F473780

General Info

Members Datasets Scaffolds Average Seq Length
666 223 1332 141

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10013865|Ga0157373_100138655
Length 153
Sequence MLKQVQHDRSERMDADELAARVAHGMLAAEGTGPAWGIRIEEARAGYARLSMTVRADMLNGHCIVHGGMVFALADTAFAYVCNGGNEKTVAAQASIVFLGSANEGDVLVAEATAAAAAGRSGVTRVAVRTADGRPIAEFTGYSRTLGGAVVEV

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
178 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
179 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
180 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 2.25
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10013865 3300013100 Bacteria 5910
2 JGI24737J22298_10000672 3300001990 Bacteria 12094
3 JGI24737J22298_10001512 3300001990 Bacteria 8281
4 JGI24735J21928_10047027 3300002067 Bacteria 1251
5 JGI25406J46586_10099566 3300003203 Bacteria 868
6 rootL2_10288675 3300003322 Bacteria 1266
7 Ga0065712_10340438 3300005290 Bacteria 801
8 Ga0070658_10247776 3300005327 Bacteria 1511
9 Ga0070658_10573062 3300005327 Bacteria 977
10 Ga0070676_10000509 3300005328 Bacteria 18636
11 Ga0070676_10451753 3300005328 Bacteria 904
12 Ga0070683_100020756 3300005329 Bacteria 5851
13 Ga0070683_100063070 3300005329 Bacteria 3446
14 Ga0070683_101988264 3300005329 Bacteria 559
15 Ga0070690_100173990 3300005330 Bacteria 1483
16 Ga0070690_101275709 3300005330 Unclassified 588
17 Ga0070670_100026391 3300005331 Bacteria 4999
18 Ga0070670_100044342 3300005331 Bacteria 3824
19 Ga0070670_100147446 3300005331 Bacteria 2036
20 Ga0070670_100212518 3300005331 Bacteria 1682
21 Ga0070670_100796010 3300005331 Bacteria 854
22 Ga0070670_101311644 3300005331 Bacteria 663
23 Ga0070677_10255327 3300005333 Bacteria 872
24 Ga0070677_10899494 3300005333 Unclassified 511
25 Ga0068869_100018311 3300005334 Bacteria 4766
26 Ga0068869_100141300 3300005334 Bacteria 1859
27 Ga0070666_10153778 3300005335 Bacteria 1606
28 Ga0070680_100000315 3300005336 Bacteria 32377
29 Ga0070680_100000498 3300005336 Bacteria 26970
30 Ga0070680_100002832 3300005336 Bacteria 12894
31 Ga0070680_100093037 3300005336 Bacteria 2497
32 Ga0070680_101491438 3300005336 Bacteria 586
33 Ga0070682_100318513 3300005337 Bacteria 1148
34 Ga0070682_100459482 3300005337 Bacteria 977
35 Ga0068868_100001494 3300005338 Bacteria 16135
36 Ga0068868_100173496 3300005338 Bacteria 1786
37 Ga0068868_100228584 3300005338 Bacteria 1560
38 Ga0070660_100004844 3300005339 Bacteria 9298
39 Ga0070660_100123096 3300005339 Bacteria 2071
40 Ga0070660_100523240 3300005339 Bacteria 988
41 Ga0070660_101430119 3300005339 Bacteria 587
42 Ga0070689_101745657 3300005340 Bacteria 567
43 Ga0070687_100181193 3300005343 Bacteria 1262
44 Ga0070661_100207804 3300005344 Bacteria 1498
45 Ga0070661_100248848 3300005344 Bacteria 1371
46 Ga0070661_100282469 3300005344 Bacteria 1288
47 Ga0070661_100290370 3300005344 Bacteria 1270
48 Ga0070661_100379902 3300005344 Bacteria 1113
49 Ga0070661_101237467 3300005344 Bacteria 625
50 Ga0070692_10020838 3300005345 Bacteria 3183
51 Ga0070668_100006224 3300005347 Bacteria 8841
52 Ga0070668_100051865 3300005347 Bacteria 3162
53 Ga0070668_100066239 3300005347 Bacteria 2802
54 Ga0070668_100163068 3300005347 Bacteria 1810
55 Ga0070668_100292828 3300005347 Bacteria 1363
56 Ga0070668_100387453 3300005347 Bacteria 1191
57 Ga0070668_101606053 3300005347 Bacteria 596
58 Ga0070669_100099610 3300005353 Bacteria 2190
59 Ga0070669_100136402 3300005353 Bacteria 1888
60 Ga0070669_100143061 3300005353 Bacteria 1845
61 Ga0070669_100203585 3300005353 Bacteria 1558
62 Ga0070669_100324653 3300005353 Bacteria 1244
63 Ga0070669_100330651 3300005353 Bacteria 1232
64 Ga0070669_100428363 3300005353 Bacteria 1087
65 Ga0070669_100969370 3300005353 Bacteria 728
66 Ga0070669_101033874 3300005353 Bacteria 706
67 Ga0070675_100010756 3300005354 Bacteria 7158
68 Ga0070675_100455244 3300005354 Bacteria 1148
69 Ga0070675_100852518 3300005354 Bacteria 834
70 Ga0070675_101070226 3300005354 Bacteria 741
71 Ga0070675_101173371 3300005354 Bacteria 707
72 Ga0070671_100041175 3300005355 Bacteria 3839
73 Ga0070671_100623898 3300005355 Bacteria 932
74 Ga0070671_100916449 3300005355 Bacteria 766
75 Ga0070674_100052279 3300005356 Bacteria 2818
76 Ga0070673_100026023 3300005364 Bacteria 4315
77 Ga0070673_100228142 3300005364 Bacteria 1615
78 Ga0070673_100390812 3300005364 Bacteria 1242
79 Ga0070673_100405012 3300005364 Bacteria 1220
80 Ga0070673_100579308 3300005364 Bacteria 1022
81 Ga0070673_100674801 3300005364 Bacteria 947
82 Ga0070659_100007979 3300005366 Bacteria 7715
83 Ga0070659_100096583 3300005366 Bacteria 2374
84 Ga0070659_100111597 3300005366 Bacteria 2207
85 Ga0070659_100112184 3300005366 Bacteria 2202
86 Ga0070659_100114554 3300005366 Bacteria 2179
87 Ga0070659_100701755 3300005366 Bacteria 875
88 Ga0070659_101062357 3300005366 Bacteria 713
89 Ga0070667_100008606 3300005367 Bacteria 8459
90 Ga0070667_100014172 3300005367 Bacteria 6585
91 Ga0070667_100072587 3300005367 Bacteria 2933
92 Ga0070667_100126888 3300005367 Bacteria 2224
93 Ga0070667_100141072 3300005367 Bacteria 2110
94 Ga0070667_100190792 3300005367 Bacteria 1815
95 Ga0070667_100389756 3300005367 Bacteria 1266
96 Ga0070667_100466084 3300005367 Bacteria 1155
97 Ga0070667_100723886 3300005367 Bacteria 921
98 Ga0070667_100881683 3300005367 Bacteria 832
99 Ga0070694_100007483 3300005444 Bacteria 6660
100 Ga0070694_100120664 3300005444 Bacteria 1881
101 Ga0070663_100105013 3300005455 Bacteria 2114
102 Ga0070663_100435715 3300005455 Bacteria 1078
103 Ga0070663_101311223 3300005455 Bacteria 639
104 Ga0070663_101316187 3300005455 Bacteria 638
105 Ga0070678_100011915 3300005456 Bacteria 5382
106 Ga0070678_100298788 3300005456 Bacteria 1368
107 Ga0070678_100426217 3300005456 Bacteria 1157
108 Ga0070678_100755976 3300005456 Bacteria 880
109 Ga0070678_101430537 3300005456 Bacteria 646
110 Ga0070662_100000934 3300005457 Bacteria 17887
111 Ga0070662_100003335 3300005457 Bacteria 10015
112 Ga0070662_100014311 3300005457 Bacteria 5298
113 Ga0070662_100150297 3300005457 Bacteria 1812
114 Ga0070662_100277823 3300005457 Bacteria 1355
115 Ga0070662_100395007 3300005457 Bacteria 1140
116 Ga0070662_101141422 3300005457 Bacteria 669
