F473771

General Info

Members Datasets Scaffolds Average Seq Length
666 325 1332 140

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100010851|Ga0070664_1000108514
Length 159
Sequence MRECRGRRMRWSGLTHTRNSMATIHVDIVSAEGEIFSGEASMVIVPAAMGDIGIAPRHAPLLTTLRPGEIRVQVPDGEEQFFFVSGGAIEIQPHLVTVLADTALRAHDLDEAAASAAKQRAEEALRNRGTAVEVAEAQAELARXXXQLRAIEKLRKIKQ

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
185 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
209 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
210 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
216 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
217 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
218 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
219 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
220 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
266 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
292 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
293 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 2894510363 Methylomonas sp. Kb3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.8
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0
Rhizoplane 3
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100010851 3300005564 Bacteria 7390
2 Ga0065712_10112167 3300005290 Bacteria 1804
3 Ga0065715_10142692 3300005293 Bacteria 1830
4 Ga0065707_10082491 3300005295 Bacteria 14580
5 Ga0070676_10507989 3300005328 Bacteria 857
6 Ga0070676_10705495 3300005328 Bacteria 737
7 Ga0070683_100280502 3300005329 Bacteria 1585
8 Ga0070690_100000597 3300005330 Bacteria 18206
9 Ga0070690_100009484 3300005330 Bacteria 5640
10 Ga0070670_100000002 3300005331 Bacteria 568775
11 Ga0070670_100019019 3300005331 Bacteria 5891
12 Ga0070670_100163357 3300005331 Bacteria 1930
13 Ga0070677_10195850 3300005333 Bacteria 972
14 Ga0068869_100013018 3300005334 Bacteria 5519
15 Ga0068869_100361924 3300005334 Bacteria 1185
16 Ga0070666_10032611 3300005335 Bacteria 3441
17 Ga0070666_10038961 3300005335 Bacteria 3165
18 Ga0070666_10239596 3300005335 Bacteria 1282
19 Ga0070680_100042717 3300005336 Bacteria 3680
20 Ga0070682_100297078 3300005337 Bacteria 1184
21 Ga0068868_100015034 3300005338 Bacteria 5717
22 Ga0068868_100126686 3300005338 Bacteria 2087
23 Ga0068868_100389324 3300005338 Bacteria 1201
24 Ga0068868_100391493 3300005338 Bacteria 1198
25 Ga0068868_100922640 3300005338 Bacteria 795
26 Ga0070689_100000518 3300005340 Bacteria 22782
27 Ga0070689_100317707 3300005340 Bacteria 1300
28 Ga0070691_10043585 3300005341 Bacteria 2126
29 Ga0070687_100002852 3300005343 Bacteria 6605
30 Ga0070687_100069132 3300005343 Bacteria 1890
31 Ga0070661_100020262 3300005344 Bacteria 4740
32 Ga0070661_100056970 3300005344 Bacteria 2864
33 Ga0070692_10065825 3300005345 Bacteria 1919
34 Ga0070692_10237589 3300005345 Bacteria 1085
35 Ga0070668_100082701 3300005347 Bacteria 2519
36 Ga0070668_100241662 3300005347 Bacteria 1496
37 Ga0070668_100254603 3300005347 Bacteria 1458
38 Ga0070669_100032093 3300005353 Bacteria 3794
39 Ga0070669_100119731 3300005353 Bacteria 2007
40 Ga0070675_100001970 3300005354 Bacteria 15198
41 Ga0070675_100404776 3300005354 Bacteria 1218
42 Ga0070675_100965078 3300005354 Bacteria 782
43 Ga0070671_100000047 3300005355 Bacteria 84234
44 Ga0070671_100014437 3300005355 Bacteria 6383
45 Ga0070671_100039029 3300005355 Bacteria 3942
46 Ga0070671_100107665 3300005355 Bacteria 2340
47 Ga0070674_100239842 3300005356 Bacteria 1419
48 Ga0070674_100644461 3300005356 Bacteria 900
49 Ga0070673_100119118 3300005364 Bacteria 2199
50 Ga0070673_100186781 3300005364 Bacteria 1778
51 Ga0070673_100195041 3300005364 Bacteria 1741
52 Ga0070673_100220571 3300005364 Bacteria 1641
53 Ga0070673_100636546 3300005364 Bacteria 975
54 Ga0070688_100004687 3300005365 Bacteria 7136
55 Ga0070688_100180154 3300005365 Bacteria 1465
56 Ga0070688_100331420 3300005365 Bacteria 1109
57 Ga0070688_101223845 3300005365 Bacteria 604
58 Ga0070688_101344745 3300005365 Bacteria 578
59 Ga0070659_100599302 3300005366 Bacteria 947
60 Ga0070667_100000018 3300005367 Bacteria 226033
61 Ga0070667_100007686 3300005367 Bacteria 8941
62 Ga0070667_100048838 3300005367 Bacteria 3563
63 Ga0070667_100119091 3300005367 Bacteria 2295
64 Ga0070667_101278369 3300005367 Bacteria 687
65 Ga0070709_10221388 3300005434 Bacteria 1350
66 Ga0070701_10007937 3300005438 Bacteria 4565
67 Ga0070701_10977165 3300005438 Bacteria 589
68 Ga0070711_100154078 3300005439 Bacteria 1736
69 Ga0070711_100643124 3300005439 Bacteria 888
70 Ga0070705_100009782 3300005440 Bacteria 4779
71 Ga0070705_100249587 3300005440 Bacteria 1245
72 Ga0070700_100015633 3300005441 Bacteria 4308
73 Ga0070694_100086431 3300005444 Bacteria 2191
74 Ga0070694_100125446 3300005444 Bacteria 1847
75 Ga0070663_100321379 3300005455 Bacteria 1245
76 Ga0070678_100030204 3300005456 Bacteria 3722
77 Ga0070678_100884358 3300005456 Bacteria 816
78 Ga0070662_100005447 3300005457 Bacteria 8130
79 Ga0070662_100016565 3300005457 Bacteria 4950
80 Ga0070662_101531294 3300005457 Bacteria 575
81 Ga0068867_100013369 3300005459 Bacteria 5814
82 Ga0068867_100647773 3300005459 Bacteria 927
83 Ga0070685_10000001 3300005466 Bacteria 349867
84 Ga0070685_10018527 3300005466 Bacteria 3745
85 Ga0070706_101239280 3300005467 Bacteria 685
86 Ga0070707_101552062 3300005468 Bacteria 629
87 Ga0070679_100042764 3300005530 Bacteria 4513
88 Ga0070679_100108973 3300005530 Bacteria 2756
89 Ga0070684_100000535 3300005535 Bacteria 26071
90 Ga0070684_100652627 3300005535 Bacteria 979
91 Ga0068853_100138638 3300005539 Bacteria 2182
92 Ga0068853_100834068 3300005539 Bacteria 884
93 Ga0068853_101199436 3300005539 Bacteria 733
94 Ga0070672_100492978 3300005543 Bacteria 1059
95 Ga0070672_101201418 3300005543 Bacteria 676
96 Ga0070686_100212679 3300005544 Bacteria 1393
97 Ga0070686_100758131 3300005544 Bacteria 779
98 Ga0070695_100073526 3300005545 Bacteria 2244
99 Ga0070696_100269170 3300005546 Bacteria 1295
100 Ga0070693_100064407 3300005547 Bacteria 2140
101 Ga0070665_100005419 3300005548 Bacteria 13158
102 Ga0070665_100021847 3300005548 Bacteria 6435
103 Ga0070665_100528428 3300005548 Bacteria 1191
104 Ga0070665_100936723 3300005548 Bacteria 879
105 Ga0070665_101891202 3300005548 Bacteria 603
106 Ga0070704_100024741 3300005549 Bacteria 3943
107 Ga0068855_100067596 3300005563 Bacteria 4162
