549 3300025256 Bacteria 38630
48 Ga0209233_1000028 3300025261 Bacteria 642062
49 Ga0209455_1000135 3300025272 Bacteria 148007
50 Ga0209758_1009577 3300025297 Bacteria 5986
51 Ga0207656_10002695 3300025321 Bacteria 6025
52 Ga0207655_1000083 3300025728 Bacteria 213295
53 Ga0207713_1032268 3300025735 Bacteria 2302
54 Ga0207647_10018659 3300025904 Bacteria 4684
55 Ga0207647_10114662 3300025904 Bacteria 1592
56 Ga0207705_10040332 3300025909 Bacteria 3348
57 Ga0207654_10076270 3300025911 Bacteria 2006
58 Ga0207654_10077839 3300025911 Bacteria 1989
59 Ga0207671_10011147 3300025914 Bacteria 7344
60 Ga0207671_10048066 3300025914 Bacteria 3158
61 Ga0207694_10011447 3300025924 Bacteria 6694
62 Ga0207694_10112877 3300025924 Bacteria 2163
63 Ga0207661_10095333 3300025944 Unclassified 2488
64 Ga0207667_10398653 3300025949 Bacteria 1401
65 Ga0207640_10003319 3300025981 Bacteria 8670
66 Ga0207639_10024149 3300026041 Bacteria 4395
67 Ga0207639_10135816 3300026041 Bacteria 2042
68 Ga0207702_10028806 3300026078 Bacteria 4619
69 Ga0207702_10126312 3300026078 Bacteria 2297
70 Ga0207674_10139761 3300026116 Bacteria 2382
71 Ga0209281_1000272 3300027111 Bacteria 99700
72 Ga0209371_1000641 3300027312 Bacteria 30869
73 Ga0209282_1000055 3300027666 Bacteria 101018
74 Ga0268266_10033856 3300028379 Bacteria 4342
75 Ga0307517_10170371 3300028786 Bacteria 1433
76 Ga0268256_1005909 3300030500 Bacteria 4684
77 Ga0307511_10040670 3300030521 Bacteria 3942
78 Ga0307513_10157809 3300031456 Bacteria 2166
79 Ga0307508_10017478 3300031616 Bacteria 6521
80 Ga0315914_1000095 3300031967 Bacteria 74092
81 Ga0315913_1000019 3300033430 Bacteria 100387
82 Ga0315915_1000023 3300033464 Bacteria 119157
83 Ga0395900_0117317 3300037418 Bacteria 2731
84 Ga0395898_0265255 3300037466 Bacteria 1638
85 Ga0395905_0252754 3300037471 Bacteria 1646
86 Ga0395901_0047074 3300038443 Bacteria 4479
87 Ga0395901_0151688 3300038443 Bacteria 2435
88 Ga0436365_0743852 3300039437 Bacteria 24807
89 Ga0436361_0845671 3300039447 Bacteria 3085
90 Ga0439438_001616 3300041405 Bacteria 9891
91 Ga0439447_012760 3300041407 Bacteria 2404
92 Ga0451839_0260713 3300041496 Bacteria 3525
93 Ga0451843_0766107 3300041509 Bacteria 4939
94 Ga0451853_3126826 3300041512 Bacteria 2691
95 Ga0466972_0056710 3300044658 Bacteria 1883
96 Ga0466965_0032665 3300044683 Bacteria 2542
97 Ga0495591_002496 3300046458 Bacteria 10186
98 Ga0495638_0082301 3300046460 Bacteria 1952
99 Ga0495650_0000008 3300046471 Bacteria 688246
100 Ga0495605_0019290 3300046474 Bacteria 3647
101 Ga0495584_0022473 3300046491 Bacteria 3200
102 Ga0495607_0000009 3300046501 Bacteria 216674
103 Ga0495606_0001619 3300046507 Bacteria 29382
104 Ga0495610_0018917 3300046512 Bacteria 3872
105 Ga0495632_0024918 3300046519 Bacteria 3171
106 Ga0495644_0025575 3300046523 Bacteria 2240
107 Ga0495648_0007216 3300046524 Bacteria 8929
108 Ga0495648_0014184 3300046524 Bacteria 5846
109 Ga0495654_0009827 3300046530 Bacteria 5227
110 Ga0495597_0051644 3300046542 Bacteria 1812
111 Ga0495656_0012841 3300046615 Bacteria 3102
112 Ga0495625_0005544 3300046660 Bacteria 11461
113 Ga0495661_0090529 3300046665 Bacteria 1741
114 Ga0495589_0016275 3300046794 Bacteria 3823
115 Ga0495660_0000019 3300046810 Bacteria 311047
116 Ga0495672_0000003 3300047320 Bacteria 728845
117 Ga0495673_0000011 3300047469 Bacteria 674140
118 Ga0495626_0046410 3300048091 Bacteria 2024
119 Ga0496112_0001731 3300048915 Bacteria 17084
120 Ga0496113_0172958 3300048916 Bacteria 1711
121 Ga0496116_0000076 3300048919 Bacteria 229670
122 Ga0496118_0115310 3300048921 Bacteria 1769
123 Ga0496119_0000044 3300048922 Bacteria 191820
124 Ga0496119_0001021 3300048922 Bacteria 35860
125 Ga0496119_0003395 3300048922 Bacteria 16542
126 Ga0496119_0048801 3300048922 Bacteria 2622
127 Ga0496119_0075802 3300048922 Bacteria 1953
128 Ga0496120_0000044 3300048923 Bacteria 192292
129 Ga0496120_0000073 3300048923 Bacteria 164280
130 Ga0496120_0000112 3300048923 Bacteria 136735
131 Ga0496120_0002155 3300048923 Bacteria 20986
132 Ga0496120_0020849 3300048923 Bacteria 4153
133 Ga0496122_0002008 3300048925 Bacteria 30259
134 Ga0496123_0000605 3300048926 Bacteria 60923
135 Ga0496125_0112359 3300048928 Bacteria 1969
136 Ga0495678_000479 3300049459 Bacteria 39762
137 Ga0495682_0000006 3300049460 Bacteria 316373
138 Ga0501031_0000008 3300049568 Bacteria 156304
139 Ga0501032_0000018 3300049569 Bacteria 156275
140 Ga0501033_0000032 3300049570 Bacteria 156304
141 Ga0501033_0010055 3300049570 Bacteria 7263
142 Ga0501034_0000103 3300049571 Bacteria 156304
143 Ga0501034_0013483 3300049571 Bacteria 8413
144 Ga0501034_0116285 3300049571 Bacteria 2662
145 Ga0501034_0166519 3300049571 Bacteria 2172
146 Ga0501034_0205424 3300049571 Bacteria 1926
147 Ga0501036_0000012 3300049572 Bacteria 156304
148 Ga0501037_0000018 3300049573 Bacteria 156304
149 Ga0501037_0051613 3300049573 Bacteria 3007
150 Ga0501038_0000017 3300049574 Bacteria 156304
151 Ga0501038_0035575 3300049574 Bacteria 4371
152 Ga0501038_0060321 3300049574 Bacteria 3246
153 Ga0501039_0000024 3300049575 Bacteria 156304
154 Ga0501040_0040528 3300049576 Bacteria 3169