117 Ga0070662_101843204 3300005457 Unclassified 522
118 Ga0070681_10031435 3300005458 Bacteria 5331
119 Ga0070681_10244703 3300005458 Bacteria 1707
120 Ga0070681_10515760 3300005458 Bacteria 1108
121 Ga0070681_10724812 3300005458 Bacteria 910
122 Ga0070681_10977723 3300005458 Bacteria 766
123 Ga0068867_100010679 3300005459 Bacteria 6477
124 Ga0070679_100000168 3300005530 Bacteria 52996
125 Ga0070679_100123920 3300005530 Bacteria 2567
126 Ga0070679_100264639 3300005530 Bacteria 1674
127 Ga0070679_100269547 3300005530 Bacteria 1657
128 Ga0070679_101241897 3300005530 Bacteria 690
129 Ga0070684_100016587 3300005535 Bacteria 6023
130 Ga0068853_100129850 3300005539 Bacteria 2255
131 Ga0068853_100283508 3300005539 Bacteria 1527
132 Ga0068853_100302154 3300005539 Bacteria 1479
133 Ga0068853_100355967 3300005539 Bacteria 1363
134 Ga0068853_100531276 3300005539 Bacteria 1113
135 Ga0070672_100027847 3300005543 Bacteria 4220
136 Ga0070672_100037801 3300005543 Bacteria 3684
137 Ga0070672_100088695 3300005543 Bacteria 2491
138 Ga0070672_100234701 3300005543 Bacteria 1542
139 Ga0070672_100261376 3300005543 Bacteria 1460
140 Ga0070672_100609942 3300005543 Bacteria 951
141 Ga0070672_100810479 3300005543 Bacteria 824
142 Ga0070695_100033084 3300005545 Bacteria 3234
143 Ga0070696_100006262 3300005546 Bacteria 7967
144 Ga0070696_100111003 3300005546 Bacteria 1975
145 Ga0070696_100830899 3300005546 Bacteria 762
146 Ga0070693_100161784 3300005547 Bacteria 1426
147 Ga0070693_101369648 3300005547 Bacteria 549
148 Ga0070665_100034682 3300005548 Bacteria 5076
149 Ga0070665_100100117 3300005548 Bacteria 2902
150 Ga0070704_100096152 3300005549 Bacteria 2220
151 Ga0068855_100038250 3300005563 Bacteria 5701
152 Ga0068855_100348133 3300005563 Bacteria 1633
153 Ga0068855_100491085 3300005563 Bacteria 1335
154 Ga0068855_101057050 3300005563 Bacteria 851
155 Ga0070664_100208366 3300005564 Bacteria 1746
156 Ga0070664_100264826 3300005564 Bacteria 1547
157 Ga0070664_100287619 3300005564 Bacteria 1483
158 Ga0070664_100582691 3300005564 Bacteria 1036
159 Ga0070664_100735116 3300005564 Bacteria 920
160 Ga0068857_100039999 3300005577 Bacteria 4157
161 Ga0068857_100097523 3300005577 Bacteria 2636
162 Ga0068857_100308502 3300005577 Bacteria 1460
163 Ga0068857_100889689 3300005577 Bacteria 853
164 Ga0068854_100080166 3300005578 Bacteria 2408
165 Ga0068854_100085711 3300005578 Bacteria 2333
166 Ga0068854_101485475 3300005578 Bacteria 615
167 Ga0068854_101556129 3300005578 Unclassified 601
168 Ga0068856_100385809 3300005614 Bacteria 1420
169 Ga0068856_101880999 3300005614 Bacteria 610
170 Ga0068856_102101173 3300005614 Bacteria 574
171 Ga0068852_100009958 3300005616 Bacteria 7072
172 Ga0068852_101511750 3300005616 Bacteria 694
173 Ga0068859_100003414 3300005617 Bacteria 16158
174 Ga0068859_100282440 3300005617 Bacteria 1753
175 Ga0068859_100709148 3300005617 Bacteria 1097
176 Ga0068864_100000713 3300005618 Bacteria 27896
177 Ga0068864_100119374 3300005618 Bacteria 2356
178 Ga0068861_100405401 3300005719 Bacteria 1211
179 Ga0068851_10029313 3300005834 Bacteria 2724
180 Ga0068851_10219917 3300005834 Bacteria 1067
181 Ga0068870_10304506 3300005840 Bacteria 1007
182 Ga0068870_10362482 3300005840 Bacteria 933
183 Ga0068863_100002105 3300005841 Bacteria 19733
184 Ga0068863_100018929 3300005841 Bacteria 6590
185 Ga0068863_100424539 3300005841 Bacteria 1303
186 Ga0068863_100702053 3300005841 Bacteria 1005
187 Ga0068863_101175819 3300005841 Bacteria 772
188 Ga0068858_100001407 3300005842 Bacteria 24703
189 Ga0068858_100039755 3300005842 Bacteria 4360
190 Ga0068858_100323313 3300005842 Bacteria 1475
191 Ga0068860_100287680 3300005843 Bacteria 1607
192 Ga0068860_100881333 3300005843 Bacteria 910
193 Ga0068862_100021503 3300005844 Bacteria 5391
194 Ga0068862_100021750 3300005844 Bacteria 5363
195 Ga0068862_100023331 3300005844 Bacteria 5183
196 Ga0068862_100054869 3300005844 Bacteria 3412
197 Ga0068862_100147946 3300005844 Bacteria 2089
198 Ga0068862_101445395 3300005844 Bacteria 692
199 Ga0068862_101634202 3300005844 Bacteria 652
200 Ga0081539_10026704 3300005985 Bacteria 3675
201 Ga0075364_10176282 3300006051 Bacteria 1446
202 Ga0097621_100888289 3300006237 Bacteria 829
203 Ga0097621_102044228 3300006237 Bacteria 547
204 Ga0068871_100060940 3300006358 Bacteria 3079
205 Ga0068871_101718745 3300006358 Bacteria 595
206 Ga0075428_100129750 3300006844 Bacteria 2743
207 Ga0068865_100045327 3300006881 Bacteria 3014
208 Ga0068865_100948822 3300006881 Bacteria 751
209 Ga0097620_100003414 3300006931 Bacteria 16158
210 Ga0097620_100282438 3300006931 Bacteria 1753
211 Ga0105250_10010478 3300009092 Bacteria 3864
212 Ga0105240_10079793 3300009093 Bacteria 4026
213 Ga0111539_10376563 3300009094 Bacteria 1653
214 Ga0105245_11485603 3300009098 Bacteria 728
215 Ga0105247_10169341 3300009101 Bacteria 1451
216 Ga0105247_10826621 3300009101 Bacteria 709
217 Ga0114129_10608096 3300009147 Bacteria 1415
218 Ga0105243_10305865 3300009148 Bacteria 1443
219 Ga0105242_10726910 3300009176 Bacteria 974
220 Ga0105248_10001965 3300009177 Bacteria 22859
221 Ga0105248_10008231 3300009177 Bacteria 11456
222 Ga0105248_10132205 3300009177 Bacteria 2816
223 Ga0105248_10452693 3300009177 Bacteria 1446
224 Ga0105238_10156175 3300009551 Bacteria 2257
225 Ga0105238_12212614 3300009551 Bacteria 585
226 Ga0105249_10016888 3300009553 Bacteria 6477
227 Ga0105249_10053856 3300009553 Bacteria 3678
228 Ga0105032_109239 3300009979 Bacteria 807
229 Ga0105239_10070025 3300010375 Bacteria 3853
230 Ga0105239_11655576 3300010375 Bacteria 740
231 Ga0105246_10089247 3300011119 Bacteria 2218
232 Ga0105246_10408555 3300011119 Bacteria 1129
233 Ga0105246_11644939 3300011119 Bacteria 608
234 Ga0157373_10029911 3300013100 Bacteria 3921
235 Ga0157373_10033215 3300013100 Bacteria 3713
236 Ga0157373_10091837 3300013100 Bacteria 2138
237 Ga0157373_10150328 3300013100 Bacteria 1638
238 Ga0157373_10212272 3300013100 Bacteria 1365
239 Ga0157373_10275138 3300013100 Bacteria 1192
240 Ga0157373_10594883 3300013100 Bacteria 805
241 Ga0157373_11038709 3300013100 Bacteria 613
242 Ga0157371_10192335 3300013102 Bacteria 1461
243 Ga0157371_10359133 3300013102 Bacteria 1061
244 Ga0157371_10633413 3300013102 Bacteria 797