108 Ga0068855_100288400 3300005563 Bacteria 1820
109 Ga0070664_100027599 3300005564 Bacteria 4718
110 Ga0070664_100643985 3300005564 Bacteria 985
111 Ga0070664_101471625 3300005564 Bacteria 644
112 Ga0068857_100148619 3300005577 Bacteria 2121
113 Ga0068857_100352691 3300005577 Bacteria 1363
114 Ga0068854_100118402 3300005578 Bacteria 2007
115 Ga0068856_100289865 3300005614 Bacteria 1654
116 Ga0068856_100942549 3300005614 Bacteria 882
117 Ga0070702_100000268 3300005615 Bacteria 17734
118 Ga0070702_100630853 3300005615 Bacteria 808
119 Ga0068852_100010999 3300005616 Bacteria 6788
120 Ga0068852_100448567 3300005616 Bacteria 1277
121 Ga0068859_100000952 3300005617 Bacteria 29623
122 Ga0068859_100027832 3300005617 Bacteria 5670
123 Ga0068859_100115994 3300005617 Bacteria 2742
124 Ga0068859_100885738 3300005617 Bacteria 978
125 Ga0068859_101194833 3300005617 Bacteria 838
126 Ga0068859_101556841 3300005617 Bacteria 730
127 Ga0068864_100000003 3300005618 Bacteria 568775
128 Ga0068864_100003938 3300005618 Bacteria 12229
129 Ga0068864_100022552 3300005618 Bacteria 5279
130 Ga0068864_100040965 3300005618 Bacteria 3961
131 Ga0068864_100566595 3300005618 Bacteria 1099
132 Ga0068864_100579602 3300005618 Bacteria 1087
133 Ga0068866_10068923 3300005718 Bacteria 1862
134 Ga0068861_100005659 3300005719 Bacteria 8476
135 Ga0068861_100018199 3300005719 Bacteria 5000
136 Ga0068861_100027981 3300005719 Bacteria 4111
137 Ga0068861_101461206 3300005719 Bacteria 670
138 Ga0068851_10071061 3300005834 Bacteria 1800
139 Ga0068851_10172241 3300005834 Bacteria 1195
140 Ga0068870_10049552 3300005840 Bacteria 2216
141 Ga0068863_100000641 3300005841 Bacteria 35462
142 Ga0068863_100005347 3300005841 Bacteria 12661
143 Ga0068858_100064858 3300005842 Bacteria 3380
144 Ga0068858_100077592 3300005842 Bacteria 3086
145 Ga0068858_100886900 3300005842 Bacteria 872
146 Ga0068858_101006256 3300005842 Bacteria 817
147 Ga0068860_100005872 3300005843 Bacteria 12356
148 Ga0068860_100023700 3300005843 Bacteria 5934
149 Ga0068860_100312258 3300005843 Bacteria 1542
150 Ga0068862_100005690 3300005844 Bacteria 10399
151 Ga0068862_100020287 3300005844 Bacteria 5551
152 Ga0068862_100140729 3300005844 Bacteria 2141
153 Ga0068862_100224604 3300005844 Bacteria 1701
154 Ga0068862_100231153 3300005844 Bacteria 1678
155 Ga0068862_100647708 3300005844 Bacteria 1019
156 Ga0068862_101847834 3300005844 Bacteria 614
157 Ga0081540_1092352 3300005983 Bacteria 1328
158 Ga0081539_10072118 3300005985 Bacteria 1847
159 Ga0070715_10358439 3300006163 Bacteria 799
160 Ga0075427_10014037 3300006194 Bacteria 1227
161 Ga0097621_100234200 3300006237 Bacteria 1604
162 Ga0097621_100242224 3300006237 Bacteria 1577
163 Ga0097621_100378216 3300006237 Bacteria 1264
164 Ga0097621_100414537 3300006237 Bacteria 1208
165 Ga0068871_100020731 3300006358 Bacteria 5040
166 Ga0068871_100188553 3300006358 Bacteria 1775
167 Ga0068871_100418238 3300006358 Bacteria 1196
168 Ga0075428_100001223 3300006844 Bacteria 27518
169 Ga0075428_100010077 3300006844 Bacteria 10501
170 Ga0075428_100159118 3300006844 Bacteria 2452
171 Ga0075428_100411312 3300006844 Bacteria 1449
172 Ga0075428_100667153 3300006844 Bacteria 1108
173 Ga0075430_100021039 3300006846 Bacteria 5546
174 Ga0075430_100053897 3300006846 Bacteria 3385
175 Ga0075430_100091638 3300006846 Bacteria 2541
176 Ga0075430_100109687 3300006846 Bacteria 2302
177 Ga0075430_100915157 3300006846 Bacteria 722
178 Ga0075431_100000314 3300006847 Bacteria 38252
179 Ga0075431_100022489 3300006847 Bacteria 6446
180 Ga0075431_100712723 3300006847 Bacteria 980
181 Ga0075433_10816042 3300006852 Bacteria 815
182 Ga0075434_100097922 3300006871 Bacteria 2938
183 Ga0075429_100001058 3300006880 Bacteria 22001
184 Ga0075429_100029466 3300006880 Bacteria 4767
185 Ga0075429_100143821 3300006880 Bacteria 2087
186 Ga0075429_100213368 3300006880 Bacteria 1691
187 Ga0068865_100025177 3300006881 Bacteria 3911
188 Ga0068865_100037991 3300006881 Bacteria 3256
189 Ga0068865_100198951 3300006881 Bacteria 1555
190 Ga0068865_101517869 3300006881 Bacteria 601
191 Ga0097620_100000952 3300006931 Bacteria 29623
192 Ga0097620_100027832 3300006931 Bacteria 5670
193 Ga0097620_100115993 3300006931 Bacteria 2742
194 Ga0097620_100885648 3300006931 Bacteria 978
195 Ga0097620_101194861 3300006931 Bacteria 838
196 Ga0097620_101556847 3300006931 Bacteria 730
197 Ga0075435_100827879 3300007076 Bacteria 806
198 Ga0105251_10219931 3300009011 Bacteria 855
199 Ga0105244_10337792 3300009036 Bacteria 695
200 Ga0105250_10130576 3300009092 Bacteria 1037
201 Ga0105240_10474836 3300009093 Bacteria 1395
202 Ga0105240_10582764 3300009093 Bacteria 1234
203 Ga0105240_10717443 3300009093 Bacteria 1090
204 Ga0111539_10004339 3300009094 Bacteria 18563
205 Ga0111539_10095989 3300009094 Bacteria 3482
206 Ga0111539_10128454 3300009094 Bacteria 2969
207 Ga0111539_10234120 3300009094 Bacteria 2138
208 Ga0111539_10536350 3300009094 Bacteria 1363
209 Ga0105245_10492397 3300009098 Bacteria 1241
210 Ga0105247_10138182 3300009101 Bacteria 1594
211 Ga0105247_10310603 3300009101 Bacteria 1097
212 Ga0114129_10002637 3300009147 Bacteria 24969
213 Ga0114129_10020530 3300009147 Bacteria 9395
214 Ga0114129_12234499 3300009147 Bacteria 658
215 Ga0105243_10051851 3300009148 Bacteria 3247
216 Ga0105243_10454617 3300009148 Bacteria 1202
217 Ga0105243_10956876 3300009148 Bacteria 856
218 Ga0105243_12944560 3300009148 Bacteria 516
219 Ga0105241_10973912 3300009174 Bacteria 792
220 Ga0105241_12659139 3300009174 Bacteria 503
221 Ga0105242_10666165 3300009176 Bacteria 1014
222 Ga0105242_11310572 3300009176 Bacteria 748
223 Ga0105248_10000895 3300009177 Bacteria 33359
224 Ga0105248_10029194 3300009177 Bacteria 6150
225 Ga0105248_10259906 3300009177 Bacteria 1955
226 Ga0105248_10584876 3300009177 Bacteria 1260
227 Ga0105238_10011157 3300009551 Bacteria 9037
228 Ga0105249_10026253 3300009553 Bacteria 5247
229 Ga0105249_10035929 3300009553 Bacteria 4494
230 Ga0105249_10062855 3300009553 Bacteria 3409
231 Ga0105249_10095217 3300009553 Bacteria 2791
232 Ga0105249_12803892 3300009553 Bacteria 559
233 Ga0105239_10021948 3300010375 Bacteria 7037
234 Ga0105239_10390054 3300010375 Bacteria 1575
235 Ga0105246_10021140 3300011119 Bacteria 4184
236 Ga0105246_10442011 3300011119 Bacteria 1091
237 Ga0157370_11566355 3300013104 Bacteria 592
