F473721
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 665 | 360 | 1330 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300041404|Ga0439436_0002401|Ga0439436_0002401_3392_4540 |
| Length | 364 |
| Sequence | VFPEGASLRLPRRLLVANKEASQTMRFIFKTSYAQDIALAKHGGHMFWYSLLGAALIAAPWMLPEYWLAQLTFVLIYGIVGLGLMLLAGFTGQFSIGHAAFLGTGAYTQAVLANMGVPFALPALRVKGIYLGIATLAFGFIVEEVFARWESVTGGNSGLHVKSPKLFGLDISSSEGFYMVCLVVAVICTLAILNLLRSPTGRAFVAIRDSEISAQSMGIHLARYKTMSFAISAALAGLGGALYAHKLSFISPEQFNILQSIDLLLMVVIGGLGSVHGAFLGAIFLIAMPQLIALGKDWLPPVIGQAPGLQGLVYGLVLIGFVLFEPLGLYGRWLKIRTYLQLFPFYRRGLFRRQKSFTKSDRLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 6 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 72 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 73 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 167 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 179 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 180 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 181 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 189 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 198 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 199 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 207 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 208 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 209 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 210 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 211 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 213 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 214 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 215 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 216 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 217 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 218 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 219 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 223 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 224 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 225 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 226 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 227 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 228 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 229 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 268 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 269 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 270 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 271 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 272 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 291 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 292 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 293 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 294 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 296 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 297 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 298 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 299 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 303 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 304 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 305 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 306 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 307 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 309 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 310 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 311 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 312 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 313 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 314 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 315 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 316 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 317 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 318 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 319 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 320 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 321 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 322 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 323 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 324 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 325 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 326 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 327 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 328 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 329 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 330 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 331 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 332 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 333 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 334 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 335 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 336 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 337 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 338 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 339 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 340 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 341 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 342 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 343 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 344 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 345 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 346 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 347 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 348 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 349 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 350 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 351 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 352 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 353 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 354 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 355 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 356 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 357 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 358 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 359 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 360 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.03 |