245 Ga0157370_10212313 3300013104 Bacteria 1794
246 Ga0157369_10003259 3300013105 Bacteria 19324
247 Ga0157369_10252813 3300013105 Bacteria 1839
248 Ga0157369_10253597 3300013105 Bacteria 1836
249 Ga0157369_10796016 3300013105 Bacteria 971
250 Ga0157369_10948459 3300013105 Bacteria 882
251 Ga0157369_12123328 3300013105 Bacteria 570
252 Ga0157369_12198977 3300013105 Bacteria 559
253 Ga0157369_12236933 3300013105 Bacteria 554
254 Ga0157374_10038946 3300013296 Bacteria 4372
255 Ga0157374_10164698 3300013296 Bacteria 2160
256 Ga0157374_10763577 3300013296 Bacteria 982
257 Ga0157378_10549720 3300013297 Bacteria 1160
258 Ga0163162_10054089 3300013306 Bacteria 4036
259 Ga0163162_10167045 3300013306 Bacteria 2324
260 Ga0163162_11009521 3300013306 Bacteria 941
261 Ga0157372_12642371 3300013307 Bacteria 576
262 Ga0157375_10088799 3300013308 Bacteria 3146
263 Ga0157375_10739556 3300013308 Bacteria 1135
264 Ga0157375_10949388 3300013308 Bacteria 1002
265 Ga0157375_11070644 3300013308 Bacteria 943
266 Ga0163163_10000991 3300014325 Bacteria 24023
267 Ga0163163_10032361 3300014325 Bacteria 5050
268 Ga0182008_10289308 3300014497 Bacteria 855
269 Ga0157377_10271923 3300014745 Bacteria 1107
270 Ga0157379_10001787 3300014968 Bacteria 17755
271 Ga0157379_10200885 3300014968 Bacteria 1803
272 Ga0163161_10536780 3300017792 Bacteria 957
273 Ga0163161_10821570 3300017792 Bacteria 782
274 Ga0206354_10006003 3300020081 Bacteria 548
275 Ga0206353_10770303 3300020082 Bacteria 600
276 Ga0207656_10022043 3300025321 Bacteria 2552
277 Ga0207656_10080435 3300025321 Bacteria 1464
278 Ga0207696_1009792 3300025711 Bacteria 3554
279 Ga0207682_10042604 3300025893 Bacteria 1855
280 Ga0207682_10601355 3300025893 Unclassified 518
281 Ga0207710_10093107 3300025900 Bacteria 1413
282 Ga0207688_10387893 3300025901 Bacteria 865
283 Ga0207680_10063221 3300025903 Bacteria 2264
284 Ga0207647_10001771 3300025904 Bacteria 16572
285 Ga0207647_10071617 3300025904 Bacteria 2091
286 Ga0207647_10169438 3300025904 Bacteria 1272
287 Ga0207647_10185994 3300025904 Bacteria 1205
288 Ga0207647_10270401 3300025904 Bacteria 972
289 Ga0207645_10000896 3300025907 Bacteria 24720
290 Ga0207645_10205697 3300025907 Bacteria 1296
291 Ga0207705_11246809 3300025909 Bacteria 569
292 Ga0207684_10486099 3300025910 Bacteria 1059
293 Ga0207707_10036901 3300025912 Bacteria 4271
294 Ga0207707_10225064 3300025912 Bacteria 1633
295 Ga0207707_10302974 3300025912 Bacteria 1382
296 Ga0207695_10216696 3300025913 Bacteria 1823
297 Ga0207660_10000036 3300025917 Bacteria 65280
298 Ga0207660_10000601 3300025917 Bacteria 24291
299 Ga0207660_10002663 3300025917 Bacteria 11714
300 Ga0207660_10814445 3300025917 Bacteria 762
301 Ga0207657_10008696 3300025919 Bacteria 10278
302 Ga0207657_10070752 3300025919 Bacteria 2956
303 Ga0207657_10320281 3300025919 Bacteria 1226
304 Ga0207657_10338746 3300025919 Bacteria 1187
305 Ga0207657_11263536 3300025919 Unclassified 559
306 Ga0207657_11498030 3300025919 Bacteria 504
307 Ga0207649_10221364 3300025920 Bacteria 1348
308 Ga0207649_10226285 3300025920 Bacteria 1335
309 Ga0207649_10510393 3300025920 Bacteria 915
310 Ga0207652_10000282 3300025921 Bacteria 52954
311 Ga0207652_10128594 3300025921 Bacteria 2258
312 Ga0207652_10268040 3300025921 Bacteria 1540
313 Ga0207652_10394492 3300025921 Bacteria 1249
314 Ga0207652_11470382 3300025921 Unclassified 585
315 Ga0207681_10025491 3300025923 Bacteria 3804
316 Ga0207681_10101866 3300025923 Bacteria 2072
317 Ga0207681_10256287 3300025923 Bacteria 1368
318 Ga0207681_10613839 3300025923 Bacteria 899
319 Ga0207681_10854415 3300025923 Bacteria 761
320 Ga0207650_10032573 3300025925 Bacteria 3770
321 Ga0207650_10053346 3300025925 Bacteria 2996
322 Ga0207650_10105433 3300025925 Bacteria 2176
323 Ga0207650_10202631 3300025925 Bacteria 1590
324 Ga0207650_10392774 3300025925 Bacteria 1147
325 Ga0207650_10400334 3300025925 Bacteria 1136
326 Ga0207650_10848396 3300025925 Bacteria 775
327 Ga0207659_10052445 3300025926 Bacteria 2905
328 Ga0207659_10187125 3300025926 Bacteria 1645
329 Ga0207659_10740351 3300025926 Bacteria 843
330 Ga0207659_10834984 3300025926 Bacteria 792
331 Ga0207687_10053851 3300025927 Bacteria 2813
332 Ga0207644_10129473 3300025931 Bacteria 1930
333 Ga0207644_10158836 3300025931 Bacteria 1755
334 Ga0207644_10689046 3300025931 Bacteria 852
335 Ga0207690_10001735 3300025932 Bacteria 13389
336 Ga0207690_10007671 3300025932 Bacteria 6401
337 Ga0207690_10096099 3300025932 Bacteria 2106
338 Ga0207690_10208542 3300025932 Bacteria 1488
339 Ga0207690_10325552 3300025932 Bacteria 1209
340 Ga0207690_10600534 3300025932 Bacteria 898
341 Ga0207690_10821447 3300025932 Bacteria 769
342 Ga0207706_10001971 3300025933 Bacteria 20129
343 Ga0207706_10011384 3300025933 Bacteria 8104
344 Ga0207706_10019015 3300025933 Bacteria 6179
345 Ga0207706_10246455 3300025933 Bacteria 1561
346 Ga0207706_10296453 3300025933 Bacteria 1409
347 Ga0207706_10338254 3300025933 Bacteria 1309
348 Ga0207706_10597333 3300025933 Bacteria 948
349 Ga0207706_10654796 3300025933 Bacteria 899
350 Ga0207706_10673847 3300025933 Bacteria 885
351 Ga0207706_10684921 3300025933 Bacteria 876
352 Ga0207706_10689551 3300025933 Bacteria 873
353 Ga0207686_10175713 3300025934 Bacteria 1514
354 Ga0207709_10251706 3300025935 Bacteria 1290
355 Ga0207709_11075009 3300025935 Bacteria 660
356 Ga0207670_11261060 3300025936 Bacteria 626
357 Ga0207669_10027720 3300025937 Bacteria 3106
358 Ga0207704_10527844 3300025938 Bacteria 956
359 Ga0207691_10016716 3300025940 Bacteria 6967
360 Ga0207691_10040559 3300025940 Bacteria 4300
361 Ga0207691_10131639 3300025940 Bacteria 2209
362 Ga0207691_10173307 3300025940 Bacteria 1888
363 Ga0207691_10176570 3300025940 Bacteria 1868
364 Ga0207691_11136873 3300025940 Bacteria 649
365 Ga0207711_10000044 3300025941 Bacteria 157113
366 Ga0207711_10002788 3300025941 Bacteria 15372
367 Ga0207711_10290223 3300025941 Bacteria 1507
368 Ga0207711_10765459 3300025941 Bacteria 900
369 Ga0207689_10056285 3300025942 Bacteria 3236
370 Ga0207661_10019876 3300025944 Bacteria 5011
371 Ga0207679_10102524 3300025945 Bacteria 2241
372 Ga0207679_10175322 3300025945 Bacteria 1769
373 Ga0207667_10031806 3300025949 Bacteria 5693
374 Ga0207667_10228824 3300025949 Bacteria 1904