238 Ga0157374_10318916 3300013296 Bacteria 1540
239 Ga0157374_10821964 3300013296 Bacteria 945
240 Ga0157378_10141432 3300013297 Bacteria 2235
241 Ga0157378_10391602 3300013297 Bacteria 1367
242 Ga0163162_10018159 3300013306 Bacteria 6887
243 Ga0163162_10241916 3300013306 Bacteria 1936
244 Ga0163162_10468385 3300013306 Bacteria 1391
245 Ga0163162_11894848 3300013306 Bacteria 682
246 Ga0157372_11474344 3300013307 Bacteria 784
247 Ga0157375_10009999 3300013308 Bacteria 8339
248 Ga0157375_10117022 3300013308 Bacteria 2770
249 Ga0157375_10195131 3300013308 Bacteria 2180
250 Ga0157375_10481244 3300013308 Bacteria 1406
251 Ga0163163_10000145 3300014325 Bacteria 74233
252 Ga0163163_10008857 3300014325 Bacteria 8960
253 Ga0163163_10077638 3300014325 Bacteria 3316
254 Ga0163163_11448997 3300014325 Bacteria 748
255 Ga0157380_10002636 3300014326 Bacteria 12148
256 Ga0157380_10155430 3300014326 Bacteria 1982
257 Ga0157377_10001141 3300014745 Bacteria 11257
258 Ga0157377_10755437 3300014745 Bacteria 712
259 Ga0157379_10081503 3300014968 Bacteria 2898
260 Ga0157379_10242439 3300014968 Bacteria 1635
261 Ga0157379_10301914 3300014968 Unclassified 1459
262 Ga0157379_10800097 3300014968 Bacteria 890
263 Ga0157376_10043575 3300014969 Bacteria 3683
264 Ga0157376_10577352 3300014969 Bacteria 1116
265 Ga0157376_11226708 3300014969 Bacteria 779
266 Ga0163161_10717350 3300017792 Bacteria 834
267 Ga0207656_10007886 3300025321 Bacteria 3898
268 Ga0207696_1080087 3300025711 Bacteria 902
269 Ga0207692_10147957 3300025898 Bacteria 1342
270 Ga0207642_10071064 3300025899 Bacteria 1656
271 Ga0207710_10371678 3300025900 Bacteria 731
272 Ga0207688_10054301 3300025901 Bacteria 2247
273 Ga0207680_10221518 3300025903 Bacteria 1297
274 Ga0207680_11026825 3300025903 Unclassified 590
275 Ga0207685_10145385 3300025905 Bacteria 1067
276 Ga0207699_10039464 3300025906 Bacteria 2713
277 Ga0207699_10142826 3300025906 Bacteria 1575
278 Ga0207645_10063871 3300025907 Bacteria 2353
279 Ga0207643_10004076 3300025908 Bacteria 7859
280 Ga0207707_10313242 3300025912 Bacteria 1356
281 Ga0207695_10449627 3300025913 Bacteria 1171
282 Ga0207663_10119812 3300025916 Bacteria 1800
283 Ga0207663_10256785 3300025916 Bacteria 1289
284 Ga0207662_10007994 3300025918 Bacteria 5767
285 Ga0207662_10370677 3300025918 Bacteria 965
286 Ga0207649_10010544 3300025920 Bacteria 5081
287 Ga0207649_10116540 3300025920 Bacteria 1794
288 Ga0207649_10388465 3300025920 Bacteria 1042
289 Ga0207652_10041743 3300025921 Bacteria 3902
290 Ga0207652_10116260 3300025921 Bacteria 2376
291 Ga0207681_10013128 3300025923 Bacteria 5120
292 Ga0207681_10027213 3300025923 Bacteria 3696
293 Ga0207681_10107045 3300025923 Bacteria 2027
294 Ga0207650_10000003 3300025925 Bacteria 1123235
295 Ga0207650_10235475 3300025925 Bacteria 1478
296 Ga0207650_10279806 3300025925 Bacteria 1358
297 Ga0207650_10328827 3300025925 Bacteria 1253
298 Ga0207650_10796042 3300025925 Bacteria 801
299 Ga0207659_10005231 3300025926 Bacteria 7859
300 Ga0207659_10583433 3300025926 Bacteria 952
301 Ga0207644_10000055 3300025931 Bacteria 84281
302 Ga0207644_10048560 3300025931 Bacteria 3035
303 Ga0207644_10163006 3300025931 Bacteria 1734
304 Ga0207690_10383444 3300025932 Bacteria 1117
305 Ga0207706_10007795 3300025933 Bacteria 9881
306 Ga0207706_10142756 3300025933 Bacteria 2106
307 Ga0207686_10352590 3300025934 Bacteria 1108
308 Ga0207709_10055029 3300025935 Bacteria 2456
309 Ga0207709_10058587 3300025935 Bacteria 2394
310 Ga0207709_10341457 3300025935 Bacteria 1127
311 Ga0207670_10002080 3300025936 Bacteria 10467
312 Ga0207670_10267979 3300025936 Bacteria 1326
313 Ga0207669_11864365 3300025937 Bacteria 514
314 Ga0207704_10023221 3300025938 Bacteria 3338
315 Ga0207704_10036947 3300025938 Bacteria 2816
316 Ga0207691_10050917 3300025940 Bacteria 3789
317 Ga0207691_10562988 3300025940 Bacteria 966
318 Ga0207691_11013998 3300025940 Bacteria 692
319 Ga0207711_10000290 3300025941 Bacteria 53653
320 Ga0207711_10000950 3300025941 Bacteria 27744
321 Ga0207711_10002129 3300025941 Bacteria 17844
322 Ga0207711_10014445 3300025941 Bacteria 6559
323 Ga0207711_10310212 3300025941 Bacteria 1457
324 Ga0207689_10004952 3300025942 Bacteria 11999
325 Ga0207689_10142267 3300025942 Bacteria 1976
326 Ga0207689_10262773 3300025942 Bacteria 1428
327 Ga0207689_10570204 3300025942 Bacteria 951
328 Ga0207661_10354216 3300025944 Bacteria 1325
329 Ga0207661_10455129 3300025944 Bacteria 1166
330 Ga0207679_10047108 3300025945 Bacteria 3130
331 Ga0207679_10186280 3300025945 Bacteria 1721
332 Ga0207651_10088381 3300025960 Bacteria 2259
333 Ga0207712_10129633 3300025961 Bacteria 1920
334 Ga0207712_10140723 3300025961 Bacteria 1851
335 Ga0207712_10908117 3300025961 Bacteria 778
336 Ga0207668_10154596 3300025972 Bacteria 1780
337 Ga0207668_11259353 3300025972 Bacteria 665
338 Ga0207640_10071487 3300025981 Bacteria 2337
339 Ga0207658_10000004 3300025986 Bacteria 569357
340 Ga0207658_10058671 3300025986 Bacteria 2865
341 Ga0207658_10236576 3300025986 Unclassified 1544
342 Ga0207677_10222641 3300026023 Bacteria 1514
343 Ga0207677_10847251 3300026023 Bacteria 821
344 Ga0207703_10012006 3300026035 Bacteria 6746
345 Ga0207703_10354145 3300026035 Bacteria 1352
346 Ga0207703_11471783 3300026035 Bacteria 655
347 Ga0207639_10693690 3300026041 Bacteria 944
348 Ga0207678_10377747 3300026067 Bacteria 1225
349 Ga0207708_10045503 3300026075 Bacteria 3345
350 Ga0207708_10059899 3300026075 Bacteria 2906
351 Ga0207702_11338212 3300026078 Bacteria 710
352 Ga0207641_10021505 3300026088 Bacteria 5301
353 Ga0207641_10053015 3300026088 Bacteria 3436
354 Ga0207648_10020838 3300026089 Bacteria 5902
355 Ga0207648_10312751 3300026089 Bacteria 1410
356 Ga0207648_11709076 3300026089 Bacteria 591
357 Ga0207676_10000003 3300026095 Bacteria 1123235
358 Ga0207676_10169107 3300026095 Bacteria 1902
359 Ga0207676_10420276 3300026095 Bacteria 1254
360 Ga0207676_10597154 3300026095 Bacteria 1060
361 Ga0207674_10127441 3300026116 Bacteria 2510
362 Ga0207674_10207753 3300026116 Bacteria 1907
363 Ga0207674_10207796 3300026116 Bacteria 1907
364 Ga0207675_100002194 3300026118 Bacteria 19394
365 Ga0207675_100008919 3300026118 Bacteria 9409
366 Ga0207675_100015629 3300026118 Bacteria 7078
367 Ga0207675_100027489 3300026118 Bacteria 5299
368 Ga0207683_10073005 3300026121 Bacteria 3035