| Metatranscriptomes | 0 |
| Isolates | 7.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.92 |
| Nodule | 0.75 |
| Rhizoplane | 2.56 |
| Rhizosphere | 59.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439436_0002401 | 3300041404 | Bacteria | 5616 |
| 2 | JGI25159J45721_1000390 | 3300002987 | Bacteria | 20396 |
| 3 | JGI25159J45721_1009932 | 3300002987 | Bacteria | 2471 |
| 4 | JGI25151J46595_10001225 | 3300003187 | Bacteria | 18346 |
| 5 | JGI25151J46595_10006750 | 3300003187 | Bacteria | 5715 |
| 6 | JGI25160J50197_1000587 | 3300003354 | Bacteria | 20382 |
| 7 | JGI25160J50197_1015577 | 3300003354 | Bacteria | 2490 |
| 8 | JGI25161J50226_1000046 | 3300003374 | Bacteria | 116165 |
| 9 | JGI25161J50226_1003345 | 3300003374 | Bacteria | 3705 |
| 10 | JGI25161J50226_1004119 | 3300003374 | Bacteria | 3120 |
| 11 | Ga0055535_1000168 | 3300003761 | Bacteria | 70666 |
| 12 | Ga0055542_1000214 | 3300003762 | Bacteria | 70682 |
| 13 | Ga0055526_1001336 | 3300003771 | Bacteria | 17664 |
| 14 | Ga0055526_1015004 | 3300003771 | Bacteria | 3140 |
| 15 | Ga0055526_1019305 | 3300003771 | Bacteria | 2490 |
| 16 | Ga0055537_1000333 | 3300003773 | Bacteria | 32239 |
| 17 | Ga0055536_1004071 | 3300003781 | Bacteria | 7608 |
| 18 | Ga0055536_1006559 | 3300003781 | Bacteria | 5398 |
| 19 | Ga0055536_1013076 | 3300003781 | Bacteria | 3024 |
| 20 | Ga0055534_1000265 | 3300003784 | Bacteria | 36441 |
| 21 | Ga0055534_1003619 | 3300003784 | Bacteria | 4799 |
| 22 | Ga0055528_1000471 | 3300003790 | Bacteria | 32238 |
| 23 | Ga0055530_10001300 | 3300003791 | Bacteria | 18811 |
| 24 | Ga0055540_1002601 | 3300003792 | Bacteria | 9395 |
| 25 | Ga0055540_1003978 | 3300003792 | Bacteria | 6882 |
| 26 | Ga0055540_1013665 | 3300003792 | Bacteria | 2465 |
| 27 | Ga0055531_10000572 | 3300003794 | Bacteria | 32155 |
| 28 | Ga0055531_10021507 | 3300003794 | Bacteria | 2499 |
| 29 | Ga0055543_1000270 | 3300004625 | Bacteria | 38712 |
| 30 | Ga0055543_1005877 | 3300004625 | Bacteria | 3063 |
| 31 | Ga0065165_1004394 | 3300005262 | Bacteria | 8786 |
| 32 | Ga0065165_1008423 | 3300005262 | Bacteria | 4828 |
| 33 | Ga0065714_10017429 | 3300005288 | Bacteria | 2007 |
| 34 | Ga0065714_10080960 | 3300005288 | Bacteria | 2406 |
| 35 | Ga0065704_10071856 | 3300005289 | Bacteria | 9751 |
| 36 | Ga0065704_10085617 | 3300005289 | Bacteria | 3204 |
| 37 | Ga0065707_10106764 | 3300005295 | Bacteria | 2583 |
| 38 | Ga0070676_10005696 | 3300005328 | Bacteria | 6636 |
| 39 | Ga0070670_100002652 | 3300005331 | Bacteria | 14794 |
| 40 | Ga0070670_100027701 | 3300005331 | Bacteria | 4874 |
| 41 | Ga0070670_100123525 | 3300005331 | Bacteria | 2234 |
| 42 | Ga0070670_100148216 | 3300005331 | Bacteria | 2030 |
| 43 | Ga0070677_10036034 | 3300005333 | Bacteria | 1921 |
| 44 | Ga0068869_100012209 | 3300005334 | Bacteria | 5667 |
| 45 | Ga0068869_100066228 | 3300005334 | Bacteria | 2661 |
| 46 | Ga0068869_100141443 | 3300005334 | Bacteria | 1858 |
| 47 | Ga0070666_10085581 | 3300005335 | Bacteria | 2159 |
| 48 | Ga0068868_100012831 | 3300005338 | Bacteria | 6130 |
| 49 | Ga0068868_100024677 | 3300005338 | Bacteria | 4564 |
| 50 | Ga0070689_100049223 | 3300005340 | Bacteria | 3253 |
| 51 | Ga0070687_100078289 | 3300005343 | Bacteria | 1797 |
| 52 | Ga0070668_100042712 | 3300005347 | Bacteria | 3475 |
| 53 | Ga0070668_100182609 | 3300005347 | Bacteria | 1714 |
| 54 | Ga0070669_100122845 | 3300005353 | Bacteria | 1983 |
| 55 | Ga0070675_100000243 | 3300005354 | Bacteria | 35354 |
| 56 | Ga0070675_100003727 | 3300005354 | Bacteria | 11585 |
| 57 | Ga0070675_100029315 | 3300005354 | Bacteria | 4438 |
| 58 | Ga0070675_100049676 | 3300005354 | Bacteria | 3443 |
| 59 | Ga0070675_100167953 | 3300005354 | Bacteria | 1890 |
| 60 | Ga0070671_100006003 | 3300005355 | Bacteria | 9679 |
| 61 | Ga0070671_100221576 | 3300005355 | Bacteria | 1604 |
| 62 | Ga0070673_100010639 | 3300005364 | Bacteria | 6237 |
| 63 | Ga0070673_100225270 | 3300005364 | Bacteria | 1625 |
| 64 | Ga0070673_100314204 | 3300005364 | Bacteria | 1383 |
| 65 | Ga0070667_100010689 | 3300005367 | Bacteria | 7584 |
| 66 | Ga0070667_100045883 | 3300005367 | Bacteria | 3676 |
| 67 | Ga0070667_100066289 | 3300005367 | Bacteria | 3067 |
| 68 | Ga0070667_100094495 | 3300005367 | Bacteria | 2576 |
| 69 | Ga0070667_100209868 | 3300005367 | Bacteria | 1730 |
| 70 | Ga0070678_100003356 | 3300005456 | Bacteria | 8919 |
| 71 | Ga0070678_100065650 | 3300005456 | Bacteria | 2695 |
| 72 | Ga0070678_100078872 | 3300005456 | Bacteria | 2489 |
| 73 | Ga0070678_100169210 | 3300005456 | Bacteria | 1778 |
| 74 | Ga0070662_100004403 | 3300005457 | Bacteria | 8902 |
| 75 | Ga0070662_100011286 | 3300005457 | Bacteria | 5891 |
| 76 | Ga0070662_100034829 | 3300005457 | Bacteria | 3552 |
| 77 | Ga0068867_100001303 | 3300005459 | Bacteria | 17238 |
| 78 | Ga0068867_100010378 | 3300005459 | Bacteria | 6572 |
| 79 | Ga0068867_100062429 | 3300005459 | Bacteria | 2768 |
| 80 | Ga0070685_10125285 | 3300005466 | Bacteria | 1600 |
| 81 | Ga0070706_100263470 | 3300005467 | Bacteria | 1609 |
| 82 | Ga0070672_100002056 | 3300005543 | Bacteria | 12677 |
| 83 | Ga0070672_100004518 | 3300005543 | Bacteria | 9106 |
| 84 | Ga0070672_100013934 | 3300005543 | Bacteria | 5688 |
| 85 | Ga0070672_100043606 | 3300005543 | Bacteria | 3460 |
| 86 | Ga0070672_100308954 | 3300005543 | Bacteria | 1342 |
| 87 | Ga0070665_100040676 | 3300005548 | Bacteria | 4672 |
