F473768

General Info

Members Datasets Scaffolds Average Seq Length
666 284 1333 221

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100210492|Ga0070713_1002104922
Length 260
Sequence MHFGIVNVPPASEYTGCGRKRKSRCPLYLRMVRINRSIQPAQIKLLIFDLDGTLIDSRKDLVNSVNAMLRHLHRPELPPEVVASYVGDGAPMLVRRALGDPDNQRVVIEALEFFLAYYRAHKLDNTHVYPGTAEALEVLHRAENGGGRRMAVLSNKPVNPSRQIVTALGLGHFFDHIYGGNSFPTKKPDPLGAQTLMQEAGATPDSTLIIGDSSVDVLTGRNAGTWTCGVTYGFAPQTLQTPTPDLLVDSLAELAEALRG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 3
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 15.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100210492 3300005436 Bacteria 1760
2 rootL2_10114650 3300003322 Bacteria 2724
3 rootH1_10091388 3300003323 Bacteria 1580
4 rootH1_10098294 3300003323 Bacteria 3688
5 rootH1_10116147 3300003316 Unclassified 3372
6 rootH1_10116147 3300003323 Bacteria 2501
7 Ga0065712_10086649 3300005290 Unclassified 2623
8 Ga0065712_10100720 3300005290 Unclassified 2025
9 Ga0065715_10010814 3300005293 Bacteria 2349
10 Ga0065715_10055518 3300005293 Bacteria 990
11 Ga0065707_10014965 3300005295 Bacteria 2823
12 Ga0065707_10096888 3300005295 Bacteria 3224
13 Ga0065707_10157319 3300005295 Bacteria 1578
14 Ga0065707_10214148 3300005295 Unclassified 1252
15 Ga0070658_10395448 3300005327 Bacteria 1187
16 Ga0070676_10026734 3300005328 Bacteria 3267
17 Ga0070676_10159889 3300005328 Bacteria 1449
18 Ga0070676_10345372 3300005328 Bacteria 1022
19 Ga0070683_100080885 3300005329 Unclassified 3041
20 Ga0070670_100045582 3300005331 Bacteria 3770
21 Ga0070670_100118621 3300005331 Bacteria 2282
22 Ga0070670_100296554 3300005331 Unclassified 1413
23 Ga0070670_100321793 3300005331 Bacteria 1355
24 Ga0070670_100387668 3300005331 Bacteria 1232
25 Ga0070670_100510543 3300005331 Unclassified 1070
26 Ga0070670_100811539 3300005331 Bacteria 845
27 Ga0070677_10048586 3300005333 Bacteria 1706
28 Ga0070666_10064459 3300005335 Bacteria 2485
29 Ga0068868_100090280 3300005338 Unclassified 2467
30 Ga0070660_100010292 3300005339 Bacteria 6603
31 Ga0070660_100150319 3300005339 Bacteria 1872
32 Ga0070660_100583778 3300005339 Unclassified 934
33 Ga0070689_100040687 3300005340 Unclassified 3564
34 Ga0070689_100105292 3300005340 Bacteria 2237
35 Ga0070689_100111034 3300005340 Bacteria 2181
36 Ga0070689_100321035 3300005340 Bacteria 1293
37 Ga0070687_100089768 3300005343 Bacteria 1697
38 Ga0070661_100028766 3300005344 Bacteria 4010
39 Ga0070661_100158390 3300005344 Bacteria 1714
40 Ga0070692_10022272 3300005345 Unclassified 3093
41 Ga0070668_100243592 3300005347 Bacteria 1490
42 Ga0070669_100005059 3300005353 Bacteria 9532
43 Ga0070669_100065135 3300005353 Bacteria 2685
44 Ga0070669_100096980 3300005353 Bacteria 2219
45 Ga0070669_100143185 3300005353 Bacteria 1845
46 Ga0070669_100163693 3300005353 Bacteria 1730
47 Ga0070669_100538657 3300005353 Unclassified 972
48 Ga0070675_100000882 3300005354 Bacteria 21350
49 Ga0070675_100000989 3300005354 Bacteria 20344
50 Ga0070675_100006800 3300005354 Bacteria 8782
51 Ga0070675_100015303 3300005354 Bacteria 6062
52 Ga0070675_100108800 3300005354 Unclassified 2341
53 Ga0070675_100137622 3300005354 Unclassified 2085
54 Ga0070675_100147719 3300005354 Bacteria 2014
55 Ga0070675_100241157 3300005354 Bacteria 1580
56 Ga0070675_100280520 3300005354 Bacteria 1464
57 Ga0070675_100352735 3300005354 Bacteria 1305
58 Ga0070671_100011684 3300005355 Bacteria 7062
59 Ga0070671_100070932 3300005355 Bacteria 2907
60 Ga0070671_100235437 3300005355 Unclassified 1554
61 Ga0070671_100396453 3300005355 Bacteria 1180
62 Ga0070674_100037237 3300005356 Bacteria 3271
63 Ga0070674_100107561 3300005356 Bacteria 2042
64 Ga0070674_100167564 3300005356 Bacteria 1672
65 Ga0070674_100358356 3300005356 Bacteria 1180
66 Ga0070674_100667561 3300005356 Unclassified 885
67 Ga0070673_100010372 3300005364 Bacteria 6306
68 Ga0070673_100059217 3300005364 Bacteria 3031
69 Ga0070673_100109071 3300005364 Bacteria 2293
70 Ga0070673_100151366 3300005364 Bacteria 1965
71 Ga0070673_100160898 3300005364 Bacteria 1909
72 Ga0070673_100335272 3300005364 Bacteria 1339
73 Ga0070673_100362331 3300005364 Bacteria 1289
74 Ga0070688_100012605 3300005365 Unclassified 4740
75 Ga0070688_100020732 3300005365 Bacteria 3827
76 Ga0070688_100284054 3300005365 Bacteria 1190
77 Ga0070659_100020833 3300005366 Bacteria 4986
78 Ga0070659_100418319 3300005366 Bacteria 1133
79 Ga0070659_100430121 3300005366 Bacteria 1117
80 Ga0070667_100015885 3300005367 Bacteria 6229
81 Ga0070667_100260810 3300005367 Bacteria 1552
82 Ga0070709_10143318 3300005434 Unclassified 1644
83 Ga0070709_10303788 3300005434 Bacteria 1166
84 Ga0070710_10167958 3300005437 Bacteria 1365
85 Ga0070701_10089814 3300005438 Unclassified 1681
86 Ga0070701_10253086 3300005438 Unclassified 1064
87 Ga0070701_10279172 3300005438 Bacteria 1019
88 Ga0070701_10364712 3300005438 Bacteria 906
89 Ga0070711_100162333 3300005439 Bacteria 1695
90 Ga0070705_100111171 3300005440 Bacteria 1751
91 Ga0070705_100141250 3300005440 Unclassified 1585
92 Ga0070705_100209006 3300005440 Unclassified 1344
93 Ga0070700_100112623 3300005441 Bacteria 1812
94 Ga0070700_100141502 3300005441 Bacteria 1635
95 Ga0070700_100292290 3300005441 Bacteria 1186
96 Ga0070694_100500336 3300005444 Bacteria 967
97 Ga0070708_101009278 3300005445 Bacteria 780
98 Ga0070663_100360664 3300005455 Bacteria 1179
99 Ga0070663_100371131 3300005455 Bacteria 1163
100 Ga0070678_100017126 3300005456 Bacteria 4656
101 Ga0070678_100065944 3300005456 Bacteria 2690
102 Ga0070678_100084742 3300005456 Unclassified 2413
103 Ga0070678_100230748 3300005456 Unclassified 1543
104 Ga0070678_100313017 3300005456 Bacteria 1338
105 Ga0070678_100377797 3300005456 Bacteria 1225
106 Ga0070662_100007587 3300005457 Bacteria 7040
107 Ga0070681_10051104 3300005458 Bacteria 4123
108 Ga0070681_10166558 3300005458 Bacteria 2126
109 Ga0068867_100060208 3300005459 Bacteria 2816
110 Ga0070706_100109825 3300005467 Bacteria 2566
111 Ga0070706_100184053 3300005467 Bacteria 1951
112 Ga0070707_100100944 3300005468 Bacteria 2796
113 Ga0070707_100271142 3300005468 Bacteria 1650
114 Ga0070707_100978695 3300005468 Bacteria 811
115 Ga0070698_101207174 3300005471 Unclassified 706
116 Ga0070699_100002960 3300005518 Bacteria 15094
117 Ga0070699_100333052 3300005518 Bacteria 1366
118 Ga0070699_100425073 3300005518 Bacteria 1203
119 Ga0070699_100895704 3300005518 Unclassified 813
120 Ga0070679_100100237 3300005530 Bacteria 2883
121 Ga0070679_100340966 3300005530 Bacteria 1447
122 Ga0070684_100116966 3300005535 Bacteria 2395
123 Ga0070697_100670279 3300005536 Unclassified 914
124 Ga0068853_100005850 3300005539 Bacteria 9688
125 Ga0070672_100040356 3300005543 Bacteria 3580
126 Ga0070672_100054374 3300005543 Bacteria 3133
127 Ga0070672_100059016 3300005543 Bacteria 3018
128 Ga0070672_100063089 3300005543 Bacteria 2926
129 Ga0070672_100092239 3300005543 Bacteria 2445
130 Ga0070672_100112792 3300005543 Bacteria 2218
131 Ga0070672_100486699 3300005543 Bacteria 1066
132 Ga0070672_100564539 3300005543 Bacteria 989