375 Ga0207667_10533197 3300025949 Bacteria 1188
376 Ga0207667_10708501 3300025949 Bacteria 1009
377 Ga0207651_10013342 3300025960 Bacteria 4699
378 Ga0207651_10053890 3300025960 Bacteria 2752
379 Ga0207651_10193713 3300025960 Bacteria 1623
380 Ga0207651_10544446 3300025960 Bacteria 1008
381 Ga0207651_10704990 3300025960 Bacteria 889
382 Ga0207651_11159976 3300025960 Bacteria 693
383 Ga0207712_10000146 3300025961 Bacteria 73378
384 Ga0207668_10000070 3300025972 Bacteria 78666
385 Ga0207668_10123637 3300025972 Bacteria 1963
386 Ga0207668_10204555 3300025972 Bacteria 1574
387 Ga0207668_10398005 3300025972 Bacteria 1164
388 Ga0207668_10414747 3300025972 Bacteria 1142
389 Ga0207668_10451323 3300025972 Bacteria 1097
390 Ga0207668_11150732 3300025972 Bacteria 696
391 Ga0207640_10233268 3300025981 Bacteria 1417
392 Ga0207658_10003145 3300025986 Bacteria 11800
393 Ga0207658_10010373 3300025986 Bacteria 6329
394 Ga0207658_10014037 3300025986 Bacteria 5482
395 Ga0207658_10061221 3300025986 Bacteria 2812
396 Ga0207658_10241121 3300025986 Bacteria 1531
397 Ga0207658_10318027 3300025986 Bacteria 1346
398 Ga0207658_10736228 3300025986 Bacteria 892
399 Ga0207658_11294432 3300025986 Bacteria 666
400 Ga0207677_10190191 3300026023 Bacteria 1623
401 Ga0207677_10208464 3300026023 Bacteria 1559
402 Ga0207677_10735199 3300026023 Bacteria 878
403 Ga0207703_10001894 3300026035 Bacteria 18548
404 Ga0207703_10197836 3300026035 Bacteria 1784
405 Ga0207703_10216939 3300026035 Bacteria 1709
406 Ga0207703_10531430 3300026035 Bacteria 1107
407 Ga0207639_10018488 3300026041 Bacteria 4954
408 Ga0207639_10177987 3300026041 Bacteria 1807
409 Ga0207639_10389217 3300026041 Bacteria 1254
410 Ga0207639_10818106 3300026041 Bacteria 868
411 Ga0207678_10008786 3300026067 Bacteria 8888
412 Ga0207678_10238724 3300026067 Bacteria 1557
413 Ga0207678_10708428 3300026067 Bacteria 886
414 Ga0207678_10791141 3300026067 Bacteria 837
415 Ga0207678_10854184 3300026067 Bacteria 804
416 Ga0207702_10087890 3300026078 Bacteria 2714
417 Ga0207702_10212973 3300026078 Bacteria 1797
418 Ga0207702_10790616 3300026078 Bacteria 938
419 Ga0207702_11706061 3300026078 Bacteria 623
420 Ga0207702_12253534 3300026078 Bacteria 533
421 Ga0207641_10001621 3300026088 Bacteria 21953
422 Ga0207641_10012721 3300026088 Bacteria 6899
423 Ga0207641_10123683 3300026088 Bacteria 2312
424 Ga0207641_10223147 3300026088 Bacteria 1748
425 Ga0207641_10353398 3300026088 Bacteria 1401
426 Ga0207641_10393435 3300026088 Bacteria 1329
427 Ga0207648_10001147 3300026089 Bacteria 29705
428 Ga0207676_10000446 3300026095 Bacteria 34960
429 Ga0207676_10127213 3300026095 Bacteria 2160
430 Ga0207676_10193746 3300026095 Bacteria 1790
431 Ga0207674_10000308 3300026116 Bacteria 62120
432 Ga0207674_10017639 3300026116 Bacteria 7785
433 Ga0207674_10044650 3300026116 Bacteria 4564
434 Ga0207674_10098667 3300026116 Bacteria 2904
435 Ga0207675_100922909 3300026118 Bacteria 890
436 Ga0207683_10002429 3300026121 Bacteria 16257
437 Ga0207683_10048333 3300026121 Bacteria 3726
438 Ga0207683_10081358 3300026121 Bacteria 2875
439 Ga0207683_10086414 3300026121 Bacteria 2789
440 Ga0207683_10759058 3300026121 Bacteria 900
441 Ga0207698_10066347 3300026142 Bacteria 2840
442 Ga0207698_11026180 3300026142 Bacteria 836
443 Ga0207698_12211088 3300026142 Bacteria 563
444 Ga0207698_12548937 3300026142 Bacteria 521
445 Ga0209974_10018805 3300027876 Bacteria 2292
446 Ga0207428_11080493 3300027907 Bacteria 561
447 Ga0268266_10022686 3300028379 Bacteria 5344
448 Ga0268265_10002034 3300028380 Bacteria 15864
449 Ga0268265_10002414 3300028380 Bacteria 14116
450 Ga0268265_10096649 3300028380 Bacteria 2374
451 Ga0268265_10124154 3300028380 Bacteria 2133
452 Ga0268265_10128271 3300028380 Bacteria 2103
453 Ga0268265_10155332 3300028380 Bacteria 1935
454 Ga0268265_10342279 3300028380 Bacteria 1362
455 Ga0268265_10857644 3300028380 Bacteria 889
456 Ga0268264_10000594 3300028381 Bacteria 43886
457 Ga0268264_10038170 3300028381 Bacteria 3962
458 Ga0268264_10102959 3300028381 Bacteria 2485
459 Ga0268264_10192024 3300028381 Bacteria 1862
460 Ga0268264_10301920 3300028381 Bacteria 1507
461 Ga0307408_100003245 3300031548 Bacteria 11190
462 Ga0307408_100105095 3300031548 Bacteria 2158
463 Ga0307408_100435963 3300031548 Bacteria 1133
464 Ga0307408_100654920 3300031548 Bacteria 939
465 Ga0307408_102101306 3300031548 Unclassified 544
466 Ga0307405_10004008 3300031731 Bacteria 6904
467 Ga0307405_10074580 3300031731 Bacteria 2194
468 Ga0307405_10088417 3300031731 Bacteria 2044
469 Ga0307405_10300383 3300031731 Bacteria 1218
470 Ga0307413_10001065 3300031824 Bacteria 9979
471 Ga0307413_10002155 3300031824 Bacteria 7907
472 Ga0307413_10003599 3300031824 Bacteria 6564
473 Ga0307413_10023642 3300031824 Bacteria 3333
474 Ga0307413_10066838 3300031824 Bacteria 2245
475 Ga0307410_10005221 3300031852 Bacteria 6840
476 Ga0307410_10013619 3300031852 Bacteria 4751
477 Ga0307410_10037711 3300031852 Bacteria 3159
478 Ga0307410_10072743 3300031852 Bacteria 2388
479 Ga0307410_10084939 3300031852 Bacteria 2232
480 Ga0307410_10110798 3300031852 Bacteria 1986
481 Ga0307410_10224979 3300031852 Bacteria 1445
482 Ga0307410_10231291 3300031852 Bacteria 1427
483 Ga0307410_10247153 3300031852 Bacteria 1385
484 Ga0307410_10546464 3300031852 Bacteria 959
485 Ga0307410_10594690 3300031852 Bacteria 922
486 Ga0307406_10042373 3300031901 Bacteria 2841
487 Ga0307406_10053285 3300031901 Bacteria 2576
488 Ga0307406_10171404 3300031901 Bacteria 1571
489 Ga0307406_10204226 3300031901 Bacteria 1457
490 Ga0307407_10001159 3300031903 Bacteria 9255
491 Ga0307407_10013889 3300031903 Bacteria 3924
492 Ga0307407_10020739 3300031903 Bacteria 3373
493 Ga0307407_10069755 3300031903 Bacteria 2087
494 Ga0307407_10162721 3300031903 Bacteria 1462
495 Ga0307407_10362661 3300031903 Bacteria 1029
496 Ga0307412_10063899 3300031911 Bacteria 2485
497 Ga0307409_100000982 3300031995 Bacteria 13335
498 Ga0307409_100001176 3300031995 Bacteria 12507
499 Ga0307409_100002347 3300031995 Bacteria 9838
500 Ga0307409_100025935 3300031995 Bacteria 4122
501 Ga0307409_100037710 3300031995 Bacteria 3565
502 Ga0307409_100337535 3300031995 Bacteria 1416
503 Ga0307409_100435241 3300031995 Bacteria 1262