| 88 | Ga0070664_100162821 | 3300005564 | Bacteria | 1975 |
| 89 | Ga0070664_100281773 | 3300005564 | Bacteria | 1499 |
| 90 | Ga0068857_100064216 | 3300005577 | Bacteria | 3264 |
| 91 | Ga0068857_100194812 | 3300005577 | Bacteria | 1846 |
| 92 | Ga0068857_100206267 | 3300005577 | Bacteria | 1793 |
| 93 | Ga0068854_100033089 | 3300005578 | Bacteria | 3602 |
| 94 | Ga0068854_100092842 | 3300005578 | Bacteria | 2249 |
| 95 | Ga0068854_100208643 | 3300005578 | Bacteria | 1540 |
| 96 | Ga0068854_100246885 | 3300005578 | Bacteria | 1424 |
| 97 | Ga0068859_100000664 | 3300005617 | Bacteria | 34524 |
| 98 | Ga0068864_100000649 | 3300005618 | Bacteria | 29069 |
| 99 | Ga0068864_100002170 | 3300005618 | Bacteria | 16199 |
| 100 | Ga0068864_100012522 | 3300005618 | Bacteria | 7015 |
| 101 | Ga0068866_10002429 | 3300005718 | Bacteria | 7686 |
| 102 | Ga0068866_10012183 | 3300005718 | Bacteria | 3743 |
| 103 | Ga0068861_100056642 | 3300005719 | Bacteria | 2992 |
| 104 | Ga0068861_100301240 | 3300005719 | Bacteria | 1388 |
| 105 | Ga0068851_10031521 | 3300005834 | Bacteria | 2634 |
| 106 | Ga0068863_100029931 | 3300005841 | Bacteria | 5201 |
| 107 | Ga0068863_100085517 | 3300005841 | Bacteria | 2989 |
| 108 | Ga0068863_100260196 | 3300005841 | Bacteria | 1677 |
| 109 | Ga0068858_100000753 | 3300005842 | Bacteria | 33946 |
| 110 | Ga0068858_100001308 | 3300005842 | Bacteria | 25722 |
| 111 | Ga0068860_100002605 | 3300005843 | Bacteria | 18875 |
| 112 | Ga0068860_100002764 | 3300005843 | Bacteria | 18265 |
| 113 | Ga0068860_100005264 | 3300005843 | Bacteria | 13132 |
| 114 | Ga0068862_100163419 | 3300005844 | Bacteria | 1989 |
| 115 | Ga0068862_100201791 | 3300005844 | Bacteria | 1793 |
| 116 | Ga0081455_10089108 | 3300005937 | Bacteria | 2504 |
| 117 | Ga0075365_10012259 | 3300006038 | Bacteria | 5082 |
| 118 | Ga0075365_10104328 | 3300006038 | Bacteria | 1944 |
| 119 | Ga0075365_10128389 | 3300006038 | Bacteria | 1753 |
| 120 | Ga0075365_10185421 | 3300006038 | Bacteria | 1455 |
| 121 | Ga0075365_10199188 | 3300006038 | Bacteria | 1403 |
| 122 | Ga0075368_10004034 | 3300006042 | Bacteria | 4940 |
| 123 | Ga0075363_100005537 | 3300006048 | Bacteria | 5630 |
| 124 | Ga0075363_100041448 | 3300006048 | Bacteria | 2428 |
| 125 | Ga0075363_100043855 | 3300006048 | Bacteria | 2367 |
| 126 | Ga0075364_10005816 | 3300006051 | Bacteria | 7198 |
| 127 | Ga0075364_10033290 | 3300006051 | Bacteria | 3317 |
| 128 | Ga0075364_10053443 | 3300006051 | Bacteria | 2641 |
| 129 | Ga0075432_10012307 | 3300006058 | Bacteria | 2906 |
| 130 | Ga0070716_100197628 | 3300006173 | Bacteria | 1334 |
| 131 | Ga0075362_10007426 | 3300006177 | Bacteria | 4151 |
| 132 | Ga0075362_10050019 | 3300006177 | Bacteria | 1868 |
| 133 | Ga0075367_10072773 | 3300006178 | Bacteria | 2070 |
| 134 | Ga0075367_10079223 | 3300006178 | Bacteria | 1985 |
| 135 | Ga0075369_10057668 | 3300006186 | Bacteria | 1689 |
| 136 | Ga0075366_10004449 | 3300006195 | Bacteria | 7522 |
| 137 | Ga0075366_10004609 | 3300006195 | Bacteria | 7406 |
| 138 | Ga0075366_10007302 | 3300006195 | Bacteria | 6096 |
| 139 | Ga0075366_10023123 | 3300006195 | Bacteria | 3620 |
| 140 | Ga0075366_10035706 | 3300006195 | Bacteria | 2931 |
| 141 | Ga0075366_10036931 | 3300006195 | Bacteria | 2881 |
| 142 | Ga0097621_100018401 | 3300006237 | Bacteria | 5335 |
| 143 | Ga0097621_100030835 | 3300006237 | Bacteria | 4248 |
| 144 | Ga0097621_100346637 | 3300006237 | Bacteria | 1320 |
| 145 | Ga0075370_10000228 | 3300006353 | Bacteria | 20029 |
| 146 | Ga0075370_10003908 | 3300006353 | Bacteria | 7151 |
| 147 | Ga0075370_10007388 | 3300006353 | Bacteria | 5594 |
| 148 | Ga0075370_10008651 | 3300006353 | Bacteria | 5247 |
| 149 | Ga0075370_10029533 | 3300006353 | Bacteria | 3054 |
| 150 | Ga0075370_10047414 | 3300006353 | Bacteria | 2433 |
| 151 | Ga0075370_10116276 | 3300006353 | Bacteria | 1555 |
| 152 | Ga0075430_100000318 | 3300006846 | Bacteria | 34303 |
| 153 | Ga0075430_100114647 | 3300006846 | Bacteria | 2245 |
| 154 | Ga0075431_100340803 | 3300006847 | Bacteria | 1508 |
| 155 | Ga0068865_100002181 | 3300006881 | Bacteria | 11531 |
| 156 | Ga0068865_100086459 | 3300006881 | Bacteria | 2263 |
| 157 | Ga0068865_100296017 | 3300006881 | Bacteria | 1293 |
| 158 | Ga0097620_100000664 | 3300006931 | Bacteria | 34524 |
| 159 | Ga0079104_1005414 | 3300006946 | Bacteria | 5109 |
| 160 | Ga0099826_10005686 | 3300006948 | Bacteria | 8978 |
| 161 | Ga0105244_10007097 | 3300009036 | Bacteria | 7162 |
| 162 | Ga0105244_10082806 | 3300009036 | Bacteria | 1586 |
| 163 | Ga0105240_10158043 | 3300009093 | Bacteria | 2695 |
| 164 | Ga0105245_10028047 | 3300009098 | Bacteria | 4962 |
| 165 | Ga0105245_10061457 | 3300009098 | Bacteria | 3387 |
| 166 | Ga0105245_10138678 | 3300009098 | Bacteria | 2288 |
| 167 | Ga0114129_10307032 | 3300009147 | Bacteria | 2113 |
| 168 | Ga0105243_10001208 | 3300009148 | Bacteria | 23242 |
| 169 | Ga0105243_10007703 | 3300009148 | Bacteria | 8278 |
| 170 | Ga0105243_10013939 | 3300009148 | Bacteria | 6082 |
| 171 | Ga0105243_10171051 | 3300009148 | Bacteria | 1881 |
| 172 | Ga0105243_10393137 | 3300009148 | Bacteria | 1286 |
| 173 | Ga0105248_10011097 | 3300009177 | Bacteria | 9940 |
| 174 | Ga0105248_10577210 | 3300009177 | Bacteria | 1269 |
| 175 | Ga0105248_10600103 | 3300009177 | Bacteria | 1242 |
| 176 | Ga0105238_10191826 | 3300009551 | Bacteria | 2019 |
| 177 | Ga0105249_10035236 | 3300009553 | Bacteria | 4538 |
| 178 | Ga0105239_10064107 | 3300010375 | Bacteria | 4034 |
| 179 | Ga0105246_10089187 | 3300011119 | Bacteria | 2218 |
| 180 | Ga0105246_10111627 | 3300011119 | Bacteria | 2009 |
| 181 | Ga0105246_10114497 | 3300011119 | Bacteria | 1987 |
| 182 | Ga0105246_10275131 | 3300011119 | Bacteria | 1348 |
| 183 | Ga0157347_1001782 | 3300012502 | Bacteria | 1750 |
| 184 | Ga0157373_10012523 | 3300013100 | Bacteria | 6235 |
| 185 | Ga0157373_10141198 | 3300013100 | Bacteria | 1694 |