155 Ga0501043_0004332 3300049579 Bacteria 11551
156 Ga0501046_0037111 3300049580 Bacteria 3917
157 Ga0501047_0004558 3300049581 Bacteria 13028
158 Ga0501048_0180440 3300049582 Bacteria 1496
159 Ga0501071_0014047 3300049587 Bacteria 5472
160 Ga0501073_0062954 3300049589 Bacteria 2587
161 Ga0501035_0000040 3300049822 Bacteria 156262
162 Ga0501035_0013756 3300049822 Bacteria 7469
163 Ga0501044_0000040 3300049823 Bacteria 156304
164 Ga0501045_0104315 3300049824 Bacteria 2100
165 nmdc:mga0yw44_60118_c1 3300050492 Bacteria 2327
166 nmdc:mga06r32_15012_c1 3300050510 Bacteria 7030
167 Ga0500621_000004 3300053126 Bacteria 485792
168 Ga0500658_0022535 3300053134 Bacteria 2396
169 Ga0500637_0039656 3300053178 Bacteria 2657
170 Ga0500611_010543 3300053727 Bacteria 1501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10000008 Ga0105244_10000008159 367
2 3300013104 Ga0157370_10009932 Ga0157370_100099325 367
3 3300025728 Ga0207655_1000083 Ga0207655_1000083129 367
4 3300005539 Ga0068853_100009175 Ga0068853_1000091756 370
5 3300010375 Ga0105239_10081665 Ga0105239_100816652 370
6 3300013105 Ga0157369_10250223 Ga0157369_102502232 370
7 3300025914 Ga0207671_10048066 Ga0207671_100480664 370
8 3300026041 Ga0207639_10135816 Ga0207639_101358162 370
9 iso_pu_bacteria 2977957713 2977958338 373
10 iso_pu_bacteria 2979710463 2979715662 374
11 3300006038 Ga0075365_10049506 Ga0075365_100495062 376
12 iso_pu_bacteria 2856356410 2856357187 376
13 3300013308 Ga0157375_10075429 Ga0157375_100754292 377
14 3300030521 Ga0307511_10040670 Ga0307511_100406703 377
15 3300031616 Ga0307508_10017478 Ga0307508_100174782 377
16 3300049589 Ga0501073_0062954 Ga0501073_0062954_525_1739 377
17 3300053178 Ga0500637_0039656 Ga0500637_0039656_870_2096 377
18 iso_pu_bacteria 2837651117 2837652035 377
19 iso_pu_bacteria 2869278585 2869285652 378
20 iso_pu_bacteria 2878738818 2878744806 378
21 iso_pu_bacteria 2924776078 2924782837 378
22 iso_pu_bacteria 2958034702 2958041667 378
23 iso_pu_bacteria 2958041894 2958047951 378
24 iso_pu_bacteria 2970593180 2970600268 378
25 iso_pu_bacteria 637000159 637075953 378
26 3300005344 Ga0070661_100001089 Ga0070661_1000010897 379
27 3300005539 Ga0068853_100006106 Ga0068853_1000061067 379
28 3300005578 Ga0068854_100046419 Ga0068854_1000464193 379
29 3300005614 Ga0068856_100034379 Ga0068856_1000343792 379
30 3300005616 Ga0068852_100007354 Ga0068852_1000073547 379
31 3300005834 Ga0068851_10000365 Ga0068851_100003659 379
32 3300009093 Ga0105240_10066593 Ga0105240_100665935 379
33 3300009174 Ga0105241_10036083 Ga0105241_100360835 379
34 3300009545 Ga0105237_10019781 Ga0105237_100197817 379
35 3300009551 Ga0105238_10038235 Ga0105238_100382355 379
36 3300010375 Ga0105239_10005658 Ga0105239_100056582 379
37 3300025321 Ga0207656_10002695 Ga0207656_100026955 379
38 3300025911 Ga0207654_10076270 Ga0207654_100762702 379
39 3300025914 Ga0207671_10011147 Ga0207671_100111477 379
40 3300025924 Ga0207694_10011447 Ga0207694_100114477 379
41 3300025944 Ga0207661_10095333 Ga0207661_100953332 379
42 3300025981 Ga0207640_10003319 Ga0207640_100033199 379
43 3300026041 Ga0207639_10024149 Ga0207639_100241491 379
44 3300026078 Ga0207702_10028806 Ga0207702_100288062 379
45 iso_pu_bacteria 2508501122 2509111469 379
46 iso_pu_bacteria 2508501123 2509116656 379
47 iso_pu_bacteria 2509276019 2509379608 379
48 iso_pu_bacteria 2509276022 2509394644 379
49 iso_pu_bacteria 2509276033 2509442291 379
50 iso_pu_bacteria 2510065059 2510318777 379
51 iso_pu_bacteria 2510461076 2510892883 379
52 iso_pu_bacteria 2511231052 2511499766 379
53 iso_pu_bacteria 2512047086 2512530189 379
54 iso_pu_bacteria 2512875016 2512932869 379
55 iso_pu_bacteria 2512875024 2512960890 379
56 iso_pu_bacteria 2512875026 2512975479 379
57 iso_pu_bacteria 2513237086 2513584894 379
58 iso_pu_bacteria 2513237089 2513605871 379
59 iso_pu_bacteria 2513237090 2513608980 379
60 iso_pu_bacteria 2513237091 2513618276 379
61 iso_pu_bacteria 2513237093 2513630728 379
62 iso_pu_bacteria 2513237103 2513711920 379
63 iso_pu_bacteria 2513237104 2513723845 379
64 iso_pu_bacteria 2513237140 2513883031 379
65 iso_pu_bacteria 2513237143 2513903086 379
66 iso_pu_bacteria 2513237144 2513910475 379
67 iso_pu_bacteria 2513237146 2513924887 379
68 iso_pu_bacteria 2513237160 2514006830 379
69 iso_pu_bacteria 2513237162 2514018249 379
70 iso_pu_bacteria 2513237164 2514036662 379
71 iso_pu_bacteria 2513237305 2514417285 379
72 iso_pu_bacteria 2513237351 2514585982 379
73 iso_pu_bacteria 2515154113 2515633036 379
74 iso_pu_bacteria 2515154114 2515640241 379
75 iso_pu_bacteria 2515154116 2515656322 379
76 iso_pu_bacteria 2516653046 2516897356 379
77 iso_pu_bacteria 2517093000 2517098500 379
78 iso_pu_bacteria 2517487022 2517567071 379
79 iso_pu_bacteria 2524023207 2524453254 379
80 iso_pu_bacteria 2551306084 2551678533 379
81 iso_pu_bacteria 2551306084 2551681536 379
82 iso_pu_bacteria 2551306085 2551688908 379
83 iso_pu_bacteria 2551306089 2551714922 379
84 iso_pu_bacteria 2558860100 2558862912 379
85 iso_pu_bacteria 2588253730 2588518925 379
86 iso_pu_bacteria 2597489875 2597811079 379
87 iso_pu_bacteria 2599185170 2599416448 379