504 Ga0307409_100721505 3300031995 Bacteria 998
505 Ga0307416_100009905 3300032002 Bacteria 6268
506 Ga0307416_100014684 3300032002 Bacteria 5380
507 Ga0307416_100041367 3300032002 Bacteria 3589
508 Ga0307416_100185192 3300032002 Bacteria 1956
509 Ga0307416_102688278 3300032002 Bacteria 594
510 Ga0307414_10002980 3300032004 Bacteria 8963
511 Ga0307414_10003702 3300032004 Bacteria 8196
512 Ga0307414_10004745 3300032004 Bacteria 7420
513 Ga0307414_10057117 3300032004 Bacteria 2741
514 Ga0307414_10120220 3300032004 Bacteria 2018
515 Ga0307414_10144795 3300032004 Bacteria 1865
516 Ga0307414_10403466 3300032004 Bacteria 1188
517 Ga0307414_10895217 3300032004 Bacteria 813
518 Ga0307411_10001476 3300032005 Bacteria 9660
519 Ga0307411_10002611 3300032005 Bacteria 8056
520 Ga0307411_10011170 3300032005 Bacteria 4831
521 Ga0307411_10015660 3300032005 Bacteria 4267
522 Ga0307411_10021267 3300032005 Bacteria 3792
523 Ga0307411_10040583 3300032005 Bacteria 2953
524 Ga0307411_10310166 3300032005 Bacteria 1269
525 Ga0307415_100568634 3300032126 Bacteria 1003
526 Ga0307415_101409578 3300032126 Bacteria 664
527 Ga0373938_0124721 3300034957 Bacteria 667
528 Ga0373940_0064450 3300035088 Bacteria 1055
529 Ga0395899_0000258 3300037312 Bacteria 69644
530 Ga0395899_0025051 3300037312 Bacteria 4505
531 Ga0395899_0046049 3300037312 Bacteria 3249
532 Ga0395899_0350192 3300037312 Bacteria 988
533 Ga0395899_0749013 3300037312 Unclassified 608
534 Ga0395900_0000254 3300037418 Bacteria 83296
535 Ga0395900_0025252 3300037418 Bacteria 6082
536 Ga0395900_0034717 3300037418 Bacteria 5195
537 Ga0395900_0039372 3300037418 Bacteria 4870
538 Ga0395900_0049003 3300037418 Bacteria 4351
539 Ga0395900_0076714 3300037418 Bacteria 3434
540 Ga0395900_0132416 3300037418 Bacteria 2555
541 Ga0395900_0202242 3300037418 Bacteria 2009
542 Ga0395900_0605144 3300037418 Bacteria 1036
543 Ga0395900_0615402 3300037418 Bacteria 1025
544 Ga0395900_0941858 3300037418 Bacteria 785
545 Ga0395900_1353298 3300037418 Unclassified 625
546 Ga0395898_0027557 3300037466 Bacteria 5701
547 Ga0395898_0059442 3300037466 Bacteria 3718
548 Ga0395898_0132568 3300037466 Bacteria 2386
549 Ga0395898_0354931 3300037466 Bacteria 1398
550 Ga0395898_0499340 3300037466 Bacteria 1157
551 Ga0395898_0570712 3300037466 Bacteria 1074
552 Ga0395898_1645368 3300037466 Bacteria 566
553 Ga0395905_0001843 3300037471 Bacteria 24471
554 Ga0395905_0004604 3300037471 Bacteria 14271
555 Ga0395905_0010770 3300037471 Bacteria 8862
556 Ga0395905_0045919 3300037471 Bacteria 4097
557 Ga0395905_0071396 3300037471 Bacteria 3255
558 Ga0395905_0103530 3300037471 Bacteria 2672
559 Ga0395905_0116289 3300037471 Bacteria 2514
560 Ga0395905_0125512 3300037471 Bacteria 2413
561 Ga0395905_0134418 3300037471 Bacteria 2326
562 Ga0395905_0142458 3300037471 Bacteria 2255
563 Ga0395905_0195147 3300037471 Bacteria 1898
564 Ga0395905_0234941 3300037471 Bacteria 1714
565 Ga0395905_0265365 3300037471 Bacteria 1602
566 Ga0395905_0344153 3300037471 Bacteria 1382
567 Ga0395905_0569056 3300037471 Bacteria 1034
568 Ga0395905_1548442 3300037471 Bacteria 567
569 Ga0395901_0000030 3300038443 Bacteria 241916
570 Ga0395901_0010489 3300038443 Bacteria 9385
571 Ga0395901_0031748 3300038443 Bacteria 5446
572 Ga0395901_0094124 3300038443 Bacteria 3138
573 Ga0395901_0113399 3300038443 Bacteria 2847
574 Ga0395901_0133385 3300038443 Bacteria 2610
575 Ga0395901_0163961 3300038443 Bacteria 2334
576 Ga0395901_0167671 3300038443 Bacteria 2305
577 Ga0395901_0180773 3300038443 Bacteria 2212
578 Ga0395901_0458129 3300038443 Bacteria 1303
579 Ga0395901_0570229 3300038443 Bacteria 1145
580 Ga0395901_0598954 3300038443 Bacteria 1111
581 Ga0395901_0766908 3300038443 Bacteria 956
582 Ga0395901_1131299 3300038443 Bacteria 752
583 Ga0395901_1236482 3300038443 Bacteria 711
584 Ga0436365_1712901 3300039437 Unclassified 572
585 Ga0451802_1581971 3300041460 Bacteria 618
586 Ga0439432_118348 3300042006 Bacteria 785
587 Ga0439449_0230147 3300042007 Bacteria 696
588 Ga0439457_123173 3300042014 Bacteria 614
589 Ga0450914_010990 3300042118 Bacteria 885
590 Ga0450920_062340 3300042122 Bacteria 754
591 Ga0450902_058411 3300042137 Unclassified 666
592 Ga0450905_007187 3300042142 Bacteria 1514
593 Ga0450889_001776 3300042144 Bacteria 2183
594 Ga0450889_002757 3300042144 Bacteria 1743
595 Ga0439464_0082359 3300042439 Unclassified 962
596 Ga0466965_0171159 3300044683 Bacteria 1143
597 Ga0466965_0493601 3300044683 Bacteria 686
598 Ga0466965_0577460 3300044683 Bacteria 637
599 Ga0466966_0012063 3300044684 Bacteria 5726
600 Ga0466961_0038610 3300044693 Bacteria 3063
601 Ga0466961_0045249 3300044693 Bacteria 2816
602 Ga0466961_0697132 3300044693 Bacteria 608
603 Ga0466963_0008334 3300044694 Bacteria 6209
604 Ga0466963_0048501 3300044694 Bacteria 2806
605 Ga0466963_0076312 3300044694 Bacteria 2263
606 Ga0466963_0166974 3300044694 Bacteria 1533
607 Ga0466963_0187753 3300044694 Bacteria 1444
608 Ga0466963_0759950 3300044694 Bacteria 684
609 Ga0466963_0993085 3300044694 Bacteria 591
610 Ga0466964_0209116 3300044706 Bacteria 941
611 Ga0466964_0444369 3300044706 Bacteria 686
612 Ga0466964_0604769 3300044706 Unclassified 602
613 Ga0453684_0581089 3300044712 Bacteria 1230
614 Ga0466971_0257638 3300044719 Bacteria 832
615 Ga0466971_0457353 3300044719 Bacteria 626
616 Ga0466968_0031048 3300044735 Bacteria 2215
617 Ga0466970_0046367 3300044765 Bacteria 2315
618 Ga0466970_0476953 3300044765 Bacteria 717
619 Ga0466957_0042850 3300044842 Bacteria 2739
620 Ga0466957_0344767 3300044842 Bacteria 1009
621 Ga0466957_0818021 3300044842 Bacteria 662
622 Ga0466960_0060292 3300044901 Bacteria 1859
623 Ga0466959_0191762 3300045049 Bacteria 1426
624 Ga0466959_0285978 3300045049 Bacteria 1131
625 Ga0466959_0541062 3300045049 Bacteria 786
626 Ga0466958_0067347 3300045836 Bacteria 2187
627 Ga0466958_0176460 3300045836 Bacteria 1355
628 Ga0466958_0179114 3300045836 Bacteria 1345
629 Ga0466958_0329359 3300045836 Bacteria 982
630 Ga0466967_0032422 3300045976 Bacteria 4411
631 Ga0466967_0153582 3300045976 Bacteria 2154
632 Ga0466967_0195589 3300045976 Bacteria 1913
633 Ga0466967_1910956 3300045976 Bacteria 590
634 Ga0495668_0029251 3300046616 Bacteria 3113
635 Ga0495669_0007857 3300046684 Bacteria 4475