| 186 | Ga0157373_10241855 | 3300013100 | Bacteria | 1276 |
| 187 | Ga0157370_10173203 | 3300013104 | Bacteria | 2006 |
| 188 | Ga0157369_10021938 | 3300013105 | Bacteria | 7138 |
| 189 | Ga0157374_10371824 | 3300013296 | Bacteria | 1423 |
| 190 | Ga0157378_10004511 | 3300013297 | Bacteria | 12212 |
| 191 | Ga0157378_10010562 | 3300013297 | Bacteria | 8070 |
| 192 | Ga0157378_10107814 | 3300013297 | Bacteria | 2549 |
| 193 | Ga0157378_10189611 | 3300013297 | Bacteria | 1938 |
| 194 | Ga0163162_10004677 | 3300013306 | Bacteria | 13200 |
| 195 | Ga0163162_10021485 | 3300013306 | Bacteria | 6358 |
| 196 | Ga0163162_10296163 | 3300013306 | Bacteria | 1750 |
| 197 | Ga0163162_10449355 | 3300013306 | Bacteria | 1421 |
| 198 | Ga0157372_10489617 | 3300013307 | Bacteria | 1434 |
| 199 | Ga0157375_10143305 | 3300013308 | Bacteria | 2518 |
| 200 | Ga0157375_10236213 | 3300013308 | Bacteria | 1987 |
| 201 | Ga0157375_10367627 | 3300013308 | Bacteria | 1604 |
| 202 | Ga0157375_10421836 | 3300013308 | Bacteria | 1500 |
| 203 | Ga0163163_10003252 | 3300014325 | Bacteria | 13780 |
| 204 | Ga0163163_10198961 | 3300014325 | Bacteria | 2052 |
| 205 | Ga0163163_10408160 | 3300014325 | Bacteria | 1417 |
| 206 | Ga0157380_10028571 | 3300014326 | Bacteria | 4254 |
| 207 | Ga0182008_10065342 | 3300014497 | Bacteria | 1790 |
| 208 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 209 | Ga0157377_10100293 | 3300014745 | Bacteria | 1724 |
| 210 | Ga0157379_10000301 | 3300014968 | Bacteria | 39095 |
| 211 | Ga0157379_10062580 | 3300014968 | Bacteria | 3328 |
| 212 | Ga0157376_10046256 | 3300014969 | Bacteria | 3588 |
| 213 | Ga0182006_1005503 | 3300015261 | Bacteria | 6027 |
| 214 | Ga0182007_10003488 | 3300015262 | Bacteria | 7402 |
| 215 | Ga0182007_10004544 | 3300015262 | Bacteria | 6271 |
| 216 | Ga0182005_1020985 | 3300015265 | Bacteria | 1794 |
| 217 | Ga0183362_10015 | 3300015683 | Bacteria | 36270 |
| 218 | Ga0163161_10000669 | 3300017792 | Bacteria | 27400 |
| 219 | Ga0163161_10016093 | 3300017792 | Bacteria | 5221 |
| 220 | Ga0163161_10026203 | 3300017792 | Bacteria | 4130 |
| 221 | Ga0163161_10076572 | 3300017792 | Bacteria | 2456 |
| 222 | Ga0209436_106917 | 3300025208 | Bacteria | 2427 |
| 223 | Ga0209672_101344 | 3300025228 | Bacteria | 9266 |
| 224 | Ga0209147_100697 | 3300025229 | Bacteria | 17206 |
| 225 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 226 | Ga0207425_1000696 | 3300025245 | Bacteria | 18207 |
| 227 | Ga0207425_1002191 | 3300025245 | Bacteria | 7109 |
| 228 | Ga0209148_1000183 | 3300025254 | Bacteria | 122620 |
| 229 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 230 | Ga0209129_1005391 | 3300025258 | Bacteria | 4552 |
| 231 | Ga0209565_1000357 | 3300025263 | Bacteria | 39887 |
| 232 | Ga0209565_1000670 | 3300025263 | Bacteria | 21669 |
| 233 | Ga0209565_1001468 | 3300025263 | Bacteria | 10337 |
| 234 | Ga0209565_1001490 | 3300025263 | Bacteria | 10226 |
| 235 | Ga0209673_1000849 | 3300025273 | Bacteria | 39887 |
| 236 | Ga0209673_1004621 | 3300025273 | Bacteria | 7291 |
| 237 | Ga0209130_1000064 | 3300025284 | Bacteria | 196568 |
| 238 | Ga0209130_1001757 | 3300025284 | Bacteria | 12863 |
| 239 | Ga0209130_1002259 | 3300025284 | Bacteria | 9950 |
| 240 | Ga0209675_1000352 | 3300025291 | Bacteria | 39879 |
| 241 | Ga0209675_1006237 | 3300025291 | Bacteria | 4823 |
| 242 | Ga0209675_1008030 | 3300025291 | Bacteria | 3943 |
| 243 | Ga0209675_1011745 | 3300025291 | Bacteria | 2880 |
| 244 | Ga0209675_1019464 | 3300025291 | Bacteria | 1868 |
| 245 | Ga0209675_1021893 | 3300025291 | Bacteria | 1693 |
| 246 | Ga0209676_1000137 | 3300025292 | Bacteria | 179437 |
| 247 | Ga0209676_1000385 | 3300025292 | Bacteria | 81044 |
| 248 | Ga0209676_1000873 | 3300025292 | Bacteria | 38608 |
| 249 | Ga0209676_1008682 | 3300025292 | Bacteria | 4491 |
| 250 | Ga0209676_1014082 | 3300025292 | Bacteria | 3030 |
| 251 | Ga0209676_1020259 | 3300025292 | Bacteria | 2264 |
| 252 | Ga0209025_1000290 | 3300025294 | Bacteria | 113067 |
| 253 | Ga0209025_1000313 | 3300025294 | Bacteria | 107850 |
| 254 | Ga0209025_1004032 | 3300025294 | Bacteria | 13154 |
| 255 | Ga0209025_1005627 | 3300025294 | Bacteria | 10115 |
| 256 | Ga0209025_1014190 | 3300025294 | Bacteria | 4930 |
| 257 | Ga0209025_1017484 | 3300025294 | Bacteria | 4134 |
| 258 | Ga0209025_1031447 | 3300025294 | Bacteria | 2510 |
| 259 | Ga0209025_1035892 | 3300025294 | Bacteria | 2231 |
| 260 | Ga0209564_1001545 | 3300025295 | Bacteria | 22749 |
| 261 | Ga0209564_1005054 | 3300025295 | Bacteria | 7708 |
| 262 | Ga0209564_1009323 | 3300025295 | Bacteria | 4691 |
| 263 | Ga0209564_1014249 | 3300025295 | Bacteria | 3320 |
| 264 | Ga0209564_1031976 | 3300025295 | Bacteria | 1594 |
| 265 | Ga0209758_1000135 | 3300025297 | Bacteria | 177753 |
| 266 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 267 | Ga0209050_1001437 | 3300025298 | Bacteria | 25610 |
| 268 | Ga0209050_1001535 | 3300025298 | Bacteria | 24230 |
| 269 | Ga0209256_1000129 | 3300025299 | Bacteria | 163766 |
| 270 | Ga0209256_1000224 | 3300025299 | Bacteria | 104436 |
| 271 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 272 | Ga0207426_1000171 | 3300025302 | Bacteria | 163766 |
| 273 | Ga0207426_1000185 | 3300025302 | Bacteria | 154146 |
| 274 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 275 | Ga0209051_1000137 | 3300025303 | Bacteria | 137784 |
| 276 | Ga0209051_1000859 | 3300025303 | Bacteria | 30952 |
| 277 | Ga0209051_1001741 | 3300025303 | Bacteria | 17359 |
| 278 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 279 | Ga0209257_1000205 | 3300025304 | Bacteria | 143735 |
| 280 | Ga0209257_1008774 | 3300025304 | Bacteria | 5619 |
| 281 | Ga0209257_1009859 | 3300025304 | Bacteria | 4989 |
| 282 | Ga0209257_1013535 | 3300025304 | Bacteria | 3613 |
| 283 | Ga0207697_10020368 | 3300025315 | Bacteria | 2716 |
| 284 | Ga0207655_1002202 | 3300025728 | Bacteria | 16179 |