88 iso_pu_bacteria 2599185301 2599939859 379
89 iso_pu_bacteria 2615840624 2616297885 379
90 iso_pu_bacteria 2643221595 2643987608 379
91 iso_pu_bacteria 2643221627 2644157871 379
92 iso_pu_bacteria 2643221634 2644195209 379
93 iso_pu_bacteria 2687453392 2688596967 379
94 iso_pu_bacteria 2693429783 2694630226 379
95 iso_pu_bacteria 2693429784 2694634306 379
96 iso_pu_bacteria 2721755686 2723574117 379
97 iso_pu_bacteria 2724679232 2725949383 379
98 iso_pu_bacteria 2756170246 2756670931 379
99 iso_pu_bacteria 2765235802 2765464462 379
100 iso_pu_bacteria 2775506902 2776267092 379
101 iso_pu_bacteria 2775506904 2776283433 379
102 iso_pu_bacteria 2791355091 2792621361 379
103 iso_pu_bacteria 2791355092 2792627954 379
104 iso_pu_bacteria 2791355094 2792643670 379
105 iso_pu_bacteria 2791355259 2793315013 379
106 iso_pu_bacteria 2802428858 2802720981 379
107 iso_pu_bacteria 2802428859 2802727472 379
108 iso_pu_bacteria 2802428860 2802733439 379
109 iso_pu_bacteria 2802428861 2802740167 379
110 iso_pu_bacteria 2802428862 2802746493 379
111 iso_pu_bacteria 2802428863 2802753233 379
112 iso_pu_bacteria 2838035591 2838036563 379
113 iso_pu_bacteria 2838661181 2838662457 379
114 iso_pu_bacteria 2839993093 2839997338 379
115 iso_pu_bacteria 2841734538 2841737463 379
116 iso_pu_bacteria 2842217011 2842219643 379
117 iso_pu_bacteria 2844009547 2844012308 379
118 iso_pu_bacteria 2847670302 2847674707 379
119 iso_pu_bacteria 2850079185 2850079392 379
120 iso_pu_bacteria 2855825444 2855830772 379
121 iso_pu_bacteria 2855839649 2855845456 379
122 iso_pu_bacteria 2856314179 2856317407 379
123 iso_pu_bacteria 2856320880 2856322804 379
124 iso_pu_bacteria 2856334872 2856338339 379
125 iso_pu_bacteria 2856342000 2856349201 379
126 iso_pu_bacteria 2856349417 2856355335 379
127 iso_pu_bacteria 2856364286 2856366858 379
128 iso_pu_bacteria 2857349434 2857352254 379
129 iso_pu_bacteria 2857367948 2857370917 379
130 iso_pu_bacteria 2858800743 2858805323 379
131 iso_pu_bacteria 2869162929 2869168562 379
132 iso_pu_bacteria 2869169390 2869175170 379
133 iso_pu_bacteria 2869234852 2869241878 379
134 iso_pu_bacteria 2869242130 2869249190 379
135 iso_pu_bacteria 2869249662 2869249921 379
136 iso_pu_bacteria 2869256925 2869262912 379
137 iso_pu_bacteria 2869264136 2869270049 379
138 iso_pu_bacteria 2869271264 2869276238 379
139 iso_pu_bacteria 2869285874 2869287730 379
140 iso_pu_bacteria 2871429161 2871435678 379
141 iso_pu_bacteria 2871435913 2871441916 379
142 iso_pu_bacteria 2871451962 2871452878 379
143 iso_pu_bacteria 2871459585 2871460252 379
144 iso_pu_bacteria 2871466892 2871473273 379
145 iso_pu_bacteria 2871474448 2871480888 379
146 iso_pu_bacteria 2871481445 2871485698 379
147 iso_pu_bacteria 2871488783 2871493519 379
148 iso_pu_bacteria 2871495908 2871496543 379
149 iso_pu_bacteria 2874109183 2874115109 379
150 iso_pu_bacteria 2874116593 2874119249 379
151 iso_pu_bacteria 2874123672 2874128947 379
152 iso_pu_bacteria 2874131515 2874132902 379
153 iso_pu_bacteria 2874139085 2874142010 379
154 iso_pu_bacteria 2874146452 2874151361 379
155 iso_pu_bacteria 2874155637 2874158995 379
156 iso_pu_bacteria 2874162495 2874163035 379
157 iso_pu_bacteria 2874168670 2874175072 379
158 iso_pu_bacteria 2876363079 2876364881 379
159 iso_pu_bacteria 2876369609 2876377287 379
160 iso_pu_bacteria 2876386047 2876387076 379
161 iso_pu_bacteria 2876392853 2876397709 379
162 iso_pu_bacteria 2876399893 2876405593 379
163 iso_pu_bacteria 2876406927 2876413851 379
164 iso_pu_bacteria 2876413966 2876417414 379
165 iso_pu_bacteria 2876420981 2876422186 379
166 iso_pu_bacteria 2878035449 2878038445 379
167 iso_pu_bacteria 2878730984 2878733082 379
168 iso_pu_bacteria 2878745973 2878749241 379
169 iso_pu_bacteria 2878753008 2878757561 379
170 iso_pu_bacteria 2878760144 2878760771 379
171 iso_pu_bacteria 2878767105 2878767604 379
172 iso_pu_bacteria 2878774303 2878775702 379
173 iso_pu_bacteria 2878781027 2878784097 379
174 iso_pu_bacteria 2878788777 2878794335 379
175 iso_pu_bacteria 2881147464 2881149591 379
176 iso_pu_bacteria 2881155292 2881160772 379
177 iso_pu_bacteria 2881161766 2881166470 379
178 iso_pu_bacteria 2881845957 2881849485 379
179 iso_pu_bacteria 2881861095 2881863130 379
180 iso_pu_bacteria 2882632389 2882639384 379
181 iso_pu_bacteria 2882912400 2882918381 379
182 iso_pu_bacteria 2885305155 2885307951 379
183 iso_pu_bacteria 2885312484 2885313127 379
184 iso_pu_bacteria 2885318864 2885319414 379
185 iso_pu_bacteria 2885326080 2885326735 379
186 iso_pu_bacteria 2885334103 2885340996 379
187 iso_pu_bacteria 2885342637 2885348489 379
188 iso_pu_bacteria 2888343758 2888345379 379
189 iso_pu_bacteria 2888350351 2888354699 379
190 iso_pu_bacteria 2889010040 2889016314 379
191 iso_pu_bacteria 2889016732 2889018663 379
192 iso_pu_bacteria 2896384573 2896389747 379
193 iso_pu_bacteria 2903448605 2903449657 379
194 iso_pu_bacteria 2903492973 2903498705 379
195 iso_pu_bacteria 2903492973 2903501291 379
196 iso_pu_bacteria 2903521522 2903522383 379
197 iso_pu_bacteria 2903528002 2903528762 379
198 iso_pu_bacteria 2903540706 2903541337 379