636 Ga0495669_0120314 3300046684 Bacteria 1230
637 Ga0495669_0129330 3300046684 Bacteria 1188
638 Ga0495670_0181976 3300046691 Bacteria 1110
639 Ga0495685_164653 3300047447 Bacteria 717
640 Ga0496100_0012340 3300048903 Bacteria 4895
641 Ga0496101_0353849 3300048904 Bacteria 1154
642 Ga0496102_0403060 3300048905 Bacteria 1286
643 Ga0496104_0502831 3300048907 Bacteria 1123
644 Ga0496106_1132034 3300048909 Bacteria 612
645 Ga0496108_1088835 3300048911 Bacteria 679
646 Ga0496109_0179240 3300048912 Bacteria 1989
647 Ga0496109_0278645 3300048912 Bacteria 1576
648 Ga0496110_0004667 3300048913 Bacteria 10653
649 Ga0496110_1421121 3300048913 Bacteria 603
650 Ga0496111_0168022 3300048914 Bacteria 1629
651 Ga0496112_0000161 3300048915 Bacteria 42407
652 Ga0496112_0084734 3300048915 Bacteria 3135
653 Ga0496113_0171659 3300048916 Bacteria 1717
654 Ga0501068_0220819 3300049584 Bacteria 1205
655 Ga0501070_0713683 3300049586 Bacteria 792
656 Ga0501272_004900 3300049769 Bacteria 1400
657 nmdc:mga00v17_341896_c1 3300050491 Bacteria 973
658 nmdc:mga08y16_474037_c1 3300050511 Bacteria 1274
659 nmdc:mga0n895_500255_c1 3300050512 Bacteria 1224
660 nmdc:mga0rr50_108143_c1 3300050513 Bacteria 2196
661 Ga0495655_0236334 3300053083 Bacteria 610
662 Ga0500658_0000041 3300053134 Bacteria 77435
663 Ga0590071_058255 3300059421 Bacteria 942
664 Ga0466962_0002451 3300061719 Bacteria 8803
665 Ga0466962_0060630 3300061719 Bacteria 1806
666 Ga0530510_0300200 3300061734 Bacteria 1202
667 Ga0157373_10013865
668 JGI24737J22298_10000672
669 JGI24737J22298_10001512
670 JGI24735J21928_10047027
671 JGI25406J46586_10099566
672 rootL2_10288675
673 Ga0065712_10340438
674 Ga0070658_10247776
675 Ga0070658_10573062
676 Ga0070676_10000509
677 Ga0070676_10451753
678 Ga0070683_100020756
679 Ga0070683_100063070
680 Ga0070683_101988264
681 Ga0070690_100173990
682 Ga0070690_101275709
683 Ga0070670_100026391
684 Ga0070670_100044342
685 Ga0070670_100147446
686 Ga0070670_100212518
687 Ga0070670_100796010
688 Ga0070670_101311644
689 Ga0070677_10255327
690 Ga0070677_10899494
691 Ga0068869_100018311
692 Ga0068869_100141300
693 Ga0070666_10153778
694 Ga0070680_100000315
695 Ga0070680_100000498
696 Ga0070680_100002832
697 Ga0070680_100093037
698 Ga0070680_101491438
699 Ga0070682_100318513
700 Ga0070682_100459482
701 Ga0068868_100001494
702 Ga0068868_100173496
703 Ga0068868_100228584
704 Ga0070660_100004844
705 Ga0070660_100123096
706 Ga0070660_100523240
707 Ga0070660_101430119
708 Ga0070689_101745657
709 Ga0070687_100181193
710 Ga0070661_100207804
711 Ga0070661_100248848
712 Ga0070661_100282469
713 Ga0070661_100290370
714 Ga0070661_100379902
715 Ga0070661_101237467
716 Ga0070692_10020838
717 Ga0070668_100006224
718 Ga0070668_100051865
719 Ga0070668_100066239
720 Ga0070668_100163068
721 Ga0070668_100292828
722 Ga0070668_100387453
723 Ga0070668_101606053
724 Ga0070669_100099610
725 Ga0070669_100136402
726 Ga0070669_100143061
727 Ga0070669_100203585
728 Ga0070669_100324653
729 Ga0070669_100330651
730 Ga0070669_100428363
731 Ga0070669_100969370
732 Ga0070669_101033874
733 Ga0070675_100010756
734 Ga0070675_100455244
735 Ga0070675_100852518
736 Ga0070675_101070226
737 Ga0070675_101173371
738 Ga0070671_100041175
739 Ga0070671_100623898
740 Ga0070671_100916449
741 Ga0070674_100052279
742 Ga0070673_100026023
743 Ga0070673_100228142
744 Ga0070673_100390812
745 Ga0070673_100405012
746 Ga0070673_100579308
747 Ga0070673_100674801
748 Ga0070659_100007979
749 Ga0070659_100096583
750 Ga0070659_100111597
751 Ga0070659_100112184
752 Ga0070659_100114554
753 Ga0070659_100701755
754 Ga0070659_101062357
755 Ga0070667_100008606
756 Ga0070667_100014172
757 Ga0070667_100072587
758 Ga0070667_100126888
759 Ga0070667_100141072
760 Ga0070667_100190792
761 Ga0070667_100389756
762 Ga0070667_100466084
763 Ga0070667_100723886
764 Ga0070667_100881683
765 Ga0070694_100007483
766 Ga0070694_100120664
767 Ga0070663_100105013
768 Ga0070663_100435715
769 Ga0070663_101311223
770 Ga0070663_101316187
771 Ga0070678_100011915
772 Ga0070678_100298788
773 Ga0070678_100426217
774 Ga0070678_100755976
775 Ga0070678_101430537
776 Ga0070662_100000934
777 Ga0070662_100003335
778 Ga0070662_100014311
779 Ga0070662_100150297
780 Ga0070662_100277823
781 Ga0070662_100395007
782 Ga0070662_101141422
783 Ga0070662_101843204
784 Ga0070681_10031435
785 Ga0070681_10244703
786 Ga0070681_10515760
787 Ga0070681_10724812
788 Ga0070681_10977723
789 Ga0068867_100010679
790 Ga0070679_100000168
791 Ga0070679_100123920
792 Ga0070679_100264639
793 Ga0070679_100269547
794 Ga0070679_101241897
795 Ga0070684_100016587
796 Ga0068853_100129850
797 Ga0068853_100283508
798 Ga0068853_100302154
799 Ga0068853_100355967
800 Ga0068853_100531276
801 Ga0070672_100027847
802 Ga0070672_100037801
803 Ga0070672_100088695
804 Ga0070672_100234701
805 Ga0070672_100261376
806 Ga0070672_100609942
807 Ga0070672_100810479
808 Ga0070695_100033084
809 Ga0070696_100006262
810 Ga0070696_100111003
811 Ga0070696_100830899
812 Ga0070693_100161784
813 Ga0070693_101369648
814 Ga0070665_100034682
815 Ga0070665_100100117
816 Ga0070704_100096152
817 Ga0068855_100038250
818 Ga0068855_100348133
819 Ga0068855_100491085
820 Ga0068855_101057050
821 Ga0070664_100208366
822 Ga0070664_100264826
823 Ga0070664_100287619
824 Ga0070664_100582691
825 Ga0070664_100735116
826 Ga0068857_100039999
827 Ga0068857_100097523
828 Ga0068857_100308502
829 Ga0068857_100889689
830 Ga0068854_100080166
831 Ga0068854_100085711
832 Ga0068854_101485475
833 Ga0068854_101556129
834 Ga0068856_100385809
835 Ga0068856_101880999
836 Ga0068856_102101173
837 Ga0068852_100009958
838 Ga0068852_101511750
839 Ga0068859_100003414
840 Ga0068859_100282440
841 Ga0068859_100709148
842 Ga0068864_100000713
843 Ga0068864_100119374
844 Ga0068861_100405401
845 Ga0068851_10029313
846 Ga0068851_10219917
847 Ga0068870_10304506
848 Ga0068870_10362482
849 Ga0068863_100002105
850 Ga0068863_100018929
851 Ga0068863_100424539
852 Ga0068863_100702053
853 Ga0068863_101175819
854 Ga0068858_100001407
855 Ga0068858_100039755
856 Ga0068858_100323313
857 Ga0068860_100287680
858 Ga0068860_100881333
859 Ga0068862_100021503
860 Ga0068862_100021750
861 Ga0068862_100023331
862 Ga0068862_100054869
863 Ga0068862_100147946