| 285 | Ga0207682_10031130 | 3300025893 | Bacteria | 2140 |
| 286 | Ga0207642_10011627 | 3300025899 | Bacteria | 3148 |
| 287 | Ga0207680_10000566 | 3300025903 | Bacteria | 17497 |
| 288 | Ga0207645_10003023 | 3300025907 | Bacteria | 12988 |
| 289 | Ga0207645_10006702 | 3300025907 | Bacteria | 8231 |
| 290 | Ga0207645_10120181 | 3300025907 | Bacteria | 1705 |
| 291 | Ga0207705_10190450 | 3300025909 | Bacteria | 1551 |
| 292 | Ga0207695_10110197 | 3300025913 | Bacteria | 2733 |
| 293 | Ga0207671_10096876 | 3300025914 | Bacteria | 2230 |
| 294 | Ga0207662_10040248 | 3300025918 | Bacteria | 2746 |
| 295 | Ga0207681_10025086 | 3300025923 | Bacteria | 3831 |
| 296 | Ga0207681_10061636 | 3300025923 | Bacteria | 2579 |
| 297 | Ga0207681_10254289 | 3300025923 | Bacteria | 1373 |
| 298 | Ga0207694_10008501 | 3300025924 | Bacteria | 7752 |
| 299 | Ga0207650_10081846 | 3300025925 | Bacteria | 2449 |
| 300 | Ga0207650_10247554 | 3300025925 | Bacteria | 1442 |
| 301 | Ga0207659_10000413 | 3300025926 | Bacteria | 25819 |
| 302 | Ga0207659_10017569 | 3300025926 | Bacteria | 4674 |
| 303 | Ga0207659_10106453 | 3300025926 | Bacteria | 2124 |
| 304 | Ga0207687_10009580 | 3300025927 | Bacteria | 6334 |
| 305 | Ga0207687_10177932 | 3300025927 | Bacteria | 1646 |
| 306 | Ga0207687_10345752 | 3300025927 | Bacteria | 1210 |
| 307 | Ga0207644_10010403 | 3300025931 | Bacteria | 6129 |
| 308 | Ga0207644_10013414 | 3300025931 | Bacteria | 5462 |
| 309 | Ga0207690_10221778 | 3300025932 | Bacteria | 1447 |
| 310 | Ga0207706_10019318 | 3300025933 | Bacteria | 6129 |
| 311 | Ga0207706_10038279 | 3300025933 | Bacteria | 4255 |
| 312 | Ga0207706_10143824 | 3300025933 | Bacteria | 2098 |
| 313 | Ga0207706_10156170 | 3300025933 | Bacteria | 2006 |
| 314 | Ga0207706_10236860 | 3300025933 | Bacteria | 1596 |
| 315 | Ga0207686_10118159 | 3300025934 | Bacteria | 1800 |
| 316 | Ga0207709_10000497 | 3300025935 | Bacteria | 35233 |
| 317 | Ga0207709_10002246 | 3300025935 | Bacteria | 12298 |
| 318 | Ga0207709_10072389 | 3300025935 | Bacteria | 2192 |
| 319 | Ga0207709_10108671 | 3300025935 | Bacteria | 1850 |
| 320 | Ga0207670_10007925 | 3300025936 | Bacteria | 5964 |
| 321 | Ga0207669_10018533 | 3300025937 | Bacteria | 3602 |
| 322 | Ga0207669_10022637 | 3300025937 | Bacteria | 3341 |
| 323 | Ga0207704_10008514 | 3300025938 | Bacteria | 4912 |
| 324 | Ga0207704_10071544 | 3300025938 | Bacteria | 2201 |
| 325 | Ga0207704_10187857 | 3300025938 | Bacteria | 1500 |
| 326 | Ga0207665_10113227 | 3300025939 | Bacteria | 1908 |
| 327 | Ga0207691_10001908 | 3300025940 | Bacteria | 20369 |
| 328 | Ga0207691_10044683 | 3300025940 | Bacteria | 4076 |
| 329 | Ga0207691_10123327 | 3300025940 | Bacteria | 2294 |
| 330 | Ga0207691_10277340 | 3300025940 | Bacteria | 1443 |
| 331 | Ga0207691_10280468 | 3300025940 | Bacteria | 1434 |
| 332 | Ga0207711_10008859 | 3300025941 | Bacteria | 8413 |
| 333 | Ga0207711_10226348 | 3300025941 | Bacteria | 1712 |
| 334 | Ga0207711_10493940 | 3300025941 | Bacteria | 1140 |
| 335 | Ga0207689_10001563 | 3300025942 | Bacteria | 21699 |
| 336 | Ga0207689_10015963 | 3300025942 | Bacteria | 6356 |
| 337 | Ga0207689_10082631 | 3300025942 | Bacteria | 2641 |
| 338 | Ga0207689_10085451 | 3300025942 | Bacteria | 2593 |
| 339 | Ga0207679_10368910 | 3300025945 | Bacteria | 1256 |
| 340 | Ga0207651_10000989 | 3300025960 | Bacteria | 12556 |
| 341 | Ga0207651_10004313 | 3300025960 | Bacteria | 7141 |
| 342 | Ga0207651_10338289 | 3300025960 | Bacteria | 1264 |
| 343 | Ga0207651_10387788 | 3300025960 | Bacteria | 1185 |
| 344 | Ga0207712_10051703 | 3300025961 | Bacteria | 2875 |
| 345 | Ga0207712_10079535 | 3300025961 | Bacteria | 2382 |
| 346 | Ga0207668_10031689 | 3300025972 | Bacteria | 3485 |
| 347 | Ga0207668_10250744 | 3300025972 | Bacteria | 1437 |
| 348 | Ga0207640_10015485 | 3300025981 | Bacteria | 4415 |
| 349 | Ga0207640_10173279 | 3300025981 | Bacteria | 1610 |
| 350 | Ga0207658_10001221 | 3300025986 | Bacteria | 20333 |
| 351 | Ga0207658_10002977 | 3300025986 | Bacteria | 12111 |
| 352 | Ga0207658_10032821 | 3300025986 | Bacteria | 3699 |
| 353 | Ga0207677_10011811 | 3300026023 | Bacteria | 4995 |
| 354 | Ga0207677_10086809 | 3300026023 | Bacteria | 2263 |
| 355 | Ga0207677_10146078 | 3300026023 | Bacteria | 1817 |
| 356 | Ga0207703_10003078 | 3300026035 | Bacteria | 14106 |
| 357 | Ga0207703_10004844 | 3300026035 | Bacteria | 10952 |
| 358 | Ga0207703_10136899 | 3300026035 | Bacteria | 2121 |
| 359 | Ga0207708_10010511 | 3300026075 | Bacteria | 6870 |
| 360 | Ga0207708_10070867 | 3300026075 | Bacteria | 2669 |
| 361 | Ga0207641_10003058 | 3300026088 | Bacteria | 15079 |
| 362 | Ga0207641_10005904 | 3300026088 | Bacteria | 10385 |
| 363 | Ga0207641_10007144 | 3300026088 | Bacteria | 9325 |
| 364 | Ga0207641_10201166 | 3300026088 | Bacteria | 1837 |
| 365 | Ga0207648_10000412 | 3300026089 | Bacteria | 47573 |
| 366 | Ga0207648_10001863 | 3300026089 | Bacteria | 23045 |
| 367 | Ga0207648_10030118 | 3300026089 | Bacteria | 4810 |
| 368 | Ga0207648_10051461 | 3300026089 | Bacteria | 3600 |
| 369 | Ga0207648_10201123 | 3300026089 | Bacteria | 1767 |
| 370 | Ga0207676_10000325 | 3300026095 | Bacteria | 41139 |
| 371 | Ga0207676_10004555 | 3300026095 | Bacteria | 9814 |
| 372 | Ga0207676_10011788 | 3300026095 | Bacteria | 6253 |
| 373 | Ga0207674_10086521 | 3300026116 | Bacteria | 3129 |
| 374 | Ga0207674_10107002 | 3300026116 | Bacteria | 2774 |
| 375 | Ga0207674_10333187 | 3300026116 | Bacteria | 1467 |
| 376 | Ga0207675_100001409 | 3300026118 | Bacteria | 24039 |
| 377 | Ga0207675_100010988 | 3300026118 | Bacteria | 8482 |
| 378 | Ga0207675_100048452 | 3300026118 | Bacteria | 3966 |
| 379 | Ga0207683_10008809 | 3300026121 | Bacteria | 8612 |
| 380 | Ga0207683_10103368 | 3300026121 | Bacteria | 2545 |
| 381 | Ga0207683_10153877 | 3300026121 | Bacteria | 2076 |
| 382 | Ga0207683_10434459 | 3300026121 | Bacteria | 1210 |