199 iso_pu_bacteria 2904659560 2904664360 379
200 iso_pu_bacteria 2906308376 2906310279 379
201 iso_pu_bacteria 2906321335 2906324344 379
202 iso_pu_bacteria 2906328253 2906333158 379
203 iso_pu_bacteria 2906363423 2906365977 379
204 iso_pu_bacteria 2906370794 2906375161 379
205 iso_pu_bacteria 2906378014 2906378172 379
206 iso_pu_bacteria 2906386501 2906392116 379
207 iso_pu_bacteria 2906393657 2906395251 379
208 iso_pu_bacteria 2906401398 2906407985 379
209 iso_pu_bacteria 2906408224 2906414052 379
210 iso_pu_bacteria 2906414383 2906417472 379
211 iso_pu_bacteria 2906427513 2906435836 379
212 iso_pu_bacteria 2913295892 2913301659 379
213 iso_pu_bacteria 2915980308 2915983600 379
214 iso_pu_bacteria 2915986958 2915989755 379
215 iso_pu_bacteria 2915993759 2915997579 379
216 iso_pu_bacteria 2916000859 2916003642 379
217 iso_pu_bacteria 2916007675 2916011480 379
218 iso_pu_bacteria 2916014648 2916021150 379
219 iso_pu_bacteria 2916021584 2916025712 379
220 iso_pu_bacteria 2916028427 2916032490 379
221 iso_pu_bacteria 2916035215 2916039596 379
222 iso_pu_bacteria 2916041962 2916043857 379
223 iso_pu_bacteria 2916048683 2916053015 379
224 iso_pu_bacteria 2916055098 2916059329 379
225 iso_pu_bacteria 2916061851 2916063241 379
226 iso_pu_bacteria 2916068649 2916071957 379
227 iso_pu_bacteria 2916076590 2916082214 379
228 iso_pu_bacteria 2920760137 2920767147 379
229 iso_pu_bacteria 2921201388 2921201544 379
230 iso_pu_bacteria 2921208531 2921211487 379
231 iso_pu_bacteria 2921237296 2921243151 379
232 iso_pu_bacteria 2921244191 2921247412 379
233 iso_pu_bacteria 2921250672 2921252364 379
234 iso_pu_bacteria 2921257292 2921259141 379
235 iso_pu_bacteria 2921263974 2921268263 379
236 iso_pu_bacteria 2921282425 2921286566 379
237 iso_pu_bacteria 2921289301 2921293055 379
238 iso_pu_bacteria 2921296804 2921301628 379
239 iso_pu_bacteria 2922130491 2922138326 379
240 iso_pu_bacteria 2922151315 2922153685 379
241 iso_pu_bacteria 2922158528 2922159039 379
242 iso_pu_bacteria 2922172374 2922172653 379
243 iso_pu_bacteria 2922178524 2922179879 379
244 iso_pu_bacteria 2922185730 2922188376 379
245 iso_pu_bacteria 2924144063 2924149365 379
246 iso_pu_bacteria 2924150972 2924155145 379
247 iso_pu_bacteria 2924158325 2924162574 379
248 iso_pu_bacteria 2924165586 2924166872 379
249 iso_pu_bacteria 2924172951 2924176683 379
250 iso_pu_bacteria 2924179722 2924182620 379
251 iso_pu_bacteria 2924186466 2924188646 379
252 iso_pu_bacteria 2924193448 2924197075 379
253 iso_pu_bacteria 2924200457 2924206312 379
254 iso_pu_bacteria 2924207177 2924208792 379
255 iso_pu_bacteria 2924214083 2924218468 379
256 iso_pu_bacteria 2924221636 2924222212 379
257 iso_pu_bacteria 2924228884 2924231529 379
258 iso_pu_bacteria 2924718760 2924719245 379
259 iso_pu_bacteria 2924733363 2924733917 379
260 iso_pu_bacteria 2924741084 2924743664 379
261 iso_pu_bacteria 2924748358 2924749215 379
262 iso_pu_bacteria 2924754689 2924755061 379
263 iso_pu_bacteria 2924762789 2924767247 379
264 iso_pu_bacteria 2924784321 2924786856 379
265 iso_pu_bacteria 2936996657 2936998151 379
266 iso_pu_bacteria 2937002841 2937005279 379
267 iso_pu_bacteria 2937009748 2937011453 379
268 iso_pu_bacteria 2937016420 2937017243 379
269 iso_pu_bacteria 2937023124 2937026068 379
270 iso_pu_bacteria 2937029754 2937032021 379
271 iso_pu_bacteria 2937036028 2937038844 379
272 iso_pu_bacteria 2937042894 2937046583 379
273 iso_pu_bacteria 2937056579 2937060673 379
274 iso_pu_bacteria 2937063883 2937067318 379
275 iso_pu_bacteria 2937071275 2937074499 379
276 iso_pu_bacteria 2937078374 2937081394 379
277 iso_pu_bacteria 2937084907 2937088869 379
278 iso_pu_bacteria 2937091812 2937095110 379
279 iso_pu_bacteria 2937098957 2937103767 379
280 iso_pu_bacteria 2937106411 2937109286 379
281 iso_pu_bacteria 2937113482 2937117366 379
282 iso_pu_bacteria 2937119839 2937120820 379
283 iso_pu_bacteria 2937126314 2937130659 379
284 iso_pu_bacteria 2937822353 2937822547 379
285 iso_pu_bacteria 2937836603 2937840301 379
286 iso_pu_bacteria 2937848649 2937852482 379
287 iso_pu_bacteria 2937861824 2937863418 379
288 iso_pu_bacteria 2937877337 2937883622 379
289 iso_pu_bacteria 2937891427 2937892978 379
290 iso_pu_bacteria 2937972304 2937977569 379
291 iso_pu_bacteria 2937980651 2937986316 379
292 iso_pu_bacteria 2937994558 2937995193 379
293 iso_pu_bacteria 2957375807 2957375857 379
294 iso_pu_bacteria 2957382221 2957386753 379
295 iso_pu_bacteria 2957388812 2957391607 379
296 iso_pu_bacteria 2957395598 2957397544 379
297 iso_pu_bacteria 2957402308 2957407083 379
298 iso_pu_bacteria 2957408893 2957409328 379
299 iso_pu_bacteria 2957415311 2957418814 379
300 iso_pu_bacteria 2957430029 2957435616 379
301 iso_pu_bacteria 2957437181 2957437942 379
302 iso_pu_bacteria 2957443900 2957444660 379
303 iso_pu_bacteria 2957450854 2957453025 379
304 iso_pu_bacteria 2957457609 2957463120 379
305 iso_pu_bacteria 2957464669 2957470458 379
306 iso_pu_bacteria 2957471148 2957476046 379
307 iso_pu_bacteria 2957478035 2957482175 379
308 iso_pu_bacteria 2957484790 2957489389 379
309 iso_pu_bacteria 2957491536 2957495391 379