133 Ga0070686_100019056 3300005544 Bacteria 4037
134 Ga0070686_100024747 3300005544 Bacteria 3601
135 Ga0070686_100067435 3300005544 Bacteria 2331
136 Ga0070695_100061285 3300005545 Bacteria 2441
137 Ga0070665_100046683 3300005548 Bacteria 4349
138 Ga0070665_100087270 3300005548 Bacteria 3125
139 Ga0070704_100106327 3300005549 Bacteria 2126
140 Ga0070704_100317633 3300005549 Unclassified 1304
141 Ga0068855_100000496 3300005563 Bacteria 48652
142 Ga0068855_100008328 3300005563 Bacteria 12534
143 Ga0068855_100023844 3300005563 Bacteria 7330
144 Ga0068855_100420266 3300005563 Bacteria 1462
145 Ga0070664_100017473 3300005564 Bacteria 5890
146 Ga0070664_100028692 3300005564 Bacteria 4632
147 Ga0070664_100041169 3300005564 Bacteria 3897
148 Ga0070664_100144607 3300005564 Bacteria 2096
149 Ga0070664_100199608 3300005564 Bacteria 1785
150 Ga0070664_100752350 3300005564 Archaea 910
151 Ga0068857_100115070 3300005577 Unclassified 2419
152 Ga0068857_100252800 3300005577 Bacteria 1616
153 Ga0068857_100434508 3300005577 Bacteria 1225
154 Ga0068856_100960331 3300005614 Unclassified 873
155 Ga0068852_100397077 3300005616 Bacteria 1356
156 Ga0068859_100010995 3300005617 Bacteria 9108
157 Ga0068859_100053340 3300005617 Bacteria 4067
158 Ga0068859_100286350 3300005617 Bacteria 1740
159 Ga0068859_100571744 3300005617 Bacteria 1224
160 Ga0068864_100296514 3300005618 Bacteria 1513
161 Ga0068864_100311545 3300005618 Bacteria 1476
162 Ga0068864_100485966 3300005618 Bacteria 1186
163 Ga0068866_10374206 3300005718 Bacteria 912
164 Ga0068866_10462146 3300005718 Bacteria 832
165 Ga0068861_100038948 3300005719 Bacteria 3545
166 Ga0068861_100079486 3300005719 Bacteria 2564
167 Ga0068861_100120088 3300005719 Bacteria 2119
168 Ga0068861_100394350 3300005719 Bacteria 1227
169 Ga0068861_100689776 3300005719 Bacteria 948
170 Ga0068851_10006981 3300005834 Bacteria 5178
171 Ga0068851_10033098 3300005834 Bacteria 2575
172 Ga0068851_10106495 3300005834 Bacteria 1493
173 Ga0068870_10034733 3300005840 Bacteria 2582
174 Ga0068863_100129691 3300005841 Bacteria 2407
175 Ga0068863_100143067 3300005841 Bacteria 2287
176 Ga0068863_100167839 3300005841 Bacteria 2105
177 Ga0068863_100327282 3300005841 Bacteria 1489
178 Ga0068863_100330683 3300005841 Bacteria 1481
179 Ga0068858_100002279 3300005842 Bacteria 19420
180 Ga0068858_100046942 3300005842 Bacteria 4004
181 Ga0068858_100050429 3300005842 Bacteria 3852
182 Ga0068858_100084288 3300005842 Bacteria 2956
183 Ga0068858_100171988 3300005842 Bacteria 2043
184 Ga0068858_100544669 3300005842 Unclassified 1123
185 Ga0068860_100123829 3300005843 Bacteria 2478
186 Ga0068860_100318624 3300005843 Bacteria 1526
187 Ga0068860_100425154 3300005843 Unclassified 1317
188 Ga0068860_100590494 3300005843 Unclassified 1115
189 Ga0068862_100000482 3300005844 Bacteria 42588
190 Ga0068862_100316609 3300005844 Bacteria 1439
191 Ga0068862_100383933 3300005844 Bacteria 1311
192 Ga0068862_100466621 3300005844 Unclassified 1193
193 Ga0081455_10205615 3300005937 Bacteria 1471
194 Ga0081538_10089024 3300005981 Bacteria 1604
195 Ga0081539_10024418 3300005985 Unclassified 3921
196 Ga0070717_10204655 3300006028 Bacteria 1730
197 Ga0075368_10003257 3300006042 Bacteria 5406
198 Ga0075364_10015725 3300006051 Bacteria 4696
199 Ga0070715_10143267 3300006163 Bacteria 1163
200 Ga0070716_100305115 3300006173 Bacteria 1109
201 Ga0070716_100352088 3300006173 Bacteria 1043
202 Ga0070712_100514478 3300006175 Unclassified 1005
203 Ga0075367_10237243 3300006178 Bacteria 1142
204 Ga0097621_100025718 3300006237 Bacteria 4607
205 Ga0097621_100026008 3300006237 Bacteria 4586
206 Ga0097621_100506624 3300006237 Bacteria 1094
207 Ga0075370_10004905 3300006353 Bacteria 6570
208 Ga0068871_100023692 3300006358 Bacteria 4752
209 Ga0068871_100228389 3300006358 Bacteria 1615
210 Ga0075428_100003208 3300006844 Bacteria 17888
211 Ga0075428_100082064 3300006844 Bacteria 3518
212 Ga0075428_100256851 3300006844 Unclassified 1882
213 Ga0075428_100282047 3300006844 Bacteria 1787
214 Ga0075430_100017089 3300006846 Bacteria 6180
215 Ga0075430_100093433 3300006846 Unclassified 2515
216 Ga0075430_100295674 3300006846 Bacteria 1339
217 Ga0075430_100302538 3300006846 Bacteria 1323
218 Ga0075431_100003079 3300006847 Bacteria 16157
219 Ga0075431_100008543 3300006847 Bacteria 10256
220 Ga0075431_100081851 3300006847 Bacteria 3333
221 Ga0075431_100120699 3300006847 Bacteria 2705
222 Ga0075433_10430981 3300006852 Bacteria 1163
223 Ga0075433_10586585 3300006852 Bacteria 979
224 Ga0075434_100062611 3300006871 Bacteria 3703
225 Ga0075434_100122551 3300006871 Bacteria 2616
226 Ga0075434_100244329 3300006871 Bacteria 1815
227 Ga0075434_100254223 3300006871 Bacteria 1776
228 Ga0075434_100503402 3300006871 Unclassified 1232
229 Ga0075429_100046967 3300006880 Unclassified 3757
230 Ga0075429_100076509 3300006880 Bacteria 2915
231 Ga0075429_100097682 3300006880 Bacteria 2562
232 Ga0075429_100704618 3300006880 Bacteria 884
233 Ga0068865_100483875 3300006881 Bacteria 1029
234 Ga0068865_100665913 3300006881 Bacteria 886
235 Ga0075436_100236607 3300006914 Bacteria 1298
236 Ga0075436_100290595 3300006914 Unclassified 1170
237 Ga0097620_100010995 3300006931 Bacteria 9108
238 Ga0097620_100053340 3300006931 Bacteria 4067
239 Ga0097620_100286344 3300006931 Bacteria 1740
240 Ga0097620_100571726 3300006931 Bacteria 1224
241 Ga0075435_100088492 3300007076 Bacteria 2553
242 Ga0075435_100178671 3300007076 Unclassified 1793
243 Ga0075435_100190132 3300007076 Bacteria 1738
244 Ga0075435_100265040 3300007076 Bacteria 1464
245 Ga0105240_10001978 3300009093 Bacteria 33869
246 Ga0105240_10174919 3300009093 Bacteria 2539
247 Ga0105240_10841247 3300009093 Bacteria 991
248 Ga0111539_10009038 3300009094 Bacteria 12610
249 Ga0111539_10009686 3300009094 Bacteria 12159
250 Ga0111539_10025036 3300009094 Bacteria 7313
251 Ga0111539_10068960 3300009094 Bacteria 4175
252 Ga0111539_10091854 3300009094 Bacteria 3567
253 Ga0111539_10161551 3300009094 Bacteria 2620
254 Ga0111539_10174588 3300009094 Bacteria 2510
255 Ga0111539_10257287 3300009094 Bacteria 2033
256 Ga0111539_10476425 3300009094 Bacteria 1454
257 Ga0111539_11179995 3300009094 Bacteria 889
258 Ga0105245_10086030 3300009098 Unclassified 2882
259 Ga0105245_10136224 3300009098 Bacteria 2308
260 Ga0105245_10161920 3300009098 Bacteria 2124
261 Ga0105247_10036625 3300009101 Bacteria 2991
262 Ga0105247_10180913 3300009101 Bacteria 1407
263 Ga0105247_10383173 3300009101 Bacteria 997
264 Ga0114129_10029011 3300009147 Bacteria 7837
265 Ga0114129_10067056 3300009147 Bacteria 5005
266 Ga0114129_10159861 3300009147 Bacteria 3079
267 Ga0114129_10396065 3300009147 Bacteria 1821
268 Ga0114129_10856946 3300009147 Bacteria 1154
269 Ga0114129_10943830 3300009147 Unclassified 1090
270 Ga0114129_11261389 3300009147 Unclassified 918
271 Ga0105243_10948487 3300009148 Bacteria 859
272 Ga0105241_10011851 3300009174 Bacteria 6405
273 Ga0105241_10121739 3300009174 Bacteria 2102
274 Ga0105241_10207240 3300009174 Unclassified 1641
275 Ga0105242_10001441 3300009176 Bacteria 18710