369 Ga0207683_10593146 3300026121 Bacteria 1025
370 Ga0207698_10875235 3300026142 Unclassified 904
371 Ga0209966_1014188 3300027695 Bacteria 1484
372 Ga0207428_10010667 3300027907 Bacteria 8193
373 Ga0207428_10085436 3300027907 Bacteria 2457
374 Ga0207428_10147854 3300027907 Bacteria 1790
375 Ga0207428_10356758 3300027907 Bacteria 1075
376 Ga0207428_10905376 3300027907 Bacteria 623
377 Ga0268266_10024069 3300028379 Bacteria 5182
378 Ga0268266_10028046 3300028379 Bacteria 4787
379 Ga0268266_10152774 3300028379 Bacteria 2082
380 Ga0268266_11334638 3300028379 Bacteria 693
381 Ga0268265_10000690 3300028380 Bacteria 33189
382 Ga0268265_10002286 3300028380 Bacteria 14581
383 Ga0268265_10021382 3300028380 Bacteria 4531
384 Ga0268265_10031997 3300028380 Bacteria 3805
385 Ga0268265_10491121 3300028380 Bacteria 1155
386 Ga0268264_10000009 3300028381 Bacteria 724972
387 Ga0268264_10345738 3300028381 Bacteria 1414
388 Ga0265327_10224169 3300031251 Bacteria 844
389 Ga0307509_10084894 3300031507 Bacteria 3260
390 Ga0307408_100031864 3300031548 Bacteria 3673
391 Ga0307408_100076520 3300031548 Bacteria 2490
392 Ga0307408_100259509 3300031548 Bacteria 1437
393 Ga0307408_100287165 3300031548 Bacteria 1372
394 Ga0307408_102211355 3300031548 Bacteria 532
395 Ga0316579_10066156 3300031691 Bacteria 1706
396 Ga0316576_10497214 3300031727 Bacteria 897
397 Ga0316578_10001917 3300031728 Bacteria 8794
398 Ga0316578_10395560 3300031728 Bacteria 819
399 Ga0307405_10070343 3300031731 Bacteria 2247
400 Ga0307405_10601722 3300031731 Bacteria 897
401 Ga0307405_10884768 3300031731 Bacteria 754
402 Ga0316577_10000215 3300031733 Bacteria 19739
403 Ga0307413_10197808 3300031824 Bacteria 1449
404 Ga0307413_10666068 3300031824 Bacteria 860
405 Ga0307413_10896770 3300031824 Bacteria 753
406 Ga0307413_11584633 3300031824 Bacteria 581
407 Ga0307413_11926363 3300031824 Bacteria 531
408 Ga0307410_10384977 3300031852 Unclassified 1129
409 Ga0307410_11133626 3300031852 Bacteria 679
410 Ga0307406_10155682 3300031901 Bacteria 1636
411 Ga0307407_10346869 3300031903 Bacteria 1050
412 Ga0307407_10940077 3300031903 Unclassified 665
413 Ga0307412_10092216 3300031911 Bacteria 2122
414 Ga0307416_100018233 3300032002 Bacteria 4939
415 Ga0307416_100336935 3300032002 Bacteria 1519
416 Ga0307416_100476598 3300032002 Bacteria 1307
417 Ga0307416_100818495 3300032002 Bacteria 1028
418 Ga0307416_101122051 3300032002 Bacteria 891
419 Ga0307414_10578663 3300032004 Bacteria 1004
420 Ga0307411_10040840 3300032005 Bacteria 2946
421 Ga0307411_10098797 3300032005 Bacteria 2058
422 Ga0307411_10153622 3300032005 Bacteria 1714
423 Ga0307411_10208152 3300032005 Bacteria 1508
424 Ga0307411_10684914 3300032005 Bacteria 891
425 Ga0307411_11533245 3300032005 Bacteria 613
426 Ga0307411_12163599 3300032005 Unclassified 521
427 Ga0307411_12242697 3300032005 Bacteria 512
428 Ga0307415_100117328 3300032126 Bacteria 1988
429 Ga0307415_100227292 3300032126 Bacteria 1500
430 Ga0316580_10020774 3300032139 Bacteria 2023
431 Ga0316593_10009487 3300032168 Bacteria 2751
432 Ga0316593_10016418 3300032168 Bacteria 2244
433 Ga0316593_10021013 3300032168 Bacteria 2036
434 Ga0316593_10023470 3300032168 Bacteria 1946
435 Ga0316593_10171917 3300032168 Bacteria 794
436 Ga0316592_1000659 3300033524 Bacteria 5026
437 Ga0316592_1042989 3300033524 Bacteria 1002
438 Ga0316586_1009831 3300033527 Bacteria 1440
439 Ga0316586_1053387 3300033527 Bacteria 726
440 Ga0316588_1171177 3300033528 Bacteria 561
441 Ga0316596_1004710 3300033541 Bacteria 3079
442 Ga0316596_1092278 3300033541 Bacteria 817
443 Ga0373958_0050983 3300034819 Bacteria 874
444 Ga0373926_0034056 3300035083 Bacteria 1802
445 Ga0373928_0057580 3300035084 Bacteria 933
446 Ga0373940_0261117 3300035088 Bacteria 586
447 Ga0373949_0073598 3300035090 Bacteria 899
448 Ga0373941_0236240 3300035115 Bacteria 708
449 Ga0373954_0566405 3300035118 Bacteria 563
450 Ga0373960_0301173 3300035121 Bacteria 596
451 Ga0373955_0001713 3300035172 Bacteria 9385
452 Ga0373955_0137277 3300035172 Bacteria 1431
453 Ga0373962_0141774 3300035242 Bacteria 781
454 Ga0316574_0185743 3300035398 Bacteria 1337
455 Ga0316574_0529958 3300035398 Bacteria 732
456 Ga0373931_0047076 3300035691 Bacteria 2282
457 Ga0373931_0223442 3300035691 Bacteria 1135
458 Ga0373933_0075035 3300035724 Bacteria 2064
459 Ga0373933_0228351 3300035724 Bacteria 1195
460 Ga0373937_0002788 3300036401 Bacteria 14589
461 Ga0373937_0046581 3300036401 Bacteria 3966
462 Ga0373937_0047279 3300036401 Bacteria 3937
463 Ga0316582_0552575 3300036647 Bacteria 793
464 Ga0316582_1108907 3300036647 Bacteria 539
465 Ga0316584_0004262 3300036712 Bacteria 9446
466 Ga0439436_0174854 3300041404 Bacteria 610
467 Ga0451798_0963655 3300041458 Bacteria 803
468 Ga0451849_0339504 3300041505 Unclassified 1351
469 Ga0451851_0192039 3300041507 Bacteria 1946
470 Ga0451855_1962699 3300041511 Bacteria 819
471 Ga0451853_3750232 3300041512 Bacteria 2263
472 Ga0439442_052627 3300042002 Bacteria 859
473 Ga0439448_0009174 3300042005 Bacteria 2913
474 Ga0439449_0136668 3300042007 Bacteria 912
475 Ga0439450_040587 3300042008 Bacteria 1079
476 Ga0439456_048320 3300042013 Bacteria 929
477 Ga0439457_033250 3300042014 Bacteria 1145
478 Ga0450914_006876 3300042118 Bacteria 1011
479 Ga0450895_023047 3300042132 Bacteria 585
480 Ga0450906_033496 3300042145 Bacteria 908
481 Ga0439460_0170023 3300042461 Bacteria 734
482 Ga0451577_0784356 3300042876 Bacteria 861
483 Ga0453684_0003750 3300044712 Bacteria 33597
484 Ga0453684_0046914 3300044712 Bacteria 5738
485 Ga0453684_0150809 3300044712 Bacteria 2763
486 Ga0451576_0027473 3300045051 Bacteria 6111
487 Ga0495617_064644 3300046452 Bacteria 1207
488 Ga0495603_0065999 3300046455 Bacteria 2132
489 Ga0495629_0073764 3300046459 Bacteria 2383
490 Ga0495638_0006331 3300046460 Bacteria 8628
491 Ga0495650_0005029 3300046471 Bacteria 8776
492 Ga0495639_0424442 3300046475 Bacteria 673
493 Ga0495639_0540094 3300046475 Bacteria 597
494 Ga0495630_0327841 3300046517 Bacteria 1171
495 Ga0495630_0575491 3300046517 Bacteria 863
496 Ga0495632_0086419 3300046519 Bacteria 1492
497 Ga0495643_0347276 3300046522 Unclassified 665
498 Ga0495586_0452775 3300046535 Bacteria 740
499 Ga0495668_0157531 3300046616 Bacteria 1244
500 Ga0495668_0161905 3300046616 Bacteria 1226
501 Ga0495634_0110058 3300046642 Bacteria 1772
502 Ga0495611_0172568 3300046648 Bacteria 1011