310 iso_pu_bacteria 2957498199 2957502836 379
311 iso_pu_bacteria 2957505466 2957509001 379
312 iso_pu_bacteria 2958064165 2958070660 379
313 iso_pu_bacteria 2958071322 2958071510 379
314 iso_pu_bacteria 2958084443 2958090790 379
315 iso_pu_bacteria 2958115193 2958120912 379
316 iso_pu_bacteria 2958122699 2958128980 379
317 iso_pu_bacteria 2958137437 2958138030 379
318 iso_pu_bacteria 2958144490 2958147386 379
319 iso_pu_bacteria 2958158011 2958164489 379
320 iso_pu_bacteria 2958165035 2958165542 379
321 iso_pu_bacteria 2960584000 2960587279 379
322 iso_pu_bacteria 2960591022 2960593988 379
323 iso_pu_bacteria 2960597568 2960600519 379
324 iso_pu_bacteria 2960603979 2960606895 379
325 iso_pu_bacteria 2960610863 2960612777 379
326 iso_pu_bacteria 2960617483 2960618424 379
327 iso_pu_bacteria 2960624210 2960628996 379
328 iso_pu_bacteria 2960631154 2960634295 379
329 iso_pu_bacteria 2960637947 2960643400 379
330 iso_pu_bacteria 2960645483 2960651811 379
331 iso_pu_bacteria 2960652885 2960656108 379
332 iso_pu_bacteria 2960660292 2960661311 379
333 iso_pu_bacteria 2960667422 2960670620 379
334 iso_pu_bacteria 2960674078 2960676173 379
335 iso_pu_bacteria 2960680706 2960683017 379
336 iso_pu_bacteria 2960687367 2960689715 379
337 iso_pu_bacteria 2960693952 2960697729 379
338 iso_pu_bacteria 2961114664 2961119359 379
339 iso_pu_bacteria 2961127735 2961132270 379
340 iso_pu_bacteria 2961136820 2961139722 379
341 iso_pu_bacteria 2961163497 2961164001 379
342 iso_pu_bacteria 2961170736 2961175112 379
343 iso_pu_bacteria 2963644680 2963646337 379
344 iso_pu_bacteria 2964607997 2964612335 379
345 iso_pu_bacteria 2964615318 2964617221 379
346 iso_pu_bacteria 2964621998 2964625690 379
347 iso_pu_bacteria 2964628898 2964630115 379
348 iso_pu_bacteria 2964636051 2964637936 379
349 iso_pu_bacteria 2964643177 2964647114 379
350 iso_pu_bacteria 2964649959 2964654433 379
351 iso_pu_bacteria 2964656573 2964660936 379
352 iso_pu_bacteria 2964663802 2964664844 379
353 iso_pu_bacteria 2964670856 2964675200 379
354 iso_pu_bacteria 2964678106 2964683157 379
355 iso_pu_bacteria 2964685014 2964691181 379
356 iso_pu_bacteria 2964691889 2964694022 379
357 iso_pu_bacteria 2964698721 2964699709 379
358 iso_pu_bacteria 2964705432 2964709070 379
359 iso_pu_bacteria 2964712639 2964716419 379
360 iso_pu_bacteria 2964719344 2964724817 379
361 iso_pu_bacteria 2965018300 2965018933 379
362 iso_pu_bacteria 2965025482 2965027036 379
363 iso_pu_bacteria 2965047637 2965049771 379
364 iso_pu_bacteria 2965062239 2965062846 379
365 iso_pu_bacteria 2965089291 2965090431 379
366 iso_pu_bacteria 2965102966 2965107555 379
367 iso_pu_bacteria 2967664464 2967668843 379
368 iso_pu_bacteria 2967671571 2967675734 379
369 iso_pu_bacteria 2967678726 2967683522 379
370 iso_pu_bacteria 2967686174 2967688232 379
371 iso_pu_bacteria 2967693043 2967697316 379
372 iso_pu_bacteria 2967699805 2967701331 379
373 iso_pu_bacteria 2967706974 2967707542 379
374 iso_pu_bacteria 2967714385 2967719291 379
375 iso_pu_bacteria 2967721400 2967724062 379
376 iso_pu_bacteria 2967728569 2967730180 379
377 iso_pu_bacteria 2967735183 2967739634 379
378 iso_pu_bacteria 2967742019 2967742417 379
379 iso_pu_bacteria 2967748971 2967751757 379
380 iso_pu_bacteria 2967755722 2967759467 379
381 iso_pu_bacteria 2967762386 2967764307 379
382 iso_pu_bacteria 2967769361 2967773916 379
383 iso_pu_bacteria 2967775926 2967776271 379
384 iso_pu_bacteria 2967996073 2967999887 379
385 iso_pu_bacteria 2968003550 2968008246 379
386 iso_pu_bacteria 2968016561 2968020462 379
387 iso_pu_bacteria 2968083720 2968087137 379
388 iso_pu_bacteria 2968091066 2968091311 379
389 iso_pu_bacteria 2968097103 2968103139 379
390 iso_pu_bacteria 2968110612 2968115614 379
391 iso_pu_bacteria 2968128360 2968128929 379
392 iso_pu_bacteria 2968138860 2968143473 379
393 iso_pu_bacteria 2968171901 2968172404 379
394 iso_pu_bacteria 2970019648 2970024232 379
395 iso_pu_bacteria 2970026789 2970027765 379
396 iso_pu_bacteria 2970033650 2970039354 379
397 iso_pu_bacteria 2970040964 2970043645 379
398 iso_pu_bacteria 2970047711 2970052268 379
399 iso_pu_bacteria 2970054988 2970057479 379
400 iso_pu_bacteria 2970061556 2970065801 379
401 iso_pu_bacteria 2970068827 2970071480 379
402 iso_pu_bacteria 2970076120 2970080349 379
403 iso_pu_bacteria 2970088815 2970093354 379
404 iso_pu_bacteria 2970095765 2970098982 379
405 iso_pu_bacteria 2970102677 2970105432 379
406 iso_pu_bacteria 2970109326 2970112675 379
407 iso_pu_bacteria 2970116247 2970119198 379
408 iso_pu_bacteria 2970122695 2970127761 379
409 iso_pu_bacteria 2970129317 2970133252 379
410 iso_pu_bacteria 2970136068 2970140400 379
411 iso_pu_bacteria 2970143518 2970149204 379
412 iso_pu_bacteria 2970149975 2970153503 379
413 iso_pu_bacteria 2970156795 2970163821 379
414 iso_pu_bacteria 2970164137 2970164992 379
415 iso_pu_bacteria 2970170962 2970177243 379
416 iso_pu_bacteria 2970177841 2970184230 379
417 iso_pu_bacteria 2970184632 2970191392 379
418 iso_pu_bacteria 2970191845 2970194581 379
419 iso_pu_bacteria 2970469710 2970473759 379