864 Ga0068862_101445395
865 Ga0068862_101634202
866 Ga0081539_10026704
867 Ga0075364_10176282
868 Ga0097621_100888289
869 Ga0097621_102044228
870 Ga0068871_100060940
871 Ga0068871_101718745
872 Ga0075428_100129750
873 Ga0068865_100045327
874 Ga0068865_100948822
875 Ga0097620_100003414
876 Ga0097620_100282438
877 Ga0105250_10010478
878 Ga0105240_10079793
879 Ga0111539_10376563
880 Ga0105245_11485603
881 Ga0105247_10169341
882 Ga0105247_10826621
883 Ga0114129_10608096
884 Ga0105243_10305865
885 Ga0105242_10726910
886 Ga0105248_10001965
887 Ga0105248_10008231
888 Ga0105248_10132205
889 Ga0105248_10452693
890 Ga0105238_10156175
891 Ga0105238_12212614
892 Ga0105249_10016888
893 Ga0105249_10053856
894 Ga0105032_109239
895 Ga0105239_10070025
896 Ga0105239_11655576
897 Ga0105246_10089247
898 Ga0105246_10408555
899 Ga0105246_11644939
900 Ga0157373_10029911
901 Ga0157373_10033215
902 Ga0157373_10091837
903 Ga0157373_10150328
904 Ga0157373_10212272
905 Ga0157373_10275138
906 Ga0157373_10594883
907 Ga0157373_11038709
908 Ga0157371_10192335
909 Ga0157371_10359133
910 Ga0157371_10633413
911 Ga0157370_10212313
912 Ga0157369_10003259
913 Ga0157369_10252813
914 Ga0157369_10253597
915 Ga0157369_10796016
916 Ga0157369_10948459
917 Ga0157369_12123328
918 Ga0157369_12198977
919 Ga0157369_12236933
920 Ga0157374_10038946
921 Ga0157374_10164698
922 Ga0157374_10763577
923 Ga0157378_10549720
924 Ga0163162_10054089
925 Ga0163162_10167045
926 Ga0163162_11009521
927 Ga0157372_12642371
928 Ga0157375_10088799
929 Ga0157375_10739556
930 Ga0157375_10949388
931 Ga0157375_11070644
932 Ga0163163_10000991
933 Ga0163163_10032361
934 Ga0182008_10289308
935 Ga0157377_10271923
936 Ga0157379_10001787
937 Ga0157379_10200885
938 Ga0163161_10536780
939 Ga0163161_10821570
940 Ga0206354_10006003
941 Ga0206353_10770303
942 Ga0207656_10022043
943 Ga0207656_10080435
944 Ga0207696_1009792
945 Ga0207682_10042604
946 Ga0207682_10601355
947 Ga0207710_10093107
948 Ga0207688_10387893
949 Ga0207680_10063221
950 Ga0207647_10001771
951 Ga0207647_10071617
952 Ga0207647_10169438
953 Ga0207647_10185994
954 Ga0207647_10270401
955 Ga0207645_10000896
956 Ga0207645_10205697
957 Ga0207705_11246809
958 Ga0207684_10486099
959 Ga0207707_10036901
960 Ga0207707_10225064
961 Ga0207707_10302974
962 Ga0207695_10216696
963 Ga0207660_10000036
964 Ga0207660_10000601
965 Ga0207660_10002663
966 Ga0207660_10814445
967 Ga0207657_10008696
968 Ga0207657_10070752
969 Ga0207657_10320281
970 Ga0207657_10338746
971 Ga0207657_11263536
972 Ga0207657_11498030
973 Ga0207649_10221364
974 Ga0207649_10226285
975 Ga0207649_10510393
976 Ga0207652_10000282
977 Ga0207652_10128594
978 Ga0207652_10268040
979 Ga0207652_10394492
980 Ga0207652_11470382
981 Ga0207681_10025491
982 Ga0207681_10101866
983 Ga0207681_10256287
984 Ga0207681_10613839
985 Ga0207681_10854415
986 Ga0207650_10032573
987 Ga0207650_10053346
988 Ga0207650_10105433
989 Ga0207650_10202631
990 Ga0207650_10392774
991 Ga0207650_10400334
992 Ga0207650_10848396
993 Ga0207659_10052445
994 Ga0207659_10187125
995 Ga0207659_10740351
996 Ga0207659_10834984
997 Ga0207687_10053851
998 Ga0207644_10129473
999 Ga0207644_10158836
1000 Ga0207644_10689046
1001 Ga0207690_10001735
1002 Ga0207690_10007671
1003 Ga0207690_10096099
1004 Ga0207690_10208542
1005 Ga0207690_10325552
1006 Ga0207690_10600534
1007 Ga0207690_10821447
1008 Ga0207706_10001971
1009 Ga0207706_10011384
1010 Ga0207706_10019015
1011 Ga0207706_10246455
1012 Ga0207706_10296453
1013 Ga0207706_10338254
1014 Ga0207706_10597333
1015 Ga0207706_10654796
1016 Ga0207706_10673847
1017 Ga0207706_10684921
1018 Ga0207706_10689551
1019 Ga0207686_10175713
1020 Ga0207709_10251706
1021 Ga0207709_11075009
1022 Ga0207670_11261060
1023 Ga0207669_10027720
1024 Ga0207704_10527844
1025 Ga0207691_10016716
1026 Ga0207691_10040559
1027 Ga0207691_10131639
1028 Ga0207691_10173307
1029 Ga0207691_10176570
1030 Ga0207691_11136873
1031 Ga0207711_10000044
1032 Ga0207711_10002788
1033 Ga0207711_10290223
1034 Ga0207711_10765459
1035 Ga0207689_10056285
1036 Ga0207661_10019876
1037 Ga0207679_10102524
1038 Ga0207679_10175322
1039 Ga0207667_10031806
1040 Ga0207667_10228824
1041 Ga0207667_10533197
1042 Ga0207667_10708501
1043 Ga0207651_10013342
1044 Ga0207651_10053890
1045 Ga0207651_10193713
1046 Ga0207651_10544446
1047 Ga0207651_10704990
1048 Ga0207651_11159976
1049 Ga0207712_10000146
1050 Ga0207668_10000070
1051 Ga0207668_10123637
1052 Ga0207668_10204555
1053 Ga0207668_10398005
1054 Ga0207668_10414747
1055 Ga0207668_10451323
1056 Ga0207668_11150732
1057 Ga0207640_10233268
1058 Ga0207658_10003145
1059 Ga0207658_10010373
1060 Ga0207658_10014037
1061 Ga0207658_10061221
1062 Ga0207658_10241121
1063 Ga0207658_10318027
1064 Ga0207658_10736228
1065 Ga0207658_11294432
1066 Ga0207677_10190191
1067 Ga0207677_10208464
1068 Ga0207677_10735199
1069 Ga0207703_10001894
1070 Ga0207703_10197836
1071 Ga0207703_10216939
1072 Ga0207703_10531430
1073 Ga0207639_10018488
1074 Ga0207639_10177987
1075 Ga0207639_10389217
1076 Ga0207639_10818106
1077 Ga0207678_10008786
1078 Ga0207678_10238724
1079 Ga0207678_10708428
1080 Ga0207678_10791141
1081 Ga0207678_10854184
1082 Ga0207702_10087890
1083 Ga0207702_10212973
1084 Ga0207702_10790616
1085 Ga0207702_11706061
1086 Ga0207702_12253534
1087 Ga0207641_10001621
1088 Ga0207641_10012721
1089 Ga0207641_10123683
1090 Ga0207641_10223147
1091 Ga0207641_10353398
1092 Ga0207641_10393435
1093 Ga0207648_10001147
1094 Ga0207676_10000446
1095 Ga0207676_10127213
1096 Ga0207676_10193746
1097 Ga0207674_10000308
1098 Ga0207674_10017639
1099 Ga0207674_10044650
1100 Ga0207674_10098667
1101 Ga0207675_100922909
1102 Ga0207683_10002429
1103 Ga0207683_10048333
1104 Ga0207683_10081358
1105 Ga0207683_10086414
1106 Ga0207683_10759058
1107 Ga0207698_10066347
1108 Ga0207698_11026180
1109 Ga0207698_12211088
1110 Ga0207698_12548937
1111 Ga0209974_10018805
1112 Ga0207428_11080493
1113 Ga0268266_10022686
1114 Ga0268265_10002034
1115 Ga0268265_10002414
1116 Ga0268265_10096649
1117 Ga0268265_10124154
1118 Ga0268265_10128271
1119 Ga0268265_10155332
1120 Ga0268265_10342279
1121 Ga0268265_10857644
1122 Ga0268264_10000594
1123 Ga0268264_10038170
1124 Ga0268264_10102959
1125 Ga0268264_10192024
1126 Ga0268264_10301920