503 Ga0495625_0160159 3300046660 Bacteria 1508
504 Ga0495625_0330748 3300046660 Bacteria 968
505 Ga0495625_0629437 3300046660 Bacteria 641
506 Ga0495647_0031594 3300046681 Bacteria 1970
507 Ga0495658_0207612 3300046683 Bacteria 1223
508 Ga0495613_0233384 3300046689 Bacteria 1288
509 Ga0495624_0368423 3300046690 Bacteria 864
510 Ga0495649_0217154 3300046694 Bacteria 990
511 Ga0495600_0257495 3300046809 Bacteria 1109
512 Ga0495581_0426933 3300047315 Bacteria 772
513 Ga0495674_0175217 3300047319 Bacteria 1788
514 Ga0495672_0033225 3300047320 Bacteria 3198
515 Ga0495686_0069021 3300047472 Bacteria 2180
516 Ga0496100_0103837 3300048903 Bacteria 1963
517 Ga0496104_0714275 3300048907 Bacteria 910
518 Ga0496105_0532822 3300048908 Bacteria 919
519 Ga0496106_0204182 3300048909 Bacteria 1573
520 Ga0496108_0023888 3300048911 Bacteria 5032
521 Ga0496109_0071223 3300048912 Bacteria 3191
522 Ga0496109_0786647 3300048912 Unclassified 889
523 Ga0496109_1086634 3300048912 Bacteria 737
524 Ga0496110_0018563 3300048913 Bacteria 5833
525 Ga0496110_0662941 3300048913 Bacteria 944
526 Ga0496110_1070439 3300048913 Bacteria 714
527 Ga0496111_0221332 3300048914 Bacteria 1406
528 Ga0496111_0451919 3300048914 Bacteria 948
529 Ga0496112_0190249 3300048915 Bacteria 2014
530 Ga0496112_0213946 3300048915 Bacteria 1884
531 Ga0496113_0027445 3300048916 Bacteria 4082
532 Ga0496114_0007497 3300048917 Bacteria 8626
533 Ga0496114_0444745 3300048917 Bacteria 1148
534 Ga0496115_0037670 3300048918 Bacteria 3833
535 Ga0496117_0335834 3300048920 Bacteria 786
536 Ga0496118_0448854 3300048921 Bacteria 655
537 Ga0496121_0083935 3300048924 Bacteria 2513
538 Ga0496125_0042571 3300048928 Bacteria 3865
539 Ga0496125_0714717 3300048928 Bacteria 530
540 Ga0501299_033175 3300049522 Bacteria 1005
541 Ga0501299_207758 3300049522 Bacteria 523
542 Ga0501300_004898 3300049523 Bacteria 1979
543 Ga0501031_0518286 3300049568 Bacteria 769
544 Ga0501032_0238690 3300049569 Bacteria 1181
545 Ga0501033_0172546 3300049570 Bacteria 1553
546 Ga0501033_1194097 3300049570 Bacteria 504
547 Ga0501034_0384616 3300049571 Bacteria 1328
548 Ga0501036_0015397 3300049572 Bacteria 6387
549 Ga0501036_0132423 3300049572 Bacteria 2104
550 Ga0501037_0029540 3300049573 Bacteria 4050
551 Ga0501037_0086081 3300049573 Bacteria 2275
552 Ga0501038_0031913 3300049574 Bacteria 4652
553 Ga0501038_0171915 3300049574 Bacteria 1753
554 Ga0501039_0004204 3300049575 Bacteria 10841
555 Ga0501039_0021803 3300049575 Bacteria 4914
556 Ga0501040_0002374 3300049576 Bacteria 12094
557 Ga0501040_0011218 3300049576 Bacteria 5863
558 Ga0501040_0222819 3300049576 Bacteria 1342
559 Ga0501040_0560494 3300049576 Bacteria 825
560 Ga0501040_1207733 3300049576 Bacteria 549
561 Ga0501041_0026667 3300049577 Bacteria 3476
562 Ga0501042_0014631 3300049578 Bacteria 5359
563 Ga0501042_0042248 3300049578 Bacteria 3244
564 Ga0501042_0205215 3300049578 Bacteria 1421
565 Ga0501043_0297456 3300049579 Bacteria 1234
566 Ga0501043_1033999 3300049579 Bacteria 583
567 Ga0501046_0004224 3300049580 Bacteria 13073
568 Ga0501046_0049631 3300049580 Bacteria 3319
569 Ga0501046_0252261 3300049580 Bacteria 1298
570 Ga0501047_0542816 3300049581 Bacteria 987
571 Ga0501048_0035128 3300049582 Bacteria 3609
572 Ga0501048_0176067 3300049582 Bacteria 1516
573 Ga0501048_0328933 3300049582 Bacteria 1089
574 Ga0501048_1377580 3300049582 Bacteria 507
575 Ga0501068_0173364 3300049584 Bacteria 1362
576 Ga0501070_0171144 3300049586 Bacteria 1789
577 Ga0501071_0011344 3300049587 Bacteria 6002
578 Ga0501072_0010386 3300049588 Bacteria 7093
579 Ga0501072_1121122 3300049588 Bacteria 612
580 Ga0501073_0111272 3300049589 Bacteria 1899
581 Ga0501074_0017326 3300049590 Bacteria 5226
582 Ga0501074_0647348 3300049590 Bacteria 747
583 Ga0501075_0003347 3300049591 Bacteria 10712
584 Ga0501075_0117743 3300049591 Bacteria 2019
585 Ga0501076_0003033 3300049592 Bacteria 11670
586 Ga0501076_0187244 3300049592 Bacteria 1688
587 Ga0501076_0847427 3300049592 Bacteria 754
588 Ga0501076_1246148 3300049592 Bacteria 612
589 Ga0501077_0009787 3300049593 Bacteria 5964
590 Ga0501233_067465 3300049668 Bacteria 900
591 Ga0501251_102633 3300049681 Unclassified 525
592 Ga0501259_026915 3300049688 Bacteria 1062
593 Ga0501079_0000950 3300049741 Bacteria 19988
594 Ga0501079_0060748 3300049741 Bacteria 2915
595 Ga0501079_0782634 3300049741 Bacteria 751
596 Ga0501080_0006723 3300049742 Bacteria 10357
597 Ga0501080_0012364 3300049742 Bacteria 7824
598 Ga0501080_0120691 3300049742 Bacteria 2429
599 Ga0501080_0250308 3300049742 Bacteria 1616
600 Ga0501080_0483860 3300049742 Bacteria 1107
601 Ga0501080_0749260 3300049742 Bacteria 859
602 Ga0501081_0006652 3300049743 Bacteria 7515
603 Ga0501081_1063774 3300049743 Bacteria 612
604 Ga0501035_0041060 3300049822 Bacteria 4178
605 Ga0501035_0043977 3300049822 Bacteria 4024
606 Ga0501044_0038561 3300049823 Bacteria 4989
607 Ga0501044_0537089 3300049823 Bacteria 1068
608 Ga0501045_0009300 3300049824 Bacteria 6875
609 Ga0501045_0079378 3300049824 Bacteria 2419
610 Ga0501045_0774641 3300049824 Bacteria 707
611 nmdc:mga05p37_1145_c1 3300050507 Bacteria 30507
612 nmdc:mga05p37_20580_c1 3300050507 Bacteria 7983
613 nmdc:mga09592_2223_c1 3300050508 Bacteria 15624
614 nmdc:mga09592_245436_c1 3300050508 Bacteria 1552
615 nmdc:mga09592_25957_c1 3300050508 Bacteria 4852
616 nmdc:mga09592_92218_c1 3300050508 Bacteria 2589
617 nmdc:mga0qj67_2601_c1 3300050509 Bacteria 12928
618 nmdc:mga0qj67_304458_c1 3300050509 Bacteria 1291
619 nmdc:mga0qj67_4072_c1 3300050509 Bacteria 10606
620 nmdc:mga0qj67_568426_c1 3300050509 Bacteria 909
621 nmdc:mga0qj67_73528_c1 3300050509 Bacteria 2730
622 nmdc:mga06r32_1418_c1 3300050510 Bacteria 21607
623 nmdc:mga06r32_19790_c1 3300050510 Bacteria 6186
624 nmdc:mga06r32_358_c1 3300050510 Bacteria 38233
625 nmdc:mga06r32_790897_c1 3300050510 Bacteria 910
626 nmdc:mga06r32_798000_c1 3300050510 Bacteria 905
627 nmdc:mga08y16_1018018_c1 3300050511 Bacteria 807
628 nmdc:mga08y16_115543_c1 3300050511 Bacteria 2794
629 nmdc:mga08y16_246847_c1 3300050511 Bacteria 1845
630 nmdc:mga08y16_254778_c1 3300050511 Bacteria 1813
631 nmdc:mga08y16_290440_c1 3300050511 Bacteria 1686
632 nmdc:mga08y16_4348_c1 3300050511 Bacteria 12984
633 nmdc:mga08y16_60110_c1 3300050511 Bacteria 3970
634 nmdc:mga0n895_509316_c1 3300050512 Bacteria 1212