420 iso_pu_bacteria 2970489779 2970490428 379
421 iso_pu_bacteria 2970503327 2970507700 379
422 iso_pu_bacteria 2970524798 2970527095 379
423 iso_pu_bacteria 2970532167 2970534773 379
424 iso_pu_bacteria 2970540015 2970544536 379
425 iso_pu_bacteria 2970547951 2970548272 379
426 iso_pu_bacteria 2970554993 2970555624 379
427 iso_pu_bacteria 2970619444 2970620166 379
428 iso_pu_bacteria 2970627176 2970631137 379
429 iso_pu_bacteria 2977516862 2977520171 379
430 iso_pu_bacteria 2977523885 2977527596 379
431 iso_pu_bacteria 2977530762 2977533596 379
432 iso_pu_bacteria 2977537788 2977542862 379
433 iso_pu_bacteria 2977544691 2977548611 379
434 iso_pu_bacteria 2977551784 2977556432 379
435 iso_pu_bacteria 2977558990 2977562277 379
436 iso_pu_bacteria 2977565890 2977568401 379
437 iso_pu_bacteria 2977572785 2977576135 379
438 iso_pu_bacteria 2977579622 2977582109 379
439 iso_pu_bacteria 2977821940 2977826718 379
440 iso_pu_bacteria 2977828996 2977832938 379
441 iso_pu_bacteria 2977851361 2977854160 379
442 iso_pu_bacteria 2977858184 2977861729 379
443 iso_pu_bacteria 2977864932 2977871924 379
444 iso_pu_bacteria 2977872689 2977873984 379
445 iso_pu_bacteria 2977907340 2977907650 379
446 iso_pu_bacteria 2977922695 2977925278 379
447 iso_pu_bacteria 2977935797 2977940646 379
448 iso_pu_bacteria 2977950692 2977956397 379
449 iso_pu_bacteria 2977986579 2977991288 379
450 iso_pu_bacteria 2979779861 2979782195 379
451 iso_pu_bacteria 2979793036 2979793978 379
452 iso_pu_bacteria 2979808191 2979812884 379
453 iso_pu_bacteria 2987636660 2987639438 379
454 iso_pu_bacteria 2987645492 2987648063 379
455 iso_pu_bacteria 2987659509 2987660009 379
456 iso_pu_bacteria 2987666974 2987673445 379
457 iso_pu_bacteria 2987673487 2987673580 379
458 iso_pu_bacteria 2996341866 2996342787 379
459 iso_pu_bacteria 2996348954 2996352918 379
460 iso_pu_bacteria 2996386984 2996393296 379
461 iso_pu_bacteria 3000135777 3000139313 379
462 iso_pu_bacteria 3003930520 3003931262 379
463 iso_pu_bacteria 3004167301 3004167354 379
464 iso_pu_bacteria 3004188549 3004189057 379
465 iso_pu_bacteria 3004195979 3004198382 379
466 iso_pu_bacteria 3004203850 3004204318 379
467 iso_pu_bacteria 3004211236 3004217772 379
468 iso_pu_bacteria 3004218560 3004221180 379
469 iso_pu_bacteria 3004232784 3004232809 379
470 iso_pu_bacteria 3004239961 3004243377 379
471 iso_pu_bacteria 3004248173 3004250636 379
472 iso_pu_bacteria 3004268573 3004269929 379
473 iso_pu_bacteria 3004275668 3004279600 379
474 iso_pu_bacteria 3004289098 3004290611 379
475 iso_pu_bacteria 3004334049 3004336057 379
476 iso_pu_bacteria 639633055 639645355 379
477 iso_pu_bacteria 648276728 648737946 379
478 iso_pu_bacteria 649633066 649871525 379
479 iso_pu_bacteria 8003992118 8003998150 379
480 iso_pu_bacteria 8003999396 8004005660 379
481 iso_pu_bacteria 8004300914 8004301843 379
482 iso_pu_bacteria 8004312739 8004314684 379
483 iso_pu_bacteria 8004361976 8004365400 379
484 iso_pu_bacteria 8004374579 8004379134 379
485 iso_pu_bacteria 8004445564 8004451786 379
486 iso_pu_bacteria 8004633249 8004637407 379
487 iso_pu_bacteria 8004640170 8004644027 379
488 iso_pu_bacteria 8004703790 8004712336 379
489 iso_pu_bacteria 8005289223 8005290825 379
490 iso_pu_bacteria 8005301065 8005301297 379
491 iso_pu_bacteria 8005556819 8005559465 379
492 iso_pu_bacteria 8005563573 8005566488 379
493 iso_pu_bacteria 8005688590 8005688888 379
494 iso_pu_bacteria 8018127388 8018132316 379
495 iso_pu_bacteria 8018163183 8018163762 379
496 iso_pu_bacteria 8024479707 8024481422 379
497 iso_pu_bacteria 8054558443 8054560631 379
498 iso_pu_bacteria 8055617313 8055619184 379
499 iso_pu_bacteria 8057874678 8057881283 379
500 3300021361 Ga0213872_10025047 Ga0213872_100250473 380
501 3300039447 Ga0436361_0845671 Ga0436361_0845671_1149_2339 380
502 3300005548 Ga0070665_100099653 Ga0070665_1000996533 381
503 3300021384 Ga0213876_10000660 Ga0213876_100006605 381
504 3300028379 Ga0268266_10033856 Ga0268266_100338566 381
505 3300039437 Ga0436365_0743852 Ga0436365_0743852_21044_22261 381
506 3300046501 Ga0495607_0000009 Ga0495607_0000009_212073_213365 381
507 3300048091 Ga0495626_0046410 Ga0495626_0046410_61_1284 381
508 3300048925 Ga0496122_0002008 Ga0496122_0002008_21056_22273 381
509 3300048926 Ga0496123_0000605 Ga0496123_0000605_38611_39828 381
510 iso_pu_bacteria 2537561728 2538428154 381
511 iso_pu_bacteria 2609459761 2609911774 381
512 iso_pu_bacteria 2846540461 2846541341 381
513 iso_pu_bacteria 2855195626 2855196577 381
514 iso_pu_bacteria 2858466076 2858467522 381
515 iso_pu_bacteria 2871272651 2871273751 381
516 iso_pu_bacteria 2871282230 2871284462 381
517 iso_pu_bacteria 2945874760 2945876180 381
518 3300009011 Ga0105251_10023093 Ga0105251_100230932 382
519 3300013307 Ga0157372_10002996 Ga0157372_100029964 382
520 3300017792 Ga0163161_10000375 Ga0163161_100003753 382
521 3300025735 Ga0207713_1032268 Ga0207713_10322682 382
522 3300027312 Ga0209371_1000641 Ga0209371_100064129 382
523 3300030500 Ga0268256_1005909 Ga0268256_10059093 382
524 3300041405 Ga0439438_001616 Ga0439438_001616_1837_3057 382
525 3300041407 Ga0439447_012760 Ga0439447_012760_1070_2290 382