276 Ga0105242_10005108 3300009176 Bacteria 10122
277 Ga0105242_10045431 3300009176 Bacteria 3560
278 Ga0105242_10550473 3300009176 Bacteria 1106
279 Ga0105248_10001706 3300009177 Bacteria 24451
280 Ga0105248_10020013 3300009177 Bacteria 7410
281 Ga0105248_10086211 3300009177 Unclassified 3533
282 Ga0105248_10195258 3300009177 Bacteria 2280
283 Ga0105248_10349119 3300009177 Bacteria 1666
284 Ga0105237_10525282 3300009545 Bacteria 1190
285 Ga0105237_10566224 3300009545 Bacteria 1143
286 Ga0105238_10003943 3300009551 Bacteria 14719
287 Ga0105249_10116965 3300009553 Unclassified 2528
288 Ga0105249_10330380 3300009553 Bacteria 1538
289 Ga0105249_10494697 3300009553 Bacteria 1267
290 Ga0105239_10041408 3300010375 Bacteria 5049
291 Ga0105239_10282752 3300010375 Bacteria 1868
292 Ga0105239_10479493 3300010375 Bacteria 1413
293 Ga0105246_10185269 3300011119 Bacteria 1606
294 Ga0105246_10415611 3300011119 Bacteria 1121
295 Ga0105246_11070115 3300011119 Unclassified 735
296 Ga0157373_10017804 3300013100 Bacteria 5173
297 Ga0157369_10089133 3300013105 Bacteria 3294
298 Ga0157369_10195224 3300013105 Bacteria 2126
299 Ga0157374_10038010 3300013296 Bacteria 4422
300 Ga0157374_10064129 3300013296 Bacteria 3447
301 Ga0157374_10068106 3300013296 Bacteria 3348
302 Ga0157378_10016467 3300013297 Bacteria 6475
303 Ga0157378_10020278 3300013297 Bacteria 5846
304 Ga0157378_10322181 3300013297 Bacteria 1502
305 Ga0157378_10351173 3300013297 Unclassified 1440
306 Ga0157378_11107111 3300013297 Bacteria 829
307 Ga0163162_10027728 3300013306 Bacteria 5602
308 Ga0163162_10033433 3300013306 Bacteria 5111
309 Ga0163162_10116987 3300013306 Unclassified 2767
310 Ga0163162_10137062 3300013306 Bacteria 2559
311 Ga0163162_10416297 3300013306 Bacteria 1476
312 Ga0163162_10994816 3300013306 Unclassified 948
313 Ga0157372_10040093 3300013307 Bacteria 5171
314 Ga0157375_10045673 3300013308 Bacteria 4264
315 Ga0157375_10179674 3300013308 Unclassified 2267
316 Ga0157375_10805546 3300013308 Unclassified 1088
317 Ga0157375_10923421 3300013308 Bacteria 1016
318 Ga0163163_10006665 3300014325 Bacteria 10119
319 Ga0163163_10197301 3300014325 Bacteria 2061
320 Ga0163163_10271723 3300014325 Bacteria 1746
321 Ga0157380_10038456 3300014326 Unclassified 3715
322 Ga0157380_10057728 3300014326 Bacteria 3092
323 Ga0157380_10067274 3300014326 Unclassified 2884
324 Ga0157380_10073004 3300014326 Unclassified 2781
325 Ga0157380_10099734 3300014326 Bacteria 2416
326 Ga0157380_10171669 3300014326 Unclassified 1895
327 Ga0157380_10314392 3300014326 Bacteria 1449
328 Ga0157380_10649349 3300014326 Bacteria 1052
329 Ga0157377_10009715 3300014745 Bacteria 4734
330 Ga0157377_10030083 3300014745 Unclassified 2938
331 Ga0157377_10186040 3300014745 Bacteria 1309
332 Ga0157379_10008819 3300014968 Bacteria 8795
333 Ga0157379_10023414 3300014968 Bacteria 5480
334 Ga0157379_10085207 3300014968 Unclassified 2832
335 Ga0157379_10103023 3300014968 Bacteria 2561
336 Ga0157376_10049638 3300014969 Unclassified 3477
337 Ga0157376_10300316 3300014969 Unclassified 1520
338 Ga0157376_10504672 3300014969 Bacteria 1189
339 Ga0157376_10738091 3300014969 Unclassified 993
340 Ga0182005_1011227 3300015265 Bacteria 2560
341 Ga0163161_10264656 3300017792 Bacteria 1344
342 Ga0213872_10000306 3300021361 Bacteria 41866
343 Ga0207656_10022432 3300025321 Bacteria 2533
344 Ga0207656_10031390 3300025321 Unclassified 2201
345 Ga0207682_10088192 3300025893 Bacteria 1341
346 Ga0207688_10165205 3300025901 Bacteria 1314
347 Ga0207680_10403150 3300025903 Bacteria 967
348 Ga0207699_10349413 3300025906 Bacteria 1044
349 Ga0207645_10021545 3300025907 Bacteria 4202
350 Ga0207643_10177057 3300025908 Bacteria 1289
351 Ga0207643_10252579 3300025908 Bacteria 1086
352 Ga0207705_10063056 3300025909 Bacteria 2678
353 Ga0207705_10381645 3300025909 Bacteria 1088
354 Ga0207684_10063922 3300025910 Bacteria 3124
355 Ga0207684_10154038 3300025910 Unclassified 1978
356 Ga0207654_10047339 3300025911 Bacteria 2457
357 Ga0207654_10340049 3300025911 Bacteria 1031
358 Ga0207707_10032287 3300025912 Bacteria 4582
359 Ga0207695_10008306 3300025913 Bacteria 13010
360 Ga0207695_10173557 3300025913 Unclassified 2079
361 Ga0207671_10198053 3300025914 Bacteria 1568
362 Ga0207693_10034769 3300025915 Bacteria 3974
363 Ga0207662_10037499 3300025918 Bacteria 2837
364 Ga0207662_10201340 3300025918 Bacteria 1289
365 Ga0207657_10013584 3300025919 Bacteria 7987
366 Ga0207657_10016066 3300025919 Bacteria 7225
367 Ga0207649_10027657 3300025920 Bacteria 3331
368 Ga0207649_10528565 3300025920 Bacteria 900
369 Ga0207652_10022386 3300025921 Bacteria 5228
370 Ga0207652_10318344 3300025921 Bacteria 1404
371 Ga0207652_10369653 3300025921 Bacteria 1294
372 Ga0207646_10001945 3300025922 Bacteria 24785
373 Ga0207646_10160673 3300025922 Bacteria 2027
374 Ga0207681_10015701 3300025923 Bacteria 4727
375 Ga0207681_10053851 3300025923 Bacteria 2733
376 Ga0207681_10174291 3300025923 Bacteria 1633
377 Ga0207681_10543066 3300025923 Bacteria 956
378 Ga0207650_10158793 3300025925 Bacteria 1790
379 Ga0207650_10219495 3300025925 Bacteria 1530
380 Ga0207659_10000551 3300025926 Bacteria 22404
381 Ga0207659_10004666 3300025926 Bacteria 8299
382 Ga0207659_10004755 3300025926 Bacteria 8233
383 Ga0207659_10014937 3300025926 Archaea 5020
384 Ga0207659_10023074 3300025926 Bacteria 4149
385 Ga0207659_10043847 3300025926 Bacteria 3145
386 Ga0207659_10121544 3300025926 Unclassified 2002
387 Ga0207659_10187458 3300025926 Bacteria 1644
388 Ga0207659_10305482 3300025926 Bacteria 1308
389 Ga0207659_10506307 3300025926 Bacteria 1023
390 Ga0207659_10555439 3300025926 Bacteria 976
391 Ga0207659_10635152 3300025926 Bacteria 912
392 Ga0207687_10026547 3300025927 Bacteria 3879
393 Ga0207644_10049460 3300025931 Bacteria 3010
394 Ga0207644_10446382 3300025931 Bacteria 1062
395 Ga0207690_10221052 3300025932 Bacteria 1449
396 Ga0207706_10003229 3300025933 Bacteria 15628
397 Ga0207706_10054638 3300025933 Bacteria 3524
398 Ga0207686_10006807 3300025934 Bacteria 6155
399 Ga0207686_10067453 3300025934 Bacteria 2289
400 Ga0207709_10131244 3300025935 Bacteria 1708
401 Ga0207670_10082071 3300025936 Bacteria 2258
402 Ga0207670_10117727 3300025936 Bacteria 1926
403 Ga0207669_10100893 3300025937 Bacteria 1908
404 Ga0207669_10456241 3300025937 Bacteria 1014
405 Ga0207665_10007172 3300025939 Bacteria 7375
406 Ga0207665_10031091 3300025939 Bacteria 3531
407 Ga0207691_10023585 3300025940 Bacteria 5793
408 Ga0207691_10024876 3300025940 Bacteria 5627
409 Ga0207691_10039217 3300025940 Bacteria 4381
410 Ga0207691_10131759 3300025940 Bacteria 2207
411 Ga0207691_10179002 3300025940 Bacteria 1853
412 Ga0207691_10257342 3300025940 Unclassified 1505
413 Ga0207691_10666076 3300025940 Bacteria 879
414 Ga0207711_10003799 3300025941 Bacteria 12985
415 Ga0207711_10038345 3300025941 Bacteria 4074
416 Ga0207711_10075899 3300025941 Bacteria 2926
417 Ga0207689_10646734 3300025942 Bacteria 891
418 Ga0207661_10133337 3300025944 Bacteria 2131
419 Ga0207679_10044408 3300025945 Bacteria 3206