635 nmdc:mga0n895_947536_c1 3300050512 Bacteria 844
636 nmdc:mga0rr50_154426_c1 3300050513 Bacteria 1858
637 nmdc:mga0rr50_798044_c1 3300050513 Bacteria 805
638 nmdc:mga0a205_309777_c1 3300050515 Bacteria 1451
639 Ga0495601_0105917 3300053077 Bacteria 1818
640 Ga0500610_0059367 3300053079 Bacteria 1996
641 Ga0495619_0263607 3300053085 Bacteria 1194
642 Ga0500644_0119080 3300053088 Bacteria 1027
643 Ga0500644_0536114 3300053088 Bacteria 516
644 Ga0500583_0301119 3300053092 Bacteria 785
645 Ga0500641_0011255 3300053096 Bacteria 3245
646 Ga0500556_0263595 3300053104 Unclassified 677
647 Ga0500658_0242536 3300053134 Bacteria 828
648 Ga0500568_0194160 3300053139 Bacteria 744
649 Ga0500589_166221 3300053147 Bacteria 882
650 Ga0500604_0157532 3300053151 Bacteria 773
651 Ga0500616_0168368 3300053153 Bacteria 997
652 Ga0500622_0002111 3300053156 Bacteria 14812
653 Ga0500622_0004934 3300053156 Bacteria 8134
654 Ga0501084_0015338 3300054114 Bacteria 6353
655 Ga0501084_0016605 3300054114 Bacteria 6112
656 Ga0501084_0533713 3300054114 Bacteria 992
657 Ga0501084_0576607 3300054114 Bacteria 951
658 Ga0501084_1398487 3300054114 Unclassified 586
659 Ga0590071_205065 3300059421 Bacteria 519
660 Ga0501082_0020641 3300060353 Bacteria 5678
661 Ga0501082_0267900 3300060353 Bacteria 1486
662 Ga0501082_0945500 3300060353 Bacteria 754
663 Ga0530510_0015494 3300061734 Bacteria 5389
664 Ga0530510_0251942 3300061734 Bacteria 1316
665 Ga0530510_0816543 3300061734 Bacteria 712
666 2894514174 2894510363 Bacteria 5121143
667 Ga0070664_100010851
668 Ga0065712_10112167
669 Ga0065715_10142692
670 Ga0065707_10082491
671 Ga0070676_10507989
672 Ga0070676_10705495
673 Ga0070683_100280502
674 Ga0070690_100000597
675 Ga0070690_100009484
676 Ga0070670_100000002
677 Ga0070670_100019019
678 Ga0070670_100163357
679 Ga0070677_10195850
680 Ga0068869_100013018
681 Ga0068869_100361924
682 Ga0070666_10032611
683 Ga0070666_10038961
684 Ga0070666_10239596
685 Ga0070680_100042717
686 Ga0070682_100297078
687 Ga0068868_100015034
688 Ga0068868_100126686
689 Ga0068868_100389324
690 Ga0068868_100391493
691 Ga0068868_100922640
692 Ga0070689_100000518
693 Ga0070689_100317707
694 Ga0070691_10043585
695 Ga0070687_100002852
696 Ga0070687_100069132
697 Ga0070661_100020262
698 Ga0070661_100056970
699 Ga0070692_10065825
700 Ga0070692_10237589
701 Ga0070668_100082701
702 Ga0070668_100241662
703 Ga0070668_100254603
704 Ga0070669_100032093
705 Ga0070669_100119731
706 Ga0070675_100001970
707 Ga0070675_100404776
708 Ga0070675_100965078
709 Ga0070671_100000047
710 Ga0070671_100014437
711 Ga0070671_100039029
712 Ga0070671_100107665
713 Ga0070674_100239842
714 Ga0070674_100644461
715 Ga0070673_100119118
716 Ga0070673_100186781
717 Ga0070673_100195041
718 Ga0070673_100220571
719 Ga0070673_100636546
720 Ga0070688_100004687
721 Ga0070688_100180154
722 Ga0070688_100331420
723 Ga0070688_101223845
724 Ga0070688_101344745
725 Ga0070659_100599302
726 Ga0070667_100000018
727 Ga0070667_100007686
728 Ga0070667_100048838
729 Ga0070667_100119091
730 Ga0070667_101278369
731 Ga0070709_10221388
732 Ga0070701_10007937
733 Ga0070701_10977165
734 Ga0070711_100154078
735 Ga0070711_100643124
736 Ga0070705_100009782
737 Ga0070705_100249587
738 Ga0070700_100015633
739 Ga0070694_100086431
740 Ga0070694_100125446
741 Ga0070663_100321379
742 Ga0070678_100030204
743 Ga0070678_100884358
744 Ga0070662_100005447
745 Ga0070662_100016565
746 Ga0070662_101531294
747 Ga0068867_100013369
748 Ga0068867_100647773
749 Ga0070685_10000001
750 Ga0070685_10018527
751 Ga0070706_101239280
752 Ga0070707_101552062
753 Ga0070679_100042764
754 Ga0070679_100108973
755 Ga0070684_100000535
756 Ga0070684_100652627
757 Ga0068853_100138638
758 Ga0068853_100834068
759 Ga0068853_101199436
760 Ga0070672_100492978
761 Ga0070672_101201418
762 Ga0070686_100212679
763 Ga0070686_100758131
764 Ga0070695_100073526
765 Ga0070696_100269170
766 Ga0070693_100064407
767 Ga0070665_100005419
768 Ga0070665_100021847
769 Ga0070665_100528428
770 Ga0070665_100936723
771 Ga0070665_101891202
772 Ga0070704_100024741
773 Ga0068855_100067596
774 Ga0068855_100288400
775 Ga0070664_100027599
776 Ga0070664_100643985
777 Ga0070664_101471625
778 Ga0068857_100148619
779 Ga0068857_100352691
780 Ga0068854_100118402
781 Ga0068856_100289865
782 Ga0068856_100942549
783 Ga0070702_100000268
784 Ga0070702_100630853
785 Ga0068852_100010999
786 Ga0068852_100448567
787 Ga0068859_100000952
788 Ga0068859_100027832
789 Ga0068859_100115994
790 Ga0068859_100885738
791 Ga0068859_101194833
792 Ga0068859_101556841
793 Ga0068864_100000003
794 Ga0068864_100003938
795 Ga0068864_100022552
796 Ga0068864_100040965
797 Ga0068864_100566595
798 Ga0068864_100579602
799 Ga0068866_10068923
800 Ga0068861_100005659
801 Ga0068861_100018199
802 Ga0068861_100027981
803 Ga0068861_101461206
804 Ga0068851_10071061
805 Ga0068851_10172241
806 Ga0068870_10049552
807 Ga0068863_100000641
808 Ga0068863_100005347
809 Ga0068858_100064858
810 Ga0068858_100077592
811 Ga0068858_100886900
812 Ga0068858_101006256
813 Ga0068860_100005872
814 Ga0068860_100023700
815 Ga0068860_100312258
816 Ga0068862_100005690
817 Ga0068862_100020287
818 Ga0068862_100140729
819 Ga0068862_100224604
820 Ga0068862_100231153
821 Ga0068862_100647708
822 Ga0068862_101847834
823 Ga0081540_1092352
824 Ga0081539_10072118
825 Ga0070715_10358439
826 Ga0075427_10014037
827 Ga0097621_100234200
828 Ga0097621_100242224
829 Ga0097621_100378216
830 Ga0097621_100414537
831 Ga0068871_100020731
832 Ga0068871_100188553
833 Ga0068871_100418238
834 Ga0075428_100001223
835 Ga0075428_100010077
836 Ga0075428_100159118
837 Ga0075428_100411312
838 Ga0075428_100667153
839 Ga0075430_100021039
840 Ga0075430_100053897
841 Ga0075430_100091638
842 Ga0075430_100109687
843 Ga0075430_100915157
844 Ga0075431_100000314
845 Ga0075431_100022489
846 Ga0075431_100712723
847 Ga0075433_10816042
848 Ga0075434_100097922
849 Ga0075429_100001058
850 Ga0075429_100029466
851 Ga0075429_100143821
852 Ga0075429_100213368
853 Ga0068865_100025177
854 Ga0068865_100037991
855 Ga0068865_100198951
856 Ga0068865_101517869
857 Ga0097620_100000952
858 Ga0097620_100027832
859 Ga0097620_100115993
860 Ga0097620_100885648
861 Ga0097620_101194861
862 Ga0097620_101556847
863 Ga0075435_100827879
864 Ga0105251_10219931
865 Ga0105244_10337792
866 Ga0105250_10130576
867 Ga0105240_10474836
868 Ga0105240_10582764