| 383 | Ga0207698_10096022 | 3300026142 | Bacteria | 2442 |
| 384 | Ga0209281_1007682 | 3300027111 | Bacteria | 2687 |
| 385 | Ga0209179_1003830 | 3300027512 | Bacteria | 2210 |
| 386 | Ga0209970_1000334 | 3300027614 | Bacteria | 7879 |
| 387 | Ga0209282_1007723 | 3300027666 | Bacteria | 6748 |
| 388 | Ga0209971_1001676 | 3300027682 | Bacteria | 5478 |
| 389 | Ga0209813_10003305 | 3300027866 | Bacteria | 3766 |
| 390 | Ga0209974_10020977 | 3300027876 | Bacteria | 2165 |
| 391 | Ga0268266_10127703 | 3300028379 | Bacteria | 2271 |
| 392 | Ga0268266_10295094 | 3300028379 | Bacteria | 1511 |
| 393 | Ga0268265_10006167 | 3300028380 | Bacteria | 8121 |
| 394 | Ga0268265_10014920 | 3300028380 | Bacteria | 5304 |
| 395 | Ga0268265_10086887 | 3300028380 | Bacteria | 2486 |
| 396 | Ga0268265_10087158 | 3300028380 | Bacteria | 2483 |
| 397 | Ga0268265_10158271 | 3300028380 | Bacteria | 1920 |
| 398 | Ga0268264_10045799 | 3300028381 | Bacteria | 3633 |
| 399 | Ga0268264_10094493 | 3300028381 | Bacteria | 2585 |
| 400 | Ga0307517_10000575 | 3300028786 | Bacteria | 62687 |
| 401 | Ga0307515_10000063 | 3300028794 | Bacteria | 245504 |
| 402 | Ga0307515_10000150 | 3300028794 | Bacteria | 169644 |
| 403 | Ga0307515_10005608 | 3300028794 | Bacteria | 25370 |
| 404 | Ga0307515_10014322 | 3300028794 | Bacteria | 14720 |
| 405 | Ga0307515_10158485 | 3300028794 | Bacteria | 2322 |
| 406 | Ga0307511_10000082 | 3300030521 | Bacteria | 80315 |
| 407 | Ga0307512_10149770 | 3300030522 | Bacteria | 1400 |
| 408 | Ga0316178_1004833 | 3300030735 | Bacteria | 2042 |
| 409 | Ga0316183_1047059 | 3300030742 | Bacteria | 1925 |
| 410 | Ga0265332_10000023 | 3300031238 | Bacteria | 211994 |
| 411 | Ga0265327_10000402 | 3300031251 | Bacteria | 80983 |
| 412 | Ga0265327_10001540 | 3300031251 | Bacteria | 28437 |
| 413 | Ga0265327_10009620 | 3300031251 | Bacteria | 6939 |
| 414 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 415 | Ga0307513_10000991 | 3300031456 | Bacteria | 41018 |
| 416 | Ga0307513_10003892 | 3300031456 | Bacteria | 20086 |
| 417 | Ga0307513_10042874 | 3300031456 | Bacteria | 4976 |
| 418 | Ga0307513_10094269 | 3300031456 | Bacteria | 3039 |
| 419 | Ga0307509_10126413 | 3300031507 | Bacteria | 2521 |
| 420 | Ga0307408_100000873 | 3300031548 | Bacteria | 23699 |
| 421 | Ga0307408_100051285 | 3300031548 | Bacteria | 2971 |
| 422 | Ga0307408_100088075 | 3300031548 | Bacteria | 2337 |
| 423 | Ga0307408_100110099 | 3300031548 | Bacteria | 2114 |
| 424 | Ga0307408_100335824 | 3300031548 | Bacteria | 1277 |
| 425 | Ga0307508_10025941 | 3300031616 | Bacteria | 5314 |
| 426 | Ga0307514_10071442 | 3300031649 | Bacteria | 2603 |
| 427 | Ga0316576_10047064 | 3300031727 | Bacteria | 3124 |
| 428 | Ga0307516_10003416 | 3300031730 | Bacteria | 20413 |
| 429 | Ga0307405_10010080 | 3300031731 | Bacteria | 4875 |
| 430 | Ga0307406_10000831 | 3300031901 | Bacteria | 17357 |
| 431 | Ga0307406_10060373 | 3300031901 | Bacteria | 2444 |
| 432 | Ga0307412_10009966 | 3300031911 | Bacteria | 5465 |
| 433 | Ga0307412_10013346 | 3300031911 | Bacteria | 4814 |
| 434 | Ga0307412_10123223 | 3300031911 | Bacteria | 1870 |
| 435 | Ga0307416_100010499 | 3300032002 | Bacteria | 6120 |
| 436 | Ga0307416_100044766 | 3300032002 | Bacteria | 3478 |
| 437 | Ga0307416_100206220 | 3300032002 | Bacteria | 1870 |
| 438 | Ga0307411_10097694 | 3300032005 | Bacteria | 2068 |
| 439 | Ga0307415_100086696 | 3300032126 | Bacteria | 2253 |
| 440 | Ga0307507_10107478 | 3300033179 | Bacteria | 2299 |
| 441 | Ga0307510_10009118 | 3300033180 | Bacteria | 11811 |
| 442 | Ga0307510_10117023 | 3300033180 | Bacteria | 2384 |
| 443 | Ga0373944_0025365 | 3300035089 | Bacteria | 1744 |
| 444 | Ga0373946_0048795 | 3300035171 | Bacteria | 1764 |
| 445 | Ga0316574_0076370 | 3300035398 | Bacteria | 2122 |
| 446 | Ga0373947_0177837 | 3300035725 | Bacteria | 1384 |
| 447 | Ga0373937_0133717 | 3300036401 | Bacteria | 2318 |
| 448 | Ga0373925_0016509 | 3300037068 | Bacteria | 5349 |
| 449 | Ga0373925_0029091 | 3300037068 | Bacteria | 4053 |
| 450 | Ga0395905_0000027 | 3300037471 | Bacteria | 297239 |
| 451 | Ga0395905_0000042 | 3300037471 | Bacteria | 247894 |
| 452 | Ga0395905_0007865 | 3300037471 | Bacteria | 10559 |
| 453 | Ga0395905_0023905 | 3300037471 | Bacteria | 5769 |
| 454 | Ga0395905_0024594 | 3300037471 | Bacteria | 5683 |
| 455 | Ga0395905_0103882 | 3300037471 | Bacteria | 2667 |
| 456 | Ga0395905_0125407 | 3300037471 | Bacteria | 2414 |
| 457 | Ga0439436_0017493 | 3300041404 | Bacteria | 2144 |
| 458 | Ga0439447_015058 | 3300041407 | Bacteria | 2154 |
| 459 | Ga0439447_021904 | 3300041407 | Bacteria | 1679 |
| 460 | Ga0439453_0000445 | 3300041408 | Bacteria | 4507 |
| 461 | Ga0439461_0013059 | 3300041410 | Bacteria | 1562 |
| 462 | Ga0439466_0014116 | 3300041411 | Bacteria | 2914 |
| 463 | Ga0439466_0020499 | 3300041411 | Bacteria | 2355 |
| 464 | Ga0439465_0027141 | 3300041413 | Bacteria | 1812 |
| 465 | Ga0451793_0428282 | 3300041452 | Bacteria | 1076 |
| 466 | Ga0439433_0010675 | 3300041999 | Bacteria | 2008 |
| 467 | Ga0439441_012683 | 3300042001 | Bacteria | 1450 |
| 468 | Ga0439443_007604 | 3300042003 | Bacteria | 1512 |
| 469 | Ga0439445_0001348 | 3300042004 | Bacteria | 5317 |
| 470 | Ga0439432_018107 | 3300042006 | Bacteria | 2357 |
| 471 | Ga0439432_051632 | 3300042006 | Bacteria | 1281 |
| 472 | Ga0439449_0001315 | 3300042007 | Bacteria | 9735 |
| 473 | Ga0439449_0005741 | 3300042007 | Bacteria | 4745 |
| 474 | Ga0439449_0008350 | 3300042007 | Bacteria | 3938 |
| 475 | Ga0439449_0066413 | 3300042007 | Bacteria | 1330 |
| 476 | Ga0439452_031508 | 3300042010 | Bacteria | 1300 |
| 477 | Ga0439455_0015898 | 3300042012 | Bacteria | 1735 |
| 478 | Ga0439457_002947 | 3300042014 | Bacteria | 4730 |
| 479 | Ga0439457_013800 | 3300042014 | Bacteria | 1813 |
| 480 | Ga0439462_0029960 | 3300042015 | Bacteria | 1439 |