420 Ga0207679_10122791 3300025945 Bacteria 2070
421 Ga0207679_10675692 3300025945 Archaea 936
422 Ga0207667_10000243 3300025949 Bacteria 76553
423 Ga0207667_10218354 3300025949 Unclassified 1953
424 Ga0207667_10240593 3300025949 Bacteria 1852
425 Ga0207651_10003844 3300025960 Bacteria 7449
426 Ga0207651_10036285 3300025960 Bacteria 3216
427 Ga0207651_10050296 3300025960 Unclassified 2829
428 Ga0207651_10131346 3300025960 Bacteria 1918
429 Ga0207651_10209111 3300025960 Bacteria 1569
430 Ga0207712_10085733 3300025961 Unclassified 2306
431 Ga0207640_10052635 3300025981 Bacteria 2653
432 Ga0207658_10014277 3300025986 Bacteria 5439
433 Ga0207658_10171306 3300025986 Unclassified 1789
434 Ga0207677_10097584 3300026023 Bacteria 2153
435 Ga0207703_10008188 3300026035 Bacteria 8259
436 Ga0207703_10066511 3300026035 Bacteria 2965
437 Ga0207703_10255169 3300026035 Bacteria 1583
438 Ga0207703_10854898 3300026035 Unclassified 870
439 Ga0207639_10629860 3300026041 Bacteria 991
440 Ga0207678_10407374 3300026067 Bacteria 1178
441 Ga0207708_10107106 3300026075 Bacteria 2168
442 Ga0207708_10154721 3300026075 Bacteria 1808
443 Ga0207708_10228137 3300026075 Bacteria 1494
444 Ga0207702_10409348 3300026078 Bacteria 1309
445 Ga0207641_10136007 3300026088 Bacteria 2212
446 Ga0207641_10200698 3300026088 Bacteria 1839
447 Ga0207641_10293607 3300026088 Bacteria 1533
448 Ga0207641_10579818 3300026088 Bacteria 1096
449 Ga0207641_10633451 3300026088 Bacteria 1049
450 Ga0207648_10008316 3300026089 Bacteria 10072
451 Ga0207648_10109062 3300026089 Unclassified 2430
452 Ga0207648_10655249 3300026089 Bacteria 971
453 Ga0207676_10204151 3300026095 Bacteria 1748
454 Ga0207676_10443069 3300026095 Bacteria 1223
455 Ga0207676_10445943 3300026095 Bacteria 1219
456 Ga0207674_10286060 3300026116 Bacteria 1597
457 Ga0207675_100201383 3300026118 Unclassified 1912
458 Ga0207675_100350797 3300026118 Bacteria 1446
459 Ga0207675_100419644 3300026118 Unclassified 1321
460 Ga0207675_100467136 3300026118 Bacteria 1252
461 Ga0207683_10174715 3300026121 Bacteria 1946
462 Ga0207683_10185969 3300026121 Bacteria 1885
463 Ga0207683_10408445 3300026121 Unclassified 1250
464 Ga0207698_10110863 3300026142 Bacteria 2299
465 Ga0207698_10276639 3300026142 Bacteria 1550
466 Ga0207428_10006726 3300027907 Bacteria 10555
467 Ga0207428_10118705 3300027907 Bacteria 2030
468 Ga0207428_10419800 3300027907 Bacteria 978
469 Ga0268266_10041348 3300028379 Bacteria 3933
470 Ga0268265_10000371 3300028380 Bacteria 48539
471 Ga0268265_10176317 3300028380 Unclassified 1832
472 Ga0268265_10295628 3300028380 Bacteria 1456
473 Ga0268264_10143001 3300028381 Unclassified 2136
474 Ga0268264_10387669 3300028381 Unclassified 1339
475 Ga0268264_10514489 3300028381 Bacteria 1169
476 Ga0268264_10826633 3300028381 Unclassified 927
477 Ga0265326_10015812 3300028558 Bacteria 2185
478 Ga0265319_1000490 3300028563 Bacteria 27473
479 Ga0265318_10004072 3300028577 Bacteria 7168
480 Ga0265338_10018456 3300028800 Bacteria 7466
481 Ga0265338_10021704 3300028800 Bacteria 6681
482 Ga0265338_10108821 3300028800 Bacteria 2238
483 Ga0265338_10428037 3300028800 Bacteria 940
484 Ga0265765_1019224 3300030879 Bacteria 816
485 Ga0265320_10066032 3300031240 Bacteria 1716
486 Ga0265320_10089906 3300031240 Unclassified 1423
487 Ga0265320_10114221 3300031240 Bacteria 1235
488 Ga0307408_100805584 3300031548 Bacteria 853
489 Ga0307508_10000853 3300031616 Bacteria 35381
490 Ga0307514_10185146 3300031649 Bacteria 1336
491 Ga0316575_10050035 3300031665 Bacteria 1663
492 Ga0265314_10050619 3300031711 Bacteria 2899
493 Ga0265342_10048133 3300031712 Bacteria 2557
494 Ga0307516_10001275 3300031730 Bacteria 35070
495 Ga0307413_10319172 3300031824 Unclassified 1186
496 Ga0307409_101195843 3300031995 Bacteria 783
497 Ga0307416_100218716 3300032002 Bacteria 1825
498 Ga0307416_100453918 3300032002 Unclassified 1335
499 Ga0307416_100531617 3300032002 Bacteria 1246
500 Ga0307416_100789060 3300032002 Unclassified 1045
501 Ga0307416_100863498 3300032002 Bacteria 1003
502 Ga0307411_10046022 3300032005 Bacteria 2810
503 Ga0307411_10545939 3300032005 Unclassified 988
504 Ga0373936_0215958 3300035113 Bacteria 850
505 Ga0373941_0160096 3300035115 Bacteria 832
506 Ga0395898_0618991 3300037466 Bacteria 1025
507 Ga0395905_0539259 3300037471 Bacteria 1068
508 Ga0436365_0570686 3300039437 Bacteria 804
509 Ga0436361_0793152 3300039447 Bacteria 90360
510 Ga0451853_2503028 3300041512 Unclassified 2687
511 Ga0439435_0001312 3300042436 Bacteria 4532
512 Ga0439460_0088729 3300042461 Bacteria 980
513 Ga0451577_0040245 3300042876 Bacteria 4197
514 Ga0451577_0062362 3300042876 Bacteria 3325
515 Ga0453683_0578170 3300044673 Bacteria 732
516 Ga0466965_0173778 3300044683 Bacteria 1134
517 Ga0453684_1002906 3300044712 Bacteria 888
518 Ga0451576_0052911 3300045051 Bacteria 4254
519 Ga0451576_0317326 3300045051 Bacteria 1631
520 Ga0451576_0850191 3300045051 Bacteria 958
521 Ga0466967_0163915 3300045976 Bacteria 2088
522 Ga0495603_0092683 3300046455 Bacteria 1766
523 Ga0495629_0303632 3300046459 Bacteria 1093
524 Ga0495653_0444711 3300046463 Archaea 816
525 Ga0495653_0677660 3300046463 Unclassified 628
526 Ga0495580_0047786 3300046472 Bacteria 3033
527 Ga0495580_0103472 3300046472 Bacteria 1979
528 Ga0495664_0062688 3300046477 Unclassified 2215
529 Ga0495664_0123666 3300046477 Unclassified 1565
530 Ga0495628_0269785 3300046516 Bacteria 1266
531 Ga0495643_0009719 3300046522 Bacteria 5950
532 Ga0495640_0441524 3300046533 Archaea 796
533 Ga0495587_0257353 3300046536 Archaea 981
534 Ga0495598_0144250 3300046537 Bacteria 826
535 Ga0495621_0004270 3300046539 Bacteria 4002
536 Ga0495621_0028950 3300046539 Bacteria 1886
537 Ga0495645_0009220 3300046543 Bacteria 6896
538 Ga0495645_0248316 3300046543 Unclassified 1184
539 Ga0495658_0179468 3300046683 Bacteria 1313
540 Ga0495613_0160851 3300046689 Bacteria 1598
541 Ga0495670_0188688 3300046691 Bacteria 1090
542 Ga0495600_0149146 3300046809 Bacteria 1515
543 Ga0495604_0362620 3300047317 Bacteria 961
544 Ga0495636_0079155 3300047318 Bacteria 1413
545 Ga0496101_0032427 3300048904 Bacteria 3678
546 Ga0496102_0030054 3300048905 Bacteria 4862
547 Ga0496102_0196775 3300048905 Bacteria 1900
548 Ga0496102_0442443 3300048905 Bacteria 1220
549 Ga0496104_0024954 3300048907 Bacteria 5507
550 Ga0496106_0020851 3300048909 Bacteria 4863
551 Ga0496108_0013129 3300048911 Bacteria 6751
552 Ga0496108_0166040 3300048911 Unclassified 1909
553 Ga0496109_0019833 3300048912 Bacteria 5933
554 Ga0496109_0249132 3300048912 Bacteria 1673
555 Ga0496110_0096761 3300048913 Bacteria 2645
556 Ga0496111_0042607 3300048914 Unclassified 3260
557 Ga0496112_0027342 3300048915 Bacteria 5499
558 Ga0496112_0103040 3300048915 Bacteria 2823
559 Ga0496112_0256547 3300048915 Bacteria 1699
560 Ga0496112_0256770 3300048915 Bacteria 1698
561 Ga0496113_0008765 3300048916 Bacteria 6606
562 Ga0496114_0036974 3300048917 Bacteria 4037
563 Ga0496115_0169315 3300048918 Bacteria 1807
564 Ga0496115_0177834 3300048918 Bacteria 1760
565 Ga0496126_0271730 3300048929 Bacteria 1406