869 Ga0105240_10717443
870 Ga0111539_10004339
871 Ga0111539_10095989
872 Ga0111539_10128454
873 Ga0111539_10234120
874 Ga0111539_10536350
875 Ga0105245_10492397
876 Ga0105247_10138182
877 Ga0105247_10310603
878 Ga0114129_10002637
879 Ga0114129_10020530
880 Ga0114129_12234499
881 Ga0105243_10051851
882 Ga0105243_10454617
883 Ga0105243_10956876
884 Ga0105243_12944560
885 Ga0105241_10973912
886 Ga0105241_12659139
887 Ga0105242_10666165
888 Ga0105242_11310572
889 Ga0105248_10000895
890 Ga0105248_10029194
891 Ga0105248_10259906
892 Ga0105248_10584876
893 Ga0105238_10011157
894 Ga0105249_10026253
895 Ga0105249_10035929
896 Ga0105249_10062855
897 Ga0105249_10095217
898 Ga0105249_12803892
899 Ga0105239_10021948
900 Ga0105239_10390054
901 Ga0105246_10021140
902 Ga0105246_10442011
903 Ga0157370_11566355
904 Ga0157374_10318916
905 Ga0157374_10821964
906 Ga0157378_10141432
907 Ga0157378_10391602
908 Ga0163162_10018159
909 Ga0163162_10241916
910 Ga0163162_10468385
911 Ga0163162_11894848
912 Ga0157372_11474344
913 Ga0157375_10009999
914 Ga0157375_10117022
915 Ga0157375_10195131
916 Ga0157375_10481244
917 Ga0163163_10000145
918 Ga0163163_10008857
919 Ga0163163_10077638
920 Ga0163163_11448997
921 Ga0157380_10002636
922 Ga0157380_10155430
923 Ga0157377_10001141
924 Ga0157377_10755437
925 Ga0157379_10081503
926 Ga0157379_10242439
927 Ga0157379_10301914
928 Ga0157379_10800097
929 Ga0157376_10043575
930 Ga0157376_10577352
931 Ga0157376_11226708
932 Ga0163161_10717350
933 Ga0207656_10007886
934 Ga0207696_1080087
935 Ga0207692_10147957
936 Ga0207642_10071064
937 Ga0207710_10371678
938 Ga0207688_10054301
939 Ga0207680_10221518
940 Ga0207680_11026825
941 Ga0207685_10145385
942 Ga0207699_10039464
943 Ga0207699_10142826
944 Ga0207645_10063871
945 Ga0207643_10004076
946 Ga0207707_10313242
947 Ga0207695_10449627
948 Ga0207663_10119812
949 Ga0207663_10256785
950 Ga0207662_10007994
951 Ga0207662_10370677
952 Ga0207649_10010544
953 Ga0207649_10116540
954 Ga0207649_10388465
955 Ga0207652_10041743
956 Ga0207652_10116260
957 Ga0207681_10013128
958 Ga0207681_10027213
959 Ga0207681_10107045
960 Ga0207650_10000003
961 Ga0207650_10235475
962 Ga0207650_10279806
963 Ga0207650_10328827
964 Ga0207650_10796042
965 Ga0207659_10005231
966 Ga0207659_10583433
967 Ga0207644_10000055
968 Ga0207644_10048560
969 Ga0207644_10163006
970 Ga0207690_10383444
971 Ga0207706_10007795
972 Ga0207706_10142756
973 Ga0207686_10352590
974 Ga0207709_10055029
975 Ga0207709_10058587
976 Ga0207709_10341457
977 Ga0207670_10002080
978 Ga0207670_10267979
979 Ga0207669_11864365
980 Ga0207704_10023221
981 Ga0207704_10036947
982 Ga0207691_10050917
983 Ga0207691_10562988
984 Ga0207691_11013998
985 Ga0207711_10000290
986 Ga0207711_10000950
987 Ga0207711_10002129
988 Ga0207711_10014445
989 Ga0207711_10310212
990 Ga0207689_10004952
991 Ga0207689_10142267
992 Ga0207689_10262773
993 Ga0207689_10570204
994 Ga0207661_10354216
995 Ga0207661_10455129
996 Ga0207679_10047108
997 Ga0207679_10186280
998 Ga0207651_10088381
999 Ga0207712_10129633
1000 Ga0207712_10140723
1001 Ga0207712_10908117
1002 Ga0207668_10154596
1003 Ga0207668_11259353
1004 Ga0207640_10071487
1005 Ga0207658_10000004
1006 Ga0207658_10058671
1007 Ga0207658_10236576
1008 Ga0207677_10222641
1009 Ga0207677_10847251
1010 Ga0207703_10012006
1011 Ga0207703_10354145
1012 Ga0207703_11471783
1013 Ga0207639_10693690
1014 Ga0207678_10377747
1015 Ga0207708_10045503
1016 Ga0207708_10059899
1017 Ga0207702_11338212
1018 Ga0207641_10021505
1019 Ga0207641_10053015
1020 Ga0207648_10020838
1021 Ga0207648_10312751
1022 Ga0207648_11709076
1023 Ga0207676_10000003
1024 Ga0207676_10169107
1025 Ga0207676_10420276
1026 Ga0207676_10597154
1027 Ga0207674_10127441
1028 Ga0207674_10207753
1029 Ga0207674_10207796
1030 Ga0207675_100002194
1031 Ga0207675_100008919
1032 Ga0207675_100015629
1033 Ga0207675_100027489
1034 Ga0207683_10073005
1035 Ga0207683_10593146
1036 Ga0207698_10875235
1037 Ga0209966_1014188
1038 Ga0207428_10010667
1039 Ga0207428_10085436
1040 Ga0207428_10147854
1041 Ga0207428_10356758
1042 Ga0207428_10905376
1043 Ga0268266_10024069
1044 Ga0268266_10028046
1045 Ga0268266_10152774
1046 Ga0268266_11334638
1047 Ga0268265_10000690
1048 Ga0268265_10002286
1049 Ga0268265_10021382
1050 Ga0268265_10031997
1051 Ga0268265_10491121
1052 Ga0268264_10000009
1053 Ga0268264_10345738
1054 Ga0265327_10224169
1055 Ga0307509_10084894
1056 Ga0307408_100031864
1057 Ga0307408_100076520
1058 Ga0307408_100259509
1059 Ga0307408_100287165
1060 Ga0307408_102211355
1061 Ga0316579_10066156
1062 Ga0316576_10497214
1063 Ga0316578_10001917
1064 Ga0316578_10395560
1065 Ga0307405_10070343
1066 Ga0307405_10601722
1067 Ga0307405_10884768
1068 Ga0316577_10000215
1069 Ga0307413_10197808
1070 Ga0307413_10666068
1071 Ga0307413_10896770
1072 Ga0307413_11584633
1073 Ga0307413_11926363
1074 Ga0307410_10384977
1075 Ga0307410_11133626
1076 Ga0307406_10155682
1077 Ga0307407_10346869
1078 Ga0307407_10940077
1079 Ga0307412_10092216
1080 Ga0307416_100018233
1081 Ga0307416_100336935
1082 Ga0307416_100476598
1083 Ga0307416_100818495
1084 Ga0307416_101122051
1085 Ga0307414_10578663
1086 Ga0307411_10040840
1087 Ga0307411_10098797
1088 Ga0307411_10153622
1089 Ga0307411_10208152
1090 Ga0307411_10684914
1091 Ga0307411_11533245
1092 Ga0307411_12163599
1093 Ga0307411_12242697
1094 Ga0307415_100117328
1095 Ga0307415_100227292
1096 Ga0316580_10020774
1097 Ga0316593_10009487
1098 Ga0316593_10016418
1099 Ga0316593_10021013
1100 Ga0316593_10023470
1101 Ga0316593_10171917
1102 Ga0316592_1000659
1103 Ga0316592_1042989
1104 Ga0316586_1009831
1105 Ga0316586_1053387
1106 Ga0316588_1171177
1107 Ga0316596_1004710
1108 Ga0316596_1092278
1109 Ga0373958_0050983
1110 Ga0373926_0034056
1111 Ga0373928_0057580
1112 Ga0373940_0261117
1113 Ga0373949_0073598
1114 Ga0373941_0236240
1115 Ga0373954_0566405
1116 Ga0373960_0301173
1117 Ga0373955_0001713
1118 Ga0373955_0137277
1119 Ga0373962_0141774
1120 Ga0316574_0185743
1121 Ga0316574_0529958
1122 Ga0373931_0047076
1123 Ga0373931_0223442
1124 Ga0373933_0075035
1125 Ga0373933_0228351
1126 Ga0373937_0002788
1127 Ga0373937_0046581
1128 Ga0373937_0047279
1129 Ga0316582_0552575
1130 Ga0316582_1108907
1131 Ga0316584_0004262
1132 Ga0439436_0174854
1133 Ga0451798_0963655
1134 Ga0451849_0339504
1135 Ga0451851_0192039
1136 Ga0451855_1962699
1137 Ga0451853_3750232
1138 Ga0439442_052627