526 3300046458 Ga0495591_002496 Ga0495591_002496_1806_3020 382
527 3300046471 Ga0495650_0000008 Ga0495650_0000008_435656_436870 382
528 3300046491 Ga0495584_0022473 Ga0495584_0022473_1300_2514 382
529 3300046507 Ga0495606_0001619 Ga0495606_0001619_16106_17320 382
530 3300046523 Ga0495644_0025575 Ga0495644_0025575_116_1330 382
531 3300046524 Ga0495648_0014184 Ga0495648_0014184_3224_4438 382
532 3300046530 Ga0495654_0009827 Ga0495654_0009827_450_1664 382
533 3300046794 Ga0495589_0016275 Ga0495589_0016275_1512_2726 382
534 3300046810 Ga0495660_0000019 Ga0495660_0000019_59332_60546 382
535 3300047320 Ga0495672_0000003 Ga0495672_0000003_283310_284524 382
536 3300047469 Ga0495673_0000011 Ga0495673_0000011_421693_422907 382
537 3300048919 Ga0496116_0000076 Ga0496116_0000076_126631_127851 382
538 3300048922 Ga0496119_0000044 Ga0496119_0000044_174721_175941 382
539 3300048922 Ga0496119_0001021 Ga0496119_0001021_20064_21284 382
540 3300048922 Ga0496119_0003395 Ga0496119_0003395_1335_2552 382
541 3300048923 Ga0496120_0000044 Ga0496120_0000044_15880_17100 382
542 3300048923 Ga0496120_0000073 Ga0496120_0000073_16498_17718 382
543 3300048923 Ga0496120_0000112 Ga0496120_0000112_121351_122568 382
544 3300049459 Ga0495678_000479 Ga0495678_000479_22231_23445 382
545 3300049460 Ga0495682_0000006 Ga0495682_0000006_18082_19296 382
546 3300049568 Ga0501031_0000008 Ga0501031_0000008_6190_7383 382
547 3300049569 Ga0501032_0000018 Ga0501032_0000018_148911_150104 382
548 3300049570 Ga0501033_0000032 Ga0501033_0000032_148922_150115 382
549 3300049570 Ga0501033_0010055 Ga0501033_0010055_3903_5096 382
550 3300049571 Ga0501034_0000103 Ga0501034_0000103_6190_7383 382
551 3300049571 Ga0501034_0013483 Ga0501034_0013483_5413_6606 382
552 3300049571 Ga0501034_0116285 Ga0501034_0116285_172_1365 382
553 3300049571 Ga0501034_0166519 Ga0501034_0166519_558_1751 382
554 3300049572 Ga0501036_0000012 Ga0501036_0000012_148922_150115 382
555 3300049573 Ga0501037_0000018 Ga0501037_0000018_6190_7383 382
556 3300049573 Ga0501037_0051613 Ga0501037_0051613_1120_2313 382
557 3300049574 Ga0501038_0000017 Ga0501038_0000017_6190_7383 382
558 3300049574 Ga0501038_0035575 Ga0501038_0035575_2299_3492 382
559 3300049574 Ga0501038_0060321 Ga0501038_0060321_714_1907 382
560 3300049575 Ga0501039_0000024 Ga0501039_0000024_6190_7383 382
561 3300049576 Ga0501040_0040528 Ga0501040_0040528_1531_2724 382
562 3300049579 Ga0501043_0004332 Ga0501043_0004332_6341_7534 382
563 3300049580 Ga0501046_0037111 Ga0501046_0037111_610_1803 382
564 3300049581 Ga0501047_0004558 Ga0501047_0004558_6125_7318 382
565 3300049582 Ga0501048_0180440 Ga0501048_0180440_121_1314 382
566 3300049587 Ga0501071_0014047 Ga0501071_0014047_3336_4529 382
567 3300049822 Ga0501035_0000040 Ga0501035_0000040_6148_7341 382
568 3300049822 Ga0501035_0013756 Ga0501035_0013756_2135_3328 382
569 3300049823 Ga0501044_0000040 Ga0501044_0000040_6190_7383 382
570 3300049824 Ga0501045_0104315 Ga0501045_0104315_688_1881 382
571 3300053126 Ga0500621_000004 Ga0500621_000004_238436_239650 382
572 iso_pu_bacteria 2506520007 2506580940 382
573 iso_pu_bacteria 2506520008 2506586079 382
574 iso_pu_bacteria 2654587920 2656276775 382
575 iso_pu_bacteria 2687453601 2689447491 382
576 iso_pu_bacteria 2847085930 2847090617 382
577 3300003214 JGI25165J46597_1000034 JGI25165J46597_100003481 383
578 3300005327 Ga0070658_10028903 Ga0070658_100289033 383
579 3300005327 Ga0070658_10293856 Ga0070658_102938561 383
580 3300005937 Ga0081455_10036446 Ga0081455_100364464 383
581 3300006038 Ga0075365_10002114 Ga0075365_100021144 383
582 3300006038 Ga0075365_10056039 Ga0075365_100560393 383
583 3300006051 Ga0075364_10131028 Ga0075364_101310282 383
584 3300006178 Ga0075367_10032589 Ga0075367_100325893 383
585 3300006844 Ga0075428_100110698 Ga0075428_1001106982 383
586 3300006847 Ga0075431_100008602 Ga0075431_1000086027 383
587 3300010375 Ga0105239_10050615 Ga0105239_100506155 383
588 3300010375 Ga0105239_10092996 Ga0105239_100929962 383
589 3300013104 Ga0157370_10266875 Ga0157370_102668751 383
590 3300021320 Ga0214544_1000010 Ga0214544_1000010233 383
591 3300021321 Ga0214542_1000023 Ga0214542_100002318 383
592 3300021321 Ga0214542_1019114 Ga0214542_10191144 383
593 3300021327 Ga0214543_1000019 Ga0214543_100001993 383
594 3300021327 Ga0214543_1000156 Ga0214543_100015631 383
595 3300022739 Ga0228711_1000056 Ga0228711_100005646 383
596 3300022740 Ga0228710_1000229 Ga0228710_100022927 383
597 3300025250 Ga0209026_1000100 Ga0209026_100010020 383
598 3300025254 Ga0209148_1000069 Ga0209148_1000069166 383
599 3300025256 Ga0209759_1000549 Ga0209759_100054920 383
600 3300025261 Ga0209233_1000028 Ga0209233_100002885 383
601 3300025272 Ga0209455_1000135 Ga0209455_100013521 383
602 3300025297 Ga0209758_1009577 Ga0209758_10095772 383
603 3300025904 Ga0207647_10018659 Ga0207647_100186592 383
604 3300025904 Ga0207647_10114662 Ga0207647_101146621 383
605 3300025909 Ga0207705_10040332 Ga0207705_100403322 383
606 3300025911 Ga0207654_10077839 Ga0207654_100778392 383
607 3300025924 Ga0207694_10112877 Ga0207694_101128772 383