1127 Ga0307408_100003245
1128 Ga0307408_100105095
1129 Ga0307408_100435963
1130 Ga0307408_100654920
1131 Ga0307408_102101306
1132 Ga0307405_10004008
1133 Ga0307405_10074580
1134 Ga0307405_10088417
1135 Ga0307405_10300383
1136 Ga0307413_10001065
1137 Ga0307413_10002155
1138 Ga0307413_10003599
1139 Ga0307413_10023642
1140 Ga0307413_10066838
1141 Ga0307410_10005221
1142 Ga0307410_10013619
1143 Ga0307410_10037711
1144 Ga0307410_10072743
1145 Ga0307410_10084939
1146 Ga0307410_10110798
1147 Ga0307410_10224979
1148 Ga0307410_10231291
1149 Ga0307410_10247153
1150 Ga0307410_10546464
1151 Ga0307410_10594690
1152 Ga0307406_10042373
1153 Ga0307406_10053285
1154 Ga0307406_10171404
1155 Ga0307406_10204226
1156 Ga0307407_10001159
1157 Ga0307407_10013889
1158 Ga0307407_10020739
1159 Ga0307407_10069755
1160 Ga0307407_10162721
1161 Ga0307407_10362661
1162 Ga0307412_10063899
1163 Ga0307409_100000982
1164 Ga0307409_100001176
1165 Ga0307409_100002347
1166 Ga0307409_100025935
1167 Ga0307409_100037710
1168 Ga0307409_100337535
1169 Ga0307409_100435241
1170 Ga0307409_100721505
1171 Ga0307416_100009905
1172 Ga0307416_100014684
1173 Ga0307416_100041367
1174 Ga0307416_100185192
1175 Ga0307416_102688278
1176 Ga0307414_10002980
1177 Ga0307414_10003702
1178 Ga0307414_10004745
1179 Ga0307414_10057117
1180 Ga0307414_10120220
1181 Ga0307414_10144795
1182 Ga0307414_10403466
1183 Ga0307414_10895217
1184 Ga0307411_10001476
1185 Ga0307411_10002611
1186 Ga0307411_10011170
1187 Ga0307411_10015660
1188 Ga0307411_10021267
1189 Ga0307411_10040583
1190 Ga0307411_10310166
1191 Ga0307415_100568634
1192 Ga0307415_101409578
1193 Ga0373938_0124721
1194 Ga0373940_0064450
1195 Ga0395899_0000258
1196 Ga0395899_0025051
1197 Ga0395899_0046049
1198 Ga0395899_0350192
1199 Ga0395899_0749013
1200 Ga0395900_0000254
1201 Ga0395900_0025252
1202 Ga0395900_0034717
1203 Ga0395900_0039372
1204 Ga0395900_0049003
1205 Ga0395900_0076714
1206 Ga0395900_0132416
1207 Ga0395900_0202242
1208 Ga0395900_0605144
1209 Ga0395900_0615402
1210 Ga0395900_0941858
1211 Ga0395900_1353298
1212 Ga0395898_0027557
1213 Ga0395898_0059442
1214 Ga0395898_0132568
1215 Ga0395898_0354931
1216 Ga0395898_0499340
1217 Ga0395898_0570712
1218 Ga0395898_1645368
1219 Ga0395905_0001843
1220 Ga0395905_0004604
1221 Ga0395905_0010770
1222 Ga0395905_0045919
1223 Ga0395905_0071396
1224 Ga0395905_0103530
1225 Ga0395905_0116289
1226 Ga0395905_0125512
1227 Ga0395905_0134418
1228 Ga0395905_0142458
1229 Ga0395905_0195147
1230 Ga0395905_0234941
1231 Ga0395905_0265365
1232 Ga0395905_0344153
1233 Ga0395905_0569056
1234 Ga0395905_1548442
1235 Ga0395901_0000030
1236 Ga0395901_0010489
1237 Ga0395901_0031748
1238 Ga0395901_0094124
1239 Ga0395901_0113399
1240 Ga0395901_0133385
1241 Ga0395901_0163961
1242 Ga0395901_0167671
1243 Ga0395901_0180773
1244 Ga0395901_0458129
1245 Ga0395901_0570229
1246 Ga0395901_0598954
1247 Ga0395901_0766908
1248 Ga0395901_1131299
1249 Ga0395901_1236482
1250 Ga0436365_1712901
1251 Ga0451802_1581971
1252 Ga0439432_118348
1253 Ga0439449_0230147
1254 Ga0439457_123173
1255 Ga0450914_010990
1256 Ga0450920_062340
1257 Ga0450902_058411
1258 Ga0450905_007187
1259 Ga0450889_001776
1260 Ga0450889_002757
1261 Ga0439464_0082359
1262 Ga0466965_0171159
1263 Ga0466965_0493601
1264 Ga0466965_0577460
1265 Ga0466966_0012063
1266 Ga0466961_0038610
1267 Ga0466961_0045249
1268 Ga0466961_0697132
1269 Ga0466963_0008334
1270 Ga0466963_0048501
1271 Ga0466963_0076312
1272 Ga0466963_0166974
1273 Ga0466963_0187753
1274 Ga0466963_0759950
1275 Ga0466963_0993085
1276 Ga0466964_0209116
1277 Ga0466964_0444369
1278 Ga0466964_0604769
1279 Ga0453684_0581089
1280 Ga0466971_0257638
1281 Ga0466971_0457353
1282 Ga0466968_0031048
1283 Ga0466970_0046367
1284 Ga0466970_0476953
1285 Ga0466957_0042850
1286 Ga0466957_0344767
1287 Ga0466957_0818021
1288 Ga0466960_0060292
1289 Ga0466959_0191762
1290 Ga0466959_0285978
1291 Ga0466959_0541062
1292 Ga0466958_0067347
1293 Ga0466958_0176460
1294 Ga0466958_0179114
1295 Ga0466958_0329359
1296 Ga0466967_0032422
1297 Ga0466967_0153582
1298 Ga0466967_0195589
1299 Ga0466967_1910956
1300 Ga0495668_0029251
1301 Ga0495669_0007857
1302 Ga0495669_0120314
1303 Ga0495669_0129330
1304 Ga0495670_0181976
1305 Ga0495685_164653
1306 Ga0496100_0012340
1307 Ga0496101_0353849
1308 Ga0496102_0403060
1309 Ga0496104_0502831
1310 Ga0496106_1132034
1311 Ga0496108_1088835
1312 Ga0496109_0179240
1313 Ga0496109_0278645
1314 Ga0496110_0004667
1315 Ga0496110_1421121
1316 Ga0496111_0168022
1317 Ga0496112_0000161
1318 Ga0496112_0084734
1319 Ga0496113_0171659
1320 Ga0501068_0220819
1321 Ga0501070_0713683
1322 Ga0501272_004900
1323 nmdc:mga00v17_341896_c1
1324 nmdc:mga08y16_474037_c1
1325 nmdc:mga0n895_500255_c1
1326 nmdc:mga0rr50_108143_c1
1327 Ga0495655_0236334
1328 Ga0500658_0000041
1329 Ga0590071_058255
1330 Ga0466962_0002451
1331 Ga0466962_0060630
1332 Ga0530510_0300200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

62

137

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.97 2 129
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9523 18 123
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9493 17 123
4xy5-assembly1.cif.gz_A crystal structure of mutant (asp52ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4 0.9384 25 128
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.9384 25 127
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9493 17 123 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9384 25 128 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9378 2 129 3.10.129.10
af_A0A0R0KY19_2_94_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.925 23 101 3.10.129.10
af_A0A0N7KK42_47_200_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.915 18 126 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2H6AXV8-F1-model_v4 Acyl-coenzyme A thioesterase PaaI (EC 3.1.2.-) 0.9824 3 133 GO:0016289
AF-A0A2E3NNB7-F1-model_v4 Phenylacetic acid degradation protein PaaD 0.9823 14 131 GO:0016289
AF-A0A564WH45-F1-model_v4 Phenylacetic acid degradation-related protein:Phenylacetic acid degradation protein PaaD 0.9815 3 133 GO:0016289
AF-A0A179D4T0-F1-model_v4 Phenylacetic acid degradation protein PaaD, thioesterase 0.9812 6 129 GO:0016289
AF-A0A354D8H7-F1-model_v4 deleted 0.9805 7 102

Map