566 Ga0501033_0235810 3300049570 Bacteria 1299
567 Ga0501034_0366629 3300049571 Bacteria 1367
568 Ga0501036_0091658 3300049572 Bacteria 2567
569 Ga0501036_0340407 3300049572 Bacteria 1253
570 Ga0501038_0041078 3300049574 Bacteria 4035
571 Ga0501039_0027667 3300049575 Bacteria 4360
572 Ga0501039_0366886 3300049575 Bacteria 1131
573 Ga0501040_0007764 3300049576 Bacteria 6944
574 Ga0501040_0036511 3300049576 Bacteria 3336
575 Ga0501041_0410952 3300049577 Unclassified 858
576 Ga0501041_0512489 3300049577 Bacteria 763
577 Ga0501042_0003000 3300049578 Bacteria 10502
578 Ga0501042_0032181 3300049578 Bacteria 3713
579 Ga0501042_0524410 3300049578 Unclassified 861
580 Ga0501043_0505905 3300049579 Bacteria 902
581 Ga0501046_0101186 3300049580 Bacteria 2211
582 Ga0501047_0034406 3300049581 Bacteria 4892
583 Ga0501048_0074116 3300049582 Bacteria 2402
584 Ga0501069_0074426 3300049585 Bacteria 1906
585 Ga0501069_0208419 3300049585 Unclassified 1134
586 Ga0501071_0027456 3300049587 Bacteria 4005
587 Ga0501071_0039841 3300049587 Unclassified 3362
588 Ga0501071_0501957 3300049587 Bacteria 931
589 Ga0501072_0046375 3300049588 Bacteria 3420
590 Ga0501072_0078142 3300049588 Bacteria 2620
591 Ga0501072_0600922 3300049588 Bacteria 867
592 Ga0501074_0069638 3300049590 Bacteria 2530
593 Ga0501074_0106226 3300049590 Bacteria 2010
594 Ga0501074_0148441 3300049590 Bacteria 1677
595 Ga0501074_0237379 3300049590 Bacteria 1297
596 Ga0501075_0015543 3300049591 Bacteria 5462
597 Ga0501075_0083774 3300049591 Bacteria 2415
598 Ga0501076_0014574 3300049592 Bacteria 5926
599 Ga0501076_0065724 3300049592 Bacteria 2893
600 Ga0501077_0020096 3300049593 Bacteria 4227
601 Ga0501077_0085621 3300049593 Bacteria 1998
602 Ga0501079_0015368 3300049741 Bacteria 5841
603 Ga0501079_0135086 3300049741 Bacteria 1920
604 Ga0501080_0220274 3300049742 Unclassified 1737
605 Ga0501081_0002830 3300049743 Bacteria 11008
606 Ga0501081_0009624 3300049743 Bacteria 6300
607 Ga0501083_0208395 3300049744 Bacteria 1275
608 Ga0501035_0186767 3300049822 Bacteria 1784
609 Ga0501035_0248198 3300049822 Bacteria 1512
610 Ga0501045_0008886 3300049824 Bacteria 7015
611 Ga0501045_0022749 3300049824 Bacteria 4489
612 Ga0501045_0077455 3300049824 Bacteria 2450
613 nmdc:mga03n38_86007_c1 3300050490 Bacteria 1487
614 nmdc:mga0yw44_17899_c1 3300050492 Bacteria 3868
615 nmdc:mga0yw44_7281_c2 3300050492 Bacteria 4116
616 nmdc:mga0k408_62595_c1 3300050493 Bacteria 2164
617 nmdc:mga06z11_47253_c1 3300050494 Bacteria 2185
618 nmdc:mga07m45_18044_c1 3300050496 Bacteria 3801
619 nmdc:mga05p37_174740_c1 3300050507 Bacteria 2618
620 nmdc:mga05p37_36918_c1 3300050507 Bacteria 5993
621 nmdc:mga05p37_391233_c1 3300050507 Bacteria 1626
622 nmdc:mga05p37_628328_c1 3300050507 Bacteria 1207
623 nmdc:mga09592_67984_c1 3300050508 Unclassified 3022
624 nmdc:mga09592_84207_c1 3300050508 Bacteria 2711
625 nmdc:mga0qj67_100400_c1 3300050509 Bacteria 2333
626 nmdc:mga0qj67_129723_c1 3300050509 Unclassified 2042
627 nmdc:mga0qj67_153915_c1 3300050509 Bacteria 1866
628 nmdc:mga06r32_101040_c1 3300050510 Bacteria 2830
629 nmdc:mga06r32_23748_c1 3300050510 Bacteria 5679
630 nmdc:mga06r32_274312_c1 3300050510 Bacteria 1674
631 nmdc:mga06r32_276393_c1 3300050510 Unclassified 1667
632 nmdc:mga06r32_281247_c1 3300050510 Unclassified 1651
633 nmdc:mga06r32_97726_c1 3300050510 Unclassified 2878
634 nmdc:mga08y16_1048071_c1 3300050511 Unclassified 793
635 nmdc:mga08y16_1249370_c1 3300050511 Bacteria 711
636 nmdc:mga08y16_153015_c1 3300050511 Bacteria 2397
637 nmdc:mga08y16_305876_c1 3300050511 Bacteria 1638
638 nmdc:mga08y16_328389_c1 3300050511 Bacteria 1574
639 nmdc:mga08y16_421046_c1 3300050511 Bacteria 1365
640 nmdc:mga08y16_512674_c1 3300050511 Bacteria 1217
641 nmdc:mga08y16_75244_c1 3300050511 Bacteria 3520
642 nmdc:mga08y16_797256_c1 3300050511 Unclassified 938
643 nmdc:mga08y16_8750_c1 3300050511 Bacteria 10621
644 nmdc:mga0n895_105006_c1 3300050512 Bacteria 2837
645 nmdc:mga0n895_21104_c1 3300050512 Bacteria 6086
646 nmdc:mga0n895_263742_c1 3300050512 Bacteria 1748
647 nmdc:mga0n895_4404_c1 3300050512 Bacteria 11565
648 nmdc:mga0n895_560432_c1 3300050512 Bacteria 1148
649 nmdc:mga0rr50_16437_c1 3300050513 Bacteria 4916
650 nmdc:mga0rr50_175271_c1 3300050513 Bacteria 1750
651 nmdc:mga0rr50_84207_c1 3300050513 Bacteria 2461
652 nmdc:mga0a205_1038_c1 3300050515 Bacteria 23124
653 nmdc:mga0a205_129173_c1 3300050515 Bacteria 2427
654 nmdc:mga0a205_134924_c1 3300050515 Bacteria 2368
655 nmdc:mga0a205_162596_c1 3300050515 Bacteria 2128
656 nmdc:mga0a205_626481_c1 3300050515 Bacteria 928
657 Ga0495601_0068124 3300053077 Bacteria 2268
658 Ga0495601_0353192 3300053077 Bacteria 956
659 Ga0495595_0017325 3300053084 Unclassified 3099
660 Ga0501084_0007498 3300054114 Bacteria 8993
661 Ga0501084_0046823 3300054114 Bacteria 3622
662 Ga0501084_0172287 3300054114 Bacteria 1827
663 Ga0501082_0063210 3300060353 Bacteria 3187
664 Ga0501082_0184105 3300060353 Bacteria 1817
665 Ga0501082_0801625 3300060353 Bacteria 824
666 Ga0530510_0010804 3300061734 Bacteria 6405
667 Ga0530510_0268578 3300061734 Unclassified 1273
668 Ga0070713_100210492
669 rootL2_10114650
670 rootH1_10091388
671 rootH1_10098294
672 rootH1_10116147
673 Ga0065712_10086649
674 Ga0065712_10100720
675 Ga0065715_10010814
676 Ga0065715_10055518
677 Ga0065707_10014965
678 Ga0065707_10096888
679 Ga0065707_10157319
680 Ga0065707_10214148
681 Ga0070658_10395448
682 Ga0070676_10026734
683 Ga0070676_10159889
684 Ga0070676_10345372
685 Ga0070683_100080885
686 Ga0070670_100045582
687 Ga0070670_100118621
688 Ga0070670_100296554
689 Ga0070670_100321793
690 Ga0070670_100387668
691 Ga0070670_100510543
692 Ga0070670_100811539
693 Ga0070677_10048586
694 Ga0070666_10064459
695 Ga0068868_100090280
696 Ga0070660_100010292
697 Ga0070660_100150319
698 Ga0070660_100583778
699 Ga0070689_100040687
700 Ga0070689_100105292
701 Ga0070689_100111034
702 Ga0070689_100321035
703 Ga0070687_100089768
704 Ga0070661_100028766
705 Ga0070661_100158390
706 Ga0070692_10022272
707 Ga0070668_100243592
708 Ga0070669_100005059
709 Ga0070669_100065135
710 Ga0070669_100096980
711 Ga0070669_100143185
712 Ga0070669_100163693
713 Ga0070669_100538657
714 Ga0070675_100000882
715 Ga0070675_100000989
716 Ga0070675_100006800
717 Ga0070675_100015303
718 Ga0070675_100108800
719 Ga0070675_100137622
720 Ga0070675_100147719
721 Ga0070675_100241157
722 Ga0070675_100280520
723 Ga0070675_100352735
724 Ga0070671_100011684
725 Ga0070671_100070932
726 Ga0070671_100235437
727 Ga0070671_100396453
728 Ga0070674_100037237
729 Ga0070674_100107561
730 Ga0070674_100167564
731 Ga0070674_100358356
732 Ga0070674_100667561
733 Ga0070673_100010372
734 Ga0070673_100059217
735 Ga0070673_100109071
736 Ga0070673_100151366
737 Ga0070673_100160898
738 Ga0070673_100335272
739 Ga0070673_100362331
740 Ga0070688_100012605
741 Ga0070688_100020732
742 Ga0070688_100284054
743 Ga0070659_100020833
744 Ga0070659_100418319
745 Ga0070659_100430121
746 Ga0070667_100015885
747 Ga0070667_100260810
748 Ga0070709_10143318
749 Ga0070709_10303788