| 481 | Ga0450911_000419 | 3300042115 | Bacteria | 13988 |
| 482 | Ga0450921_000356 | 3300042123 | Bacteria | 2084 |
| 483 | Ga0450906_005723 | 3300042145 | Bacteria | 2538 |
| 484 | Ga0450906_018242 | 3300042145 | Bacteria | 1260 |
| 485 | Ga0439446_0040259 | 3300042156 | Bacteria | 1375 |
| 486 | Ga0439434_0011533 | 3300042435 | Bacteria | 2613 |
| 487 | Ga0439435_0003265 | 3300042436 | Bacteria | 3351 |
| 488 | Ga0439464_0002346 | 3300042439 | Bacteria | 4647 |
| 489 | Ga0450918_001321 | 3300042531 | Bacteria | 4987 |
| 490 | Ga0451577_0292932 | 3300042876 | Bacteria | 1475 |
| 491 | Ga0466969_0010253 | 3300044656 | Bacteria | 4967 |
| 492 | Ga0453683_0029476 | 3300044673 | Bacteria | 3469 |
| 493 | Ga0466965_0045681 | 3300044683 | Bacteria | 2167 |
| 494 | Ga0466966_0035793 | 3300044684 | Bacteria | 3206 |
| 495 | Ga0451576_0235670 | 3300045051 | Bacteria | 1911 |
| 496 | Ga0495627_005871 | 3300046453 | Bacteria | 4881 |
| 497 | Ga0495582_0059884 | 3300046473 | Bacteria | 2101 |
| 498 | Ga0495582_0091480 | 3300046473 | Bacteria | 1697 |
| 499 | Ga0495610_0011528 | 3300046512 | Bacteria | 5396 |
| 500 | Ga0495637_0040036 | 3300046520 | Bacteria | 2019 |
| 501 | Ga0495654_0004374 | 3300046530 | Bacteria | 8405 |
| 502 | Ga0495586_0114556 | 3300046535 | Bacteria | 1503 |
| 503 | Ga0495598_0040159 | 3300046537 | Bacteria | 1363 |
| 504 | Ga0495609_0090454 | 3300046538 | Bacteria | 1331 |
| 505 | Ga0495656_0000047 | 3300046615 | Bacteria | 59690 |
| 506 | Ga0495668_0121194 | 3300046616 | Bacteria | 1431 |
| 507 | Ga0495625_0000360 | 3300046660 | Bacteria | 69587 |
| 508 | Ga0495625_0011275 | 3300046660 | Bacteria | 7307 |
| 509 | Ga0495625_0056546 | 3300046660 | Bacteria | 2792 |
| 510 | Ga0495625_0174063 | 3300046660 | Bacteria | 1435 |
| 511 | Ga0495588_0105831 | 3300046674 | Bacteria | 1480 |
| 512 | Ga0495588_0154202 | 3300046674 | Bacteria | 1214 |
| 513 | Ga0495658_0090841 | 3300046683 | Bacteria | 1808 |
| 514 | Ga0495649_0005389 | 3300046694 | Bacteria | 8144 |
| 515 | Ga0495676_0060279 | 3300047321 | Bacteria | 2975 |
| 516 | Ga0495687_005310 | 3300047443 | Bacteria | 8260 |
| 517 | Ga0495614_0009304 | 3300048089 | Bacteria | 4347 |
| 518 | Ga0495615_0020198 | 3300048090 | Bacteria | 1489 |
| 519 | Ga0496101_0012749 | 3300048904 | Bacteria | 5619 |
| 520 | Ga0496101_0048044 | 3300048904 | Bacteria | 3065 |
| 521 | Ga0496102_0067915 | 3300048905 | Bacteria | 3270 |
| 522 | Ga0496102_0188930 | 3300048905 | Bacteria | 1941 |
| 523 | Ga0496104_0088892 | 3300048907 | Bacteria | 2951 |
| 524 | Ga0496105_0066379 | 3300048908 | Bacteria | 2978 |
| 525 | Ga0496105_0067270 | 3300048908 | Bacteria | 2958 |
| 526 | Ga0496106_0017056 | 3300048909 | Bacteria | 5375 |
| 527 | Ga0496106_0105211 | 3300048909 | Bacteria | 2193 |
| 528 | Ga0496108_0091338 | 3300048911 | Bacteria | 2588 |
| 529 | Ga0496109_0080833 | 3300048912 | Bacteria | 2995 |
| 530 | Ga0496110_0127250 | 3300048913 | Bacteria | 2299 |
| 531 | Ga0496114_0103630 | 3300048917 | Bacteria | 2432 |
| 532 | Ga0496116_0017638 | 3300048919 | Bacteria | 5532 |
| 533 | Ga0496116_0021627 | 3300048919 | Bacteria | 4843 |
| 534 | Ga0496117_0018643 | 3300048920 | Bacteria | 5738 |
| 535 | Ga0496117_0025305 | 3300048920 | Bacteria | 4669 |
| 536 | Ga0496117_0113310 | 3300048920 | Bacteria | 1684 |
| 537 | Ga0496118_0005780 | 3300048921 | Bacteria | 13891 |
| 538 | Ga0496121_0002801 | 3300048924 | Bacteria | 25834 |
| 539 | Ga0496121_0013215 | 3300048924 | Bacteria | 8896 |
| 540 | Ga0496121_0042409 | 3300048924 | Bacteria | 3958 |
| 541 | Ga0496122_0069155 | 3300048925 | Bacteria | 2531 |
| 542 | Ga0496123_0146868 | 3300048926 | Bacteria | 1279 |
| 543 | Ga0496124_0147685 | 3300048927 | Bacteria | 1848 |
| 544 | Ga0496125_0002671 | 3300048928 | Bacteria | 22776 |
| 545 | Ga0496125_0014838 | 3300048928 | Bacteria | 7567 |
| 546 | Ga0496125_0021834 | 3300048928 | Bacteria | 5957 |
| 547 | Ga0496125_0061001 | 3300048928 | Bacteria | 3027 |
| 548 | Ga0496125_0086771 | 3300048928 | Bacteria | 2365 |
| 549 | Ga0496126_0321916 | 3300048929 | Bacteria | 1271 |
| 550 | Ga0501031_0043130 | 3300049568 | Bacteria | 2945 |
| 551 | Ga0501034_0227138 | 3300049571 | Bacteria | 1817 |
| 552 | Ga0501249_003565 | 3300049679 | Bacteria | 3128 |
| 553 | Ga0501225_0003789 | 3300049705 | Bacteria | 4544 |
| 554 | nmdc:mga03683_10371_c1 | 3300050489 | Bacteria | 3340 |
| 555 | nmdc:mga03683_21049_c1 | 3300050489 | Bacteria | 2509 |
| 556 | nmdc:mga03683_6421_c1 | 3300050489 | Bacteria | 4024 |
| 557 | nmdc:mga03683_70702_c1 | 3300050489 | Bacteria | 1491 |
| 558 | nmdc:mga03683_74745_c1 | 3300050489 | Bacteria | 1454 |
| 559 | nmdc:mga03n38_184772_c1 | 3300050490 | Bacteria | 1070 |
| 560 | nmdc:mga00v17_144307_c1 | 3300050491 | Bacteria | 1528 |
| 561 | nmdc:mga00v17_19953_c1 | 3300050491 | Bacteria | 3834 |
| 562 | nmdc:mga0yw44_7818_c1 | 3300050492 | Bacteria | 5290 |
| 563 | nmdc:mga0k408_13401_c1 | 3300050493 | Bacteria | 4495 |
| 564 | nmdc:mga0k408_141384_c1 | 3300050493 | Bacteria | 1432 |
| 565 | nmdc:mga0k408_14774_c1 | 3300050493 | Bacteria | 4308 |
| 566 | nmdc:mga0k408_39477_c1 | 3300050493 | Bacteria | 2713 |
| 567 | nmdc:mga0k408_51651_c1 | 3300050493 | Bacteria | 2382 |
| 568 | nmdc:mga0k408_5868_c1 | 3300050493 | Bacteria | 6544 |
| 569 | nmdc:mga0k408_6926_c1 | 3300050493 | Bacteria | 6046 |
| 570 | nmdc:mga0k408_79998_c1 | 3300050493 | Bacteria | 1912 |
| 571 | nmdc:mga06z11_146377_c1 | 3300050494 | Bacteria | 1339 |
| 572 | nmdc:mga06z11_81246_c1 | 3300050494 | Bacteria | 1740 |
| 573 | nmdc:mga04h51_14787_c1 | 3300050495 | Bacteria | 2238 |
| 574 | nmdc:mga07m45_11400_c1 | 3300050496 | Bacteria | 4669 |
| 575 | nmdc:mga07m45_131044_c1 | 3300050496 | Bacteria | 1451 |
| 576 | nmdc:mga07m45_20133_c1 | 3300050496 | Bacteria | 3622 |
| 577 | nmdc:mga07m45_25742_c1 | 3300050496 | Bacteria | 3229 |
| 578 | nmdc:mga07m45_32352_c1 | 3300050496 | Bacteria | 2134 |