608 3300025949 Ga0207667_10398653 Ga0207667_103986531 383
609 3300026078 Ga0207702_10126312 Ga0207702_101263122 383
610 3300026116 Ga0207674_10139761 Ga0207674_101397612 383
611 3300027111 Ga0209281_1000272 Ga0209281_100027229 383
612 3300027666 Ga0209282_1000055 Ga0209282_100005530 383
613 3300028786 Ga0307517_10170371 Ga0307517_101703712 383
614 3300031456 Ga0307513_10157809 Ga0307513_101578092 383
615 3300031967 Ga0315914_1000095 Ga0315914_100009552 383
616 3300033430 Ga0315913_1000019 Ga0315913_100001929 383
617 3300033464 Ga0315915_1000023 Ga0315915_100002352 383
618 3300037418 Ga0395900_0117317 Ga0395900_0117317_491_1687 383
619 3300037466 Ga0395898_0265255 Ga0395898_0265255_340_1536 383
620 3300037471 Ga0395905_0252754 Ga0395905_0252754_192_1388 383
621 3300038443 Ga0395901_0047074 Ga0395901_0047074_2136_3332 383
622 3300038443 Ga0395901_0151688 Ga0395901_0151688_75_1295 383
623 3300041496 Ga0451839_0260713 Ga0451839_0260713_1683_2879 383
624 3300041509 Ga0451843_0766107 Ga0451843_0766107_842_2038 383
625 3300041512 Ga0451853_3126826 Ga0451853_3126826_27_1223 383
626 3300044658 Ga0466972_0056710 Ga0466972_0056710_470_1666 383
627 3300044683 Ga0466965_0032665 Ga0466965_0032665_473_1669 383
628 3300046460 Ga0495638_0082301 Ga0495638_0082301_621_1823 383
629 3300046474 Ga0495605_0019290 Ga0495605_0019290_1623_2819 383
630 3300046512 Ga0495610_0018917 Ga0495610_0018917_1677_2873 383
631 3300046519 Ga0495632_0024918 Ga0495632_0024918_1024_2220 383
632 3300046524 Ga0495648_0007216 Ga0495648_0007216_1181_2377 383
633 3300046542 Ga0495597_0051644 Ga0495597_0051644_440_1636 383
634 3300046615 Ga0495656_0012841 Ga0495656_0012841_385_1581 383
635 3300046660 Ga0495625_0005544 Ga0495625_0005544_6648_7844 383
636 3300046665 Ga0495661_0090529 Ga0495661_0090529_213_1409 383
637 3300048915 Ga0496112_0001731 Ga0496112_0001731_13037_14233 383
638 3300048916 Ga0496113_0172958 Ga0496113_0172958_409_1605 383
639 3300048921 Ga0496118_0115310 Ga0496118_0115310_142_1338 383
640 3300048922 Ga0496119_0048801 Ga0496119_0048801_468_1664 383
641 3300048922 Ga0496119_0075802 Ga0496119_0075802_136_1332 383
642 3300048923 Ga0496120_0002155 Ga0496120_0002155_4629_5825 383
643 3300048923 Ga0496120_0020849 Ga0496120_0020849_2734_3930 383
644 3300048928 Ga0496125_0112359 Ga0496125_0112359_594_1790 383
645 3300049571 Ga0501034_0205424 Ga0501034_0205424_716_1915 383
646 3300050492 nmdc:mga0yw44_60118_c1 nmdc:mga0yw44_60118_c1_228_1496 383
647 3300050510 nmdc:mga06r32_15012_c1 nmdc:mga06r32_15012_c1_3884_5080 383
648 3300053134 Ga0500658_0022535 Ga0500658_0022535_568_1764 383
649 3300053727 Ga0500611_010543 Ga0500611_010543_280_1476 383
650 iso_pu_bacteria 2937813078 2937817103 383
651 iso_pu_bacteria 2938014810 2938018198 383
652 iso_pu_bacteria 2958041894 2958043916 383
653 iso_pu_bacteria 2958100919 2958102441 383
654 iso_pu_bacteria 2958130278 2958132132 383
655 iso_pu_bacteria 2958172287 2958174259 383
656 iso_pu_bacteria 2958179912 2958181946 383
657 iso_pu_bacteria 2961077736 2961079790 383
658 iso_pu_bacteria 2965119406 2965125244 383
659 iso_pu_bacteria 2968117919 2968118987 383
660 iso_pu_bacteria 2977843712 2977847394 383
661 iso_pu_bacteria 2977942078 2977945673 383
662 iso_pu_bacteria 2977971508 2977973943 383
663 iso_pu_bacteria 2979742915 2979745633 383
664 iso_pu_bacteria 2987652177 2987653915 383
665 iso_pu_bacteria 8004387939 8004389515 383
666 iso_pu_bacteria 8004714634 8004717913 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23189

259

476

0.99

PF06792

UPF0261

Uncharacterised protein family (UPF0261)

82

254

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wry-assembly2.cif.gz_B crystal structure of helicase complex 2 0.9227 2 378
3wrx-assembly2.cif.gz_B crystal structure of helicase complex 1 0.9185 2 378
3wrw-assembly1.cif.gz_B crystal structure of the n-terminal domain of resistance protein 0.9152 2 378
3wry-assembly2.cif.gz_B crystal structure of helicase complex 2 0.911 2 378
3wrx-assembly1.cif.gz_A crystal structure of helicase complex 1 0.9083 1 381
ID Description Score Start End Superfamily
3wrxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein family UPF0261, NC domain 0.9704 162 381 3.40.50.12030
3wrxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein family UPF0261, NC domain 0.9618 162 381 3.40.50.12030
3wrwF02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein family UPF0261, NC domain 0.9474 164 378 3.40.50.12030
af_K7MH55_9_191_3.40.50.12030 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein family UPF0261, NC domain 0.9323 197 381 3.40.50.12030
3wrwF02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein family UPF0261, NC domain 0.9286 164 378 3.40.50.12030
ID Description Score Start End GO Terms
AF-A0A440J546-F1-model_v4 deleted 1.001 295 371
AF-A0A528BBD5-F1-model_v4 UPF0261 family protein 0.9945 168 350
AF-A0A529M8L8-F1-model_v4 UPF0261 family protein 0.9935 141 359
AF-A0A435GK27-F1-model_v4 UPF0261 family protein 0.9909 218 361
AF-A0A3S3TD93-F1-model_v4 deleted 0.9873 191 380

Feature Viewer

pLDDT pTM Quality
92.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map