750 Ga0070710_10167958
751 Ga0070701_10089814
752 Ga0070701_10253086
753 Ga0070701_10279172
754 Ga0070701_10364712
755 Ga0070711_100162333
756 Ga0070705_100111171
757 Ga0070705_100141250
758 Ga0070705_100209006
759 Ga0070700_100112623
760 Ga0070700_100141502
761 Ga0070700_100292290
762 Ga0070694_100500336
763 Ga0070708_101009278
764 Ga0070663_100360664
765 Ga0070663_100371131
766 Ga0070678_100017126
767 Ga0070678_100065944
768 Ga0070678_100084742
769 Ga0070678_100230748
770 Ga0070678_100313017
771 Ga0070678_100377797
772 Ga0070662_100007587
773 Ga0070681_10051104
774 Ga0070681_10166558
775 Ga0068867_100060208
776 Ga0070706_100109825
777 Ga0070706_100184053
778 Ga0070707_100100944
779 Ga0070707_100271142
780 Ga0070707_100978695
781 Ga0070698_101207174
782 Ga0070699_100002960
783 Ga0070699_100333052
784 Ga0070699_100425073
785 Ga0070699_100895704
786 Ga0070679_100100237
787 Ga0070679_100340966
788 Ga0070684_100116966
789 Ga0070697_100670279
790 Ga0068853_100005850
791 Ga0070672_100040356
792 Ga0070672_100054374
793 Ga0070672_100059016
794 Ga0070672_100063089
795 Ga0070672_100092239
796 Ga0070672_100112792
797 Ga0070672_100486699
798 Ga0070672_100564539
799 Ga0070686_100019056
800 Ga0070686_100024747
801 Ga0070686_100067435
802 Ga0070695_100061285
803 Ga0070665_100046683
804 Ga0070665_100087270
805 Ga0070704_100106327
806 Ga0070704_100317633
807 Ga0068855_100000496
808 Ga0068855_100008328
809 Ga0068855_100023844
810 Ga0068855_100420266
811 Ga0070664_100017473
812 Ga0070664_100028692
813 Ga0070664_100041169
814 Ga0070664_100144607
815 Ga0070664_100199608
816 Ga0070664_100752350
817 Ga0068857_100115070
818 Ga0068857_100252800
819 Ga0068857_100434508
820 Ga0068856_100960331
821 Ga0068852_100397077
822 Ga0068859_100010995
823 Ga0068859_100053340
824 Ga0068859_100286350
825 Ga0068859_100571744
826 Ga0068864_100296514
827 Ga0068864_100311545
828 Ga0068864_100485966
829 Ga0068866_10374206
830 Ga0068866_10462146
831 Ga0068861_100038948
832 Ga0068861_100079486
833 Ga0068861_100120088
834 Ga0068861_100394350
835 Ga0068861_100689776
836 Ga0068851_10006981
837 Ga0068851_10033098
838 Ga0068851_10106495
839 Ga0068870_10034733
840 Ga0068863_100129691
841 Ga0068863_100143067
842 Ga0068863_100167839
843 Ga0068863_100327282
844 Ga0068863_100330683
845 Ga0068858_100002279
846 Ga0068858_100046942
847 Ga0068858_100050429
848 Ga0068858_100084288
849 Ga0068858_100171988
850 Ga0068858_100544669
851 Ga0068860_100123829
852 Ga0068860_100318624
853 Ga0068860_100425154
854 Ga0068860_100590494
855 Ga0068862_100000482
856 Ga0068862_100316609
857 Ga0068862_100383933
858 Ga0068862_100466621
859 Ga0081455_10205615
860 Ga0081538_10089024
861 Ga0081539_10024418
862 Ga0070717_10204655
863 Ga0075368_10003257
864 Ga0075364_10015725
865 Ga0070715_10143267
866 Ga0070716_100305115
867 Ga0070716_100352088
868 Ga0070712_100514478
869 Ga0075367_10237243
870 Ga0097621_100025718
871 Ga0097621_100026008
872 Ga0097621_100506624
873 Ga0075370_10004905
874 Ga0068871_100023692
875 Ga0068871_100228389
876 Ga0075428_100003208
877 Ga0075428_100082064
878 Ga0075428_100256851
879 Ga0075428_100282047
880 Ga0075430_100017089
881 Ga0075430_100093433
882 Ga0075430_100295674
883 Ga0075430_100302538
884 Ga0075431_100003079
885 Ga0075431_100008543
886 Ga0075431_100081851
887 Ga0075431_100120699
888 Ga0075433_10430981
889 Ga0075433_10586585
890 Ga0075434_100062611
891 Ga0075434_100122551
892 Ga0075434_100244329
893 Ga0075434_100254223
894 Ga0075434_100503402
895 Ga0075429_100046967
896 Ga0075429_100076509
897 Ga0075429_100097682
898 Ga0075429_100704618
899 Ga0068865_100483875
900 Ga0068865_100665913
901 Ga0075436_100236607
902 Ga0075436_100290595
903 Ga0097620_100010995
904 Ga0097620_100053340
905 Ga0097620_100286344
906 Ga0097620_100571726
907 Ga0075435_100088492
908 Ga0075435_100178671
909 Ga0075435_100190132
910 Ga0075435_100265040
911 Ga0105240_10001978
912 Ga0105240_10174919
913 Ga0105240_10841247
914 Ga0111539_10009038
915 Ga0111539_10009686
916 Ga0111539_10025036
917 Ga0111539_10068960
918 Ga0111539_10091854
919 Ga0111539_10161551
920 Ga0111539_10174588
921 Ga0111539_10257287
922 Ga0111539_10476425
923 Ga0111539_11179995
924 Ga0105245_10086030
925 Ga0105245_10136224
926 Ga0105245_10161920
927 Ga0105247_10036625
928 Ga0105247_10180913
929 Ga0105247_10383173
930 Ga0114129_10029011
931 Ga0114129_10067056
932 Ga0114129_10159861
933 Ga0114129_10396065
934 Ga0114129_10856946
935 Ga0114129_10943830
936 Ga0114129_11261389
937 Ga0105243_10948487
938 Ga0105241_10011851
939 Ga0105241_10121739
940 Ga0105241_10207240
941 Ga0105242_10001441
942 Ga0105242_10005108
943 Ga0105242_10045431
944 Ga0105242_10550473
945 Ga0105248_10001706
946 Ga0105248_10020013
947 Ga0105248_10086211
948 Ga0105248_10195258
949 Ga0105248_10349119
950 Ga0105237_10525282
951 Ga0105237_10566224
952 Ga0105238_10003943
953 Ga0105249_10116965
954 Ga0105249_10330380
955 Ga0105249_10494697
956 Ga0105239_10041408
957 Ga0105239_10282752
958 Ga0105239_10479493
959 Ga0105246_10185269
960 Ga0105246_10415611
961 Ga0105246_11070115
962 Ga0157373_10017804
963 Ga0157369_10089133
964 Ga0157369_10195224
965 Ga0157374_10038010
966 Ga0157374_10064129
967 Ga0157374_10068106
968 Ga0157378_10016467
969 Ga0157378_10020278
970 Ga0157378_10322181
971 Ga0157378_10351173
972 Ga0157378_11107111
973 Ga0163162_10027728
974 Ga0163162_10033433
975 Ga0163162_10116987
976 Ga0163162_10137062
977 Ga0163162_10416297
978 Ga0163162_10994816
979 Ga0157372_10040093
980 Ga0157375_10045673
981 Ga0157375_10179674
982 Ga0157375_10805546
983 Ga0157375_10923421
984 Ga0163163_10006665
985 Ga0163163_10197301
986 Ga0163163_10271723
987 Ga0157380_10038456
988 Ga0157380_10057728
989 Ga0157380_10067274
990 Ga0157380_10073004
991 Ga0157380_10099734
992 Ga0157380_10171669
993 Ga0157380_10314392
994 Ga0157380_10649349
995 Ga0157377_10009715
996 Ga0157377_10030083
997 Ga0157377_10186040
998 Ga0157379_10008819
999 Ga0157379_10023414
1000 Ga0157379_10085207
1001 Ga0157379_10103023
1002 Ga0157376_10049638
1003 Ga0157376_10300316
1004 Ga0157376_10504672
1005 Ga0157376_10738091
1006 Ga0182005_1011227
1007 Ga0163161_10264656
1008 Ga0213872_10000306
1009 Ga0207656_10022432
1010 Ga0207656_10031390
1011 Ga0207682_10088192
1012 Ga0207688_10165205
1013 Ga0207680_10403150
1014 Ga0207699_10349413
1015 Ga0207645_10021545
1016 Ga0207643_10177057
1017 Ga0207643_10252579
1018 Ga0207705_10063056
1019 Ga0207705_10381645
1020 Ga0207684_10063922
1021 Ga0207684_10154038
1022 Ga0207654_10047339
1023 Ga0207654_10340049
1024 Ga0207707_10032287
1025 Ga0207695_10008306
1026 Ga0207695_10173557
1027 Ga0207671_10198053
1028 Ga0207693_10034769
1029 Ga0207662_10037499
1030 Ga0207662_10201340
1031 Ga0207657_10013584
1032 Ga0207657_10016066
1033 Ga0207649_10027657
1034 Ga0207649_10528565
1035 Ga0207652_10022386
1036 Ga0207652_10318344
1037 Ga0207652_10369653
1038 Ga0207646_10001945
1039 Ga0207646_10160673
1040 Ga0207681_10015701
1041 Ga0207681_10053851
1042 Ga0207681_10174291
1043 Ga0207681_10543066
1044 Ga0207650_10158793
1045 Ga0207650_10219495
1046 Ga0207659_10000551