1139 Ga0439448_0009174
1140 Ga0439449_0136668
1141 Ga0439450_040587
1142 Ga0439456_048320
1143 Ga0439457_033250
1144 Ga0450914_006876
1145 Ga0450895_023047
1146 Ga0450906_033496
1147 Ga0439460_0170023
1148 Ga0451577_0784356
1149 Ga0453684_0003750
1150 Ga0453684_0046914
1151 Ga0453684_0150809
1152 Ga0451576_0027473
1153 Ga0495617_064644
1154 Ga0495603_0065999
1155 Ga0495629_0073764
1156 Ga0495638_0006331
1157 Ga0495650_0005029
1158 Ga0495639_0424442
1159 Ga0495639_0540094
1160 Ga0495630_0327841
1161 Ga0495630_0575491
1162 Ga0495632_0086419
1163 Ga0495643_0347276
1164 Ga0495586_0452775
1165 Ga0495668_0157531
1166 Ga0495668_0161905
1167 Ga0495634_0110058
1168 Ga0495611_0172568
1169 Ga0495625_0160159
1170 Ga0495625_0330748
1171 Ga0495625_0629437
1172 Ga0495647_0031594
1173 Ga0495658_0207612
1174 Ga0495613_0233384
1175 Ga0495624_0368423
1176 Ga0495649_0217154
1177 Ga0495600_0257495
1178 Ga0495581_0426933
1179 Ga0495674_0175217
1180 Ga0495672_0033225
1181 Ga0495686_0069021
1182 Ga0496100_0103837
1183 Ga0496104_0714275
1184 Ga0496105_0532822
1185 Ga0496106_0204182
1186 Ga0496108_0023888
1187 Ga0496109_0071223
1188 Ga0496109_0786647
1189 Ga0496109_1086634
1190 Ga0496110_0018563
1191 Ga0496110_0662941
1192 Ga0496110_1070439
1193 Ga0496111_0221332
1194 Ga0496111_0451919
1195 Ga0496112_0190249
1196 Ga0496112_0213946
1197 Ga0496113_0027445
1198 Ga0496114_0007497
1199 Ga0496114_0444745
1200 Ga0496115_0037670
1201 Ga0496117_0335834
1202 Ga0496118_0448854
1203 Ga0496121_0083935
1204 Ga0496125_0042571
1205 Ga0496125_0714717
1206 Ga0501299_033175
1207 Ga0501299_207758
1208 Ga0501300_004898
1209 Ga0501031_0518286
1210 Ga0501032_0238690
1211 Ga0501033_0172546
1212 Ga0501033_1194097
1213 Ga0501034_0384616
1214 Ga0501036_0015397
1215 Ga0501036_0132423
1216 Ga0501037_0029540
1217 Ga0501037_0086081
1218 Ga0501038_0031913
1219 Ga0501038_0171915
1220 Ga0501039_0004204
1221 Ga0501039_0021803
1222 Ga0501040_0002374
1223 Ga0501040_0011218
1224 Ga0501040_0222819
1225 Ga0501040_0560494
1226 Ga0501040_1207733
1227 Ga0501041_0026667
1228 Ga0501042_0014631
1229 Ga0501042_0042248
1230 Ga0501042_0205215
1231 Ga0501043_0297456
1232 Ga0501043_1033999
1233 Ga0501046_0004224
1234 Ga0501046_0049631
1235 Ga0501046_0252261
1236 Ga0501047_0542816
1237 Ga0501048_0035128
1238 Ga0501048_0176067
1239 Ga0501048_0328933
1240 Ga0501048_1377580
1241 Ga0501068_0173364
1242 Ga0501070_0171144
1243 Ga0501071_0011344
1244 Ga0501072_0010386
1245 Ga0501072_1121122
1246 Ga0501073_0111272
1247 Ga0501074_0017326
1248 Ga0501074_0647348
1249 Ga0501075_0003347
1250 Ga0501075_0117743
1251 Ga0501076_0003033
1252 Ga0501076_0187244
1253 Ga0501076_0847427
1254 Ga0501076_1246148
1255 Ga0501077_0009787
1256 Ga0501233_067465
1257 Ga0501251_102633
1258 Ga0501259_026915
1259 Ga0501079_0000950
1260 Ga0501079_0060748
1261 Ga0501079_0782634
1262 Ga0501080_0006723
1263 Ga0501080_0012364
1264 Ga0501080_0120691
1265 Ga0501080_0250308
1266 Ga0501080_0483860
1267 Ga0501080_0749260
1268 Ga0501081_0006652
1269 Ga0501081_1063774
1270 Ga0501035_0041060
1271 Ga0501035_0043977
1272 Ga0501044_0038561
1273 Ga0501044_0537089
1274 Ga0501045_0009300
1275 Ga0501045_0079378
1276 Ga0501045_0774641
1277 nmdc:mga05p37_1145_c1
1278 nmdc:mga05p37_20580_c1
1279 nmdc:mga09592_2223_c1
1280 nmdc:mga09592_245436_c1
1281 nmdc:mga09592_25957_c1
1282 nmdc:mga09592_92218_c1
1283 nmdc:mga0qj67_2601_c1
1284 nmdc:mga0qj67_304458_c1
1285 nmdc:mga0qj67_4072_c1
1286 nmdc:mga0qj67_568426_c1
1287 nmdc:mga0qj67_73528_c1
1288 nmdc:mga06r32_1418_c1
1289 nmdc:mga06r32_19790_c1
1290 nmdc:mga06r32_358_c1
1291 nmdc:mga06r32_790897_c1
1292 nmdc:mga06r32_798000_c1
1293 nmdc:mga08y16_1018018_c1
1294 nmdc:mga08y16_115543_c1
1295 nmdc:mga08y16_246847_c1
1296 nmdc:mga08y16_254778_c1
1297 nmdc:mga08y16_290440_c1
1298 nmdc:mga08y16_4348_c1
1299 nmdc:mga08y16_60110_c1
1300 nmdc:mga0n895_509316_c1
1301 nmdc:mga0n895_947536_c1
1302 nmdc:mga0rr50_154426_c1
1303 nmdc:mga0rr50_798044_c1
1304 nmdc:mga0a205_309777_c1
1305 Ga0495601_0105917
1306 Ga0500610_0059367
1307 Ga0495619_0263607
1308 Ga0500644_0119080
1309 Ga0500644_0536114
1310 Ga0500583_0301119
1311 Ga0500641_0011255
1312 Ga0500556_0263595
1313 Ga0500658_0242536
1314 Ga0500568_0194160
1315 Ga0500589_166221
1316 Ga0500604_0157532
1317 Ga0500616_0168368
1318 Ga0500622_0002111
1319 Ga0500622_0004934
1320 Ga0501084_0015338
1321 Ga0501084_0016605
1322 Ga0501084_0533713
1323 Ga0501084_0576607
1324 Ga0501084_1398487
1325 Ga0590071_205065
1326 Ga0501082_0020641
1327 Ga0501082_0267900
1328 Ga0501082_0945500
1329 Ga0530510_0015494
1330 Ga0530510_0251942
1331 Ga0530510_0816543
1332 2894514174

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

24

103

0.99

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

107

152

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ako-assembly1.cif.gz_B structure of espb-espk complex: the non-identical twin of the pe-ppe-espg secretion mechanism. 0.9691 103 145
7nkp-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo state 2 0.9517 33 58
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9484 21 92
1mft-assembly1.cif.gz_B crystal structure of four-helix bundle model 0.9357 103 144
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9284 16 97
ID Description Score Start End Superfamily
af_P0A6E6_91_134_1.20.5.440 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9997 102 144 1.20.5.440
2v7qH02 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9877 102 142 1.20.5.440
4yxwH02 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.975 102 142 1.20.5.440
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.974 15 100 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9723 14 101 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A7C3T648-F1-model_v4 ATP synthase F1 subunit epsilon 0.9865 13 96 GO:0005886
GO:0045261
GO:0046933
AF-A0A1M3L946-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9847 13 97 GO:0005886
GO:0045261
GO:0046933
AF-Q8XU77-F1-model_v4 ATP synthase epsilon chain 1 (ATP synthase F1 sector epsilon subunit 1) (F-ATPase epsilon subunit 1) 0.9838 13 149 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A534SUB7-F1-model_v4 ATP synthase F1 subunit epsilon 0.9833 16 97 GO:0012505
GO:0045261
GO:0046933
AF-A0A2W6VI87-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9827 15 97 GO:0005886
GO:0045261
GO:0046933

Map