1047 Ga0207659_10004666
1048 Ga0207659_10004755
1049 Ga0207659_10014937
1050 Ga0207659_10023074
1051 Ga0207659_10043847
1052 Ga0207659_10121544
1053 Ga0207659_10187458
1054 Ga0207659_10305482
1055 Ga0207659_10506307
1056 Ga0207659_10555439
1057 Ga0207659_10635152
1058 Ga0207687_10026547
1059 Ga0207644_10049460
1060 Ga0207644_10446382
1061 Ga0207690_10221052
1062 Ga0207706_10003229
1063 Ga0207706_10054638
1064 Ga0207686_10006807
1065 Ga0207686_10067453
1066 Ga0207709_10131244
1067 Ga0207670_10082071
1068 Ga0207670_10117727
1069 Ga0207669_10100893
1070 Ga0207669_10456241
1071 Ga0207665_10007172
1072 Ga0207665_10031091
1073 Ga0207691_10023585
1074 Ga0207691_10024876
1075 Ga0207691_10039217
1076 Ga0207691_10131759
1077 Ga0207691_10179002
1078 Ga0207691_10257342
1079 Ga0207691_10666076
1080 Ga0207711_10003799
1081 Ga0207711_10038345
1082 Ga0207711_10075899
1083 Ga0207689_10646734
1084 Ga0207661_10133337
1085 Ga0207679_10044408
1086 Ga0207679_10122791
1087 Ga0207679_10675692
1088 Ga0207667_10000243
1089 Ga0207667_10218354
1090 Ga0207667_10240593
1091 Ga0207651_10003844
1092 Ga0207651_10036285
1093 Ga0207651_10050296
1094 Ga0207651_10131346
1095 Ga0207651_10209111
1096 Ga0207712_10085733
1097 Ga0207640_10052635
1098 Ga0207658_10014277
1099 Ga0207658_10171306
1100 Ga0207677_10097584
1101 Ga0207703_10008188
1102 Ga0207703_10066511
1103 Ga0207703_10255169
1104 Ga0207703_10854898
1105 Ga0207639_10629860
1106 Ga0207678_10407374
1107 Ga0207708_10107106
1108 Ga0207708_10154721
1109 Ga0207708_10228137
1110 Ga0207702_10409348
1111 Ga0207641_10136007
1112 Ga0207641_10200698
1113 Ga0207641_10293607
1114 Ga0207641_10579818
1115 Ga0207641_10633451
1116 Ga0207648_10008316
1117 Ga0207648_10109062
1118 Ga0207648_10655249
1119 Ga0207676_10204151
1120 Ga0207676_10443069
1121 Ga0207676_10445943
1122 Ga0207674_10286060
1123 Ga0207675_100201383
1124 Ga0207675_100350797
1125 Ga0207675_100419644
1126 Ga0207675_100467136
1127 Ga0207683_10174715
1128 Ga0207683_10185969
1129 Ga0207683_10408445
1130 Ga0207698_10110863
1131 Ga0207698_10276639
1132 Ga0207428_10006726
1133 Ga0207428_10118705
1134 Ga0207428_10419800
1135 Ga0268266_10041348
1136 Ga0268265_10000371
1137 Ga0268265_10176317
1138 Ga0268265_10295628
1139 Ga0268264_10143001
1140 Ga0268264_10387669
1141 Ga0268264_10514489
1142 Ga0268264_10826633
1143 Ga0265326_10015812
1144 Ga0265319_1000490
1145 Ga0265318_10004072
1146 Ga0265338_10018456
1147 Ga0265338_10021704
1148 Ga0265338_10108821
1149 Ga0265338_10428037
1150 Ga0265765_1019224
1151 Ga0265320_10066032
1152 Ga0265320_10089906
1153 Ga0265320_10114221
1154 Ga0307408_100805584
1155 Ga0307508_10000853
1156 Ga0307514_10185146
1157 Ga0316575_10050035
1158 Ga0265314_10050619
1159 Ga0265342_10048133
1160 Ga0307516_10001275
1161 Ga0307413_10319172
1162 Ga0307409_101195843
1163 Ga0307416_100218716
1164 Ga0307416_100453918
1165 Ga0307416_100531617
1166 Ga0307416_100789060
1167 Ga0307416_100863498
1168 Ga0307411_10046022
1169 Ga0307411_10545939
1170 Ga0373936_0215958
1171 Ga0373941_0160096
1172 Ga0395898_0618991
1173 Ga0395905_0539259
1174 Ga0436365_0570686
1175 Ga0436361_0793152
1176 Ga0451853_2503028
1177 Ga0439435_0001312
1178 Ga0439460_0088729
1179 Ga0451577_0040245
1180 Ga0451577_0062362
1181 Ga0453683_0578170
1182 Ga0466965_0173778
1183 Ga0453684_1002906
1184 Ga0451576_0052911
1185 Ga0451576_0317326
1186 Ga0451576_0850191
1187 Ga0466967_0163915
1188 Ga0495603_0092683
1189 Ga0495629_0303632
1190 Ga0495653_0444711
1191 Ga0495653_0677660
1192 Ga0495580_0047786
1193 Ga0495580_0103472
1194 Ga0495664_0062688
1195 Ga0495664_0123666
1196 Ga0495628_0269785
1197 Ga0495643_0009719
1198 Ga0495640_0441524
1199 Ga0495587_0257353
1200 Ga0495598_0144250
1201 Ga0495621_0004270
1202 Ga0495621_0028950
1203 Ga0495645_0009220
1204 Ga0495645_0248316
1205 Ga0495658_0179468
1206 Ga0495613_0160851
1207 Ga0495670_0188688
1208 Ga0495600_0149146
1209 Ga0495604_0362620
1210 Ga0495636_0079155
1211 Ga0496101_0032427
1212 Ga0496102_0030054
1213 Ga0496102_0196775
1214 Ga0496102_0442443
1215 Ga0496104_0024954
1216 Ga0496106_0020851
1217 Ga0496108_0013129
1218 Ga0496108_0166040
1219 Ga0496109_0019833
1220 Ga0496109_0249132
1221 Ga0496110_0096761
1222 Ga0496111_0042607
1223 Ga0496112_0027342
1224 Ga0496112_0103040
1225 Ga0496112_0256547
1226 Ga0496112_0256770
1227 Ga0496113_0008765
1228 Ga0496114_0036974
1229 Ga0496115_0169315
1230 Ga0496115_0177834
1231 Ga0496126_0271730
1232 Ga0501033_0235810
1233 Ga0501034_0366629
1234 Ga0501036_0091658
1235 Ga0501036_0340407
1236 Ga0501038_0041078
1237 Ga0501039_0027667
1238 Ga0501039_0366886
1239 Ga0501040_0007764
1240 Ga0501040_0036511
1241 Ga0501041_0410952
1242 Ga0501041_0512489
1243 Ga0501042_0003000
1244 Ga0501042_0032181
1245 Ga0501042_0524410
1246 Ga0501043_0505905
1247 Ga0501046_0101186
1248 Ga0501047_0034406
1249 Ga0501048_0074116
1250 Ga0501069_0074426
1251 Ga0501069_0208419
1252 Ga0501071_0027456
1253 Ga0501071_0039841
1254 Ga0501071_0501957
1255 Ga0501072_0046375
1256 Ga0501072_0078142
1257 Ga0501072_0600922
1258 Ga0501074_0069638
1259 Ga0501074_0106226
1260 Ga0501074_0148441
1261 Ga0501074_0237379
1262 Ga0501075_0015543
1263 Ga0501075_0083774
1264 Ga0501076_0014574
1265 Ga0501076_0065724
1266 Ga0501077_0020096
1267 Ga0501077_0085621
1268 Ga0501079_0015368
1269 Ga0501079_0135086
1270 Ga0501080_0220274
1271 Ga0501081_0002830
1272 Ga0501081_0009624
1273 Ga0501083_0208395
1274 Ga0501035_0186767
1275 Ga0501035_0248198
1276 Ga0501045_0008886
1277 Ga0501045_0022749
1278 Ga0501045_0077455
1279 nmdc:mga03n38_86007_c1
1280 nmdc:mga0yw44_17899_c1
1281 nmdc:mga0yw44_7281_c2
1282 nmdc:mga0k408_62595_c1
1283 nmdc:mga06z11_47253_c1
1284 nmdc:mga07m45_18044_c1
1285 nmdc:mga05p37_174740_c1
1286 nmdc:mga05p37_36918_c1
1287 nmdc:mga05p37_391233_c1
1288 nmdc:mga05p37_628328_c1
1289 nmdc:mga09592_67984_c1
1290 nmdc:mga09592_84207_c1
1291 nmdc:mga0qj67_100400_c1
1292 nmdc:mga0qj67_129723_c1
1293 nmdc:mga0qj67_153915_c1
1294 nmdc:mga06r32_101040_c1
1295 nmdc:mga06r32_23748_c1
1296 nmdc:mga06r32_274312_c1
1297 nmdc:mga06r32_276393_c1
1298 nmdc:mga06r32_281247_c1
1299 nmdc:mga06r32_97726_c1
1300 nmdc:mga08y16_1048071_c1
1301 nmdc:mga08y16_1249370_c1
1302 nmdc:mga08y16_153015_c1
1303 nmdc:mga08y16_305876_c1
1304 nmdc:mga08y16_328389_c1
1305 nmdc:mga08y16_421046_c1
1306 nmdc:mga08y16_512674_c1
1307 nmdc:mga08y16_75244_c1
1308 nmdc:mga08y16_797256_c1
1309 nmdc:mga08y16_8750_c1
1310 nmdc:mga0n895_105006_c1
1311 nmdc:mga0n895_21104_c1
1312 nmdc:mga0n895_263742_c1
1313 nmdc:mga0n895_4404_c1
1314 nmdc:mga0n895_560432_c1
1315 nmdc:mga0rr50_16437_c1
1316 nmdc:mga0rr50_175271_c1
1317 nmdc:mga0rr50_84207_c1
1318 nmdc:mga0a205_1038_c1
1319 nmdc:mga0a205_129173_c1
1320 nmdc:mga0a205_134924_c1
1321 nmdc:mga0a205_162596_c1
1322 nmdc:mga0a205_626481_c1
1323 Ga0495601_0068124
1324 Ga0495601_0353192
1325 Ga0495595_0017325
1326 Ga0501084_0007498
1327 Ga0501084_0046823
1328 Ga0501084_0172287
1329 Ga0501082_0063210
1330 Ga0501082_0184105
1331 Ga0501082_0801625
1332 Ga0530510_0010804
1333 Ga0530510_0268578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

46

230

0.95

PF13242

Hydrolase_like

HAD-hyrolase-like

184

254

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

43

224

0.85

PF12710

HAD

haloacid dehalogenase-like hydrolase

46

221

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.8889 8 214
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.8845 7 218
2hi0-assembly2.cif.gz_B crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution 0.874 7 218
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.8692 7 218
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.8631 3 217
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9547 92 205 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9286 106 213 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9233 92 205 3.40.50.1000
3d6jA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9086 9 214 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9072 9 220 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7X9P827-F1-model_v4 HAD-IA family hydrolase 0.9483 7 217 GO:0005829
GO:0006281
GO:0008967
AF-A0A1F4BRV6-F1-model_v4 Phosphoglycolate phosphatase 0.9428 8 214 GO:0005829
GO:0006281
GO:0008967
AF-A0A358M2M0-F1-model_v4 Phosphoglycolate phosphatase 0.9396 8 220 GO:0005829
GO:0006281
GO:0008967
AF-A0A2W4LTW9-F1-model_v4 phosphoglycolate phosphatase (EC 3.1.3.18) 0.9392 8 219 GO:0005829
GO:0005975
GO:0006281
GO:0008967
GO:0046872
AF-A0A7C3L1K4-F1-model_v4 HAD family hydrolase 0.9381 6 217 GO:0005829
GO:0006281
GO:0008967

Map