| 579 | nmdc:mga07m45_36240_c1 | 3300050496 | Bacteria | 2747 |
| 580 | nmdc:mga07m45_61715_c1 | 3300050496 | Bacteria | 2124 |
| 581 | nmdc:mga07m45_8902_c1 | 3300050496 | Bacteria | 5183 |
| 582 | nmdc:mga05p37_58073_c1 | 3300050507 | Bacteria | 4765 |
| 583 | nmdc:mga09592_101130_c1 | 3300050508 | Bacteria | 2469 |
| 584 | nmdc:mga0qj67_325226_c1 | 3300050509 | Bacteria | 1245 |
| 585 | nmdc:mga0qj67_851_c1 | 3300050509 | Bacteria | 20946 |
| 586 | nmdc:mga0sz30_21518_c1 | 3300050516 | Bacteria | 2611 |
| 587 | nmdc:mga0sz30_8040_c1 | 3300050516 | Bacteria | 3973 |
| 588 | Ga0500610_0004579 | 3300053079 | Bacteria | 5519 |
| 589 | Ga0500610_0006383 | 3300053079 | Bacteria | 4938 |
| 590 | Ga0500644_0014012 | 3300053088 | Bacteria | 2253 |
| 591 | Ga0500646_0001449 | 3300053090 | Bacteria | 6280 |
| 592 | Ga0500583_0013199 | 3300053092 | Bacteria | 3186 |
| 593 | Ga0500651_0000169 | 3300053093 | Bacteria | 42653 |
| 594 | Ga0500651_0038181 | 3300053093 | Bacteria | 3026 |
| 595 | Ga0500650_0055005 | 3300053098 | Bacteria | 1853 |
| 596 | Ga0500571_003984 | 3300053110 | Bacteria | 7698 |
| 597 | Ga0500594_0030322 | 3300053118 | Bacteria | 1419 |
| 598 | Ga0500607_010031 | 3300053121 | Bacteria | 5669 |
| 599 | Ga0500607_074334 | 3300053121 | Bacteria | 1747 |
| 600 | Ga0500608_006441 | 3300053122 | Bacteria | 4779 |
| 601 | Ga0500655_006786 | 3300053133 | Bacteria | 2060 |
| 602 | Ga0500658_0001494 | 3300053134 | Bacteria | 9361 |
| 603 | Ga0500658_0003092 | 3300053134 | Bacteria | 6357 |
| 604 | Ga0500559_0000339 | 3300053136 | Bacteria | 35031 |
| 605 | Ga0500568_0002114 | 3300053139 | Bacteria | 11996 |
| 606 | Ga0500574_006630 | 3300053141 | Bacteria | 2345 |
| 607 | Ga0500588_0026567 | 3300053146 | Bacteria | 1621 |
| 608 | Ga0500616_0044193 | 3300053153 | Bacteria | 2377 |
| 609 | Ga0500622_0018453 | 3300053156 | Bacteria | 3709 |
| 610 | Ga0500634_0037851 | 3300053161 | Bacteria | 2623 |
| 611 | Ga0500638_044852 | 3300053162 | Bacteria | 2145 |
| 612 | Ga0500645_000657 | 3300053730 | Bacteria | 21741 |
| 613 | 2511243526 | 2511231002 | Bacteria | 5042903 |
| 614 | 2513227334 | 2513020051 | Bacteria | 6053213 |
| 615 | 2548499287 | 2547132374 | Bacteria | 5530232 |
| 616 | 2599627101 | 2599185214 | Bacteria | 8209958 |
| 617 | 2599676538 | 2599185226 | Bacteria | 8233575 |
| 618 | 2599684806 | 2599185227 | Bacteria | 8246414 |
| 619 | 2599696758 | 2599185229 | Bacteria | 8216126 |
| 620 | 2643866120 | 2643221570 | Bacteria | 5103772 |
| 621 | 2643994110 | 2643221596 | Bacteria | 5006805 |
| 622 | 2644057656 | 2643221609 | Bacteria | 6756331 |
| 623 | 2644072257 | 2643221611 | Bacteria | 6820941 |
| 624 | 2644160062 | 2643221628 | Bacteria | 5745828 |
| 625 | 2644292934 | 2643221652 | Bacteria | 5140275 |
| 626 | 2644302030 | 2643221654 | Bacteria | 5273570 |
| 627 | 2644329451 | 2643221658 | Bacteria | 6064537 |
| 628 | 2644401027 | 2643221672 | Bacteria | 6322190 |
| 629 | 2644464277 | 2643221683 | Bacteria | 5749203 |
| 630 | 2644466352 | 2643221683 | Bacteria | 5749203 |
| 631 | 2644647950 | 2643221717 | Bacteria | 5676132 |
| 632 | 2738723459 | 2738541277 | Bacteria | 7458140 |
| 633 | 2738882241 | 2738541307 | Bacteria | 8606193 |
| 634 | 2739241930 | 2738543012 | Bacteria | 7115078 |
| 635 | 2739251219 | 2738543013 | Bacteria | 5618633 |
| 636 | 2739284190 | 2738543019 | Bacteria | 7459457 |
| 637 | 2816470768 | 2816332133 | Bacteria | 7249298 |
| 638 | 2819598170 | 2818991446 | Bacteria | 7757362 |
| 639 | 2831269157 | 2831265667 | Bacteria | 7184833 |
| 640 | 2838058587 | 2838054893 | Bacteria | 7451788 |
| 641 | 2842682426 | 2842677519 | Bacteria | 5615038 |
| 642 | 2885196442 | 2885192300 | Bacteria | 5882526 |
| 643 | 2885200022 | 2885198086 | Bacteria | 7212419 |
| 644 | 2885213748 | 2885211737 | Bacteria | 7212420 |
| 645 | 2899929592 | 2899924645 | Bacteria | 7487985 |
| 646 | 2904456405 | 2904449895 | Bacteria | 6927402 |
| 647 | 2904462914 | 2904456579 | Bacteria | 6819253 |
| 648 | 2904549062 | 2904541872 | Bacteria | 8915136 |
| 649 | 2919465832 | 2919462493 | Bacteria | 5817112 |
| 650 | 2919706166 | 2919704043 | Bacteria | 5560311 |
| 651 | 2928039965 | 2928037797 | Bacteria | 7273642 |
| 652 | 2928047286 | 2928044640 | Bacteria | 7271509 |
| 653 | 2928057510 | 2928051484 | Bacteria | 7773759 |
| 654 | 2928068104 | 2928064002 | Bacteria | 7419480 |
| 655 | 2928072689 | 2928070936 | Bacteria | 8062541 |
| 656 | 2928085852 | 2928084124 | Bacteria | 7159212 |
| 657 | 2928120191 | 2928115317 | Bacteria | 6477646 |
| 658 | 2929160690 | 2929160207 | Bacteria | 9075316 |
| 659 | 2929523769 | 2929520902 | Bacteria | 6765052 |
| 660 | 2939634122 | 2939631187 | Bacteria | 6118131 |
| 661 | 2945914814 | 2945909444 | Bacteria | 7065066 |
| 662 | 2945951121 | 2945945610 | Bacteria | 5951079 |
| 663 | 2945974221 | 2945972063 | Bacteria | 6086495 |
| 664 | 2945989787 | 2945984333 | Bacteria | 7358892 |
| 665 | 2990714175 | 2990710928 | Bacteria | 5002431 |
| 666 | Ga0439436_0002401 | |||
| 667 | JGI25159J45721_1000390 | |||
| 668 | JGI25159J45721_1009932 | |||
| 669 | JGI25151J46595_10001225 | |||
| 670 | JGI25151J46595_10006750 | |||
| 671 | JGI25160J50197_1000587 | |||
| 672 | JGI25160J50197_1015577 | |||
| 673 | JGI25161J50226_1000046 | |||
| 674 | JGI25161J50226_1003345 | |||
| 675 | JGI25161J50226_1004119 | |||
| 676 | Ga0055535_1000168 | |||
| 677 | Ga0055542_1000214 | |||
| 678 | Ga0055526_1001336 | |||
| 679 | Ga0055526_1015004 | |||
| 680 | Ga0055526_1019305 | |||
| 681 | Ga0055537_1000333 | |||
| 682 | Ga0055536_1004071 | |||
| 683 | Ga0055536_1006559 | |||
| 684 | Ga0055536_1013076 | |||
| 685 | Ga0055534_1000265 | |||
| 686 | Ga0055534_1003619 | |||
| 687 | Ga0055528_1000471 | |||
| 688 | Ga0055530_10001300 | |||
| 689 | Ga0055540_1002601 | |||
| 690 | Ga0055540_1003978 | |||
| 691 | Ga0055540_1013665 | |||
| 692 | Ga0055531_10000572 | |||
| 693 | Ga0055531_10021507 | |||
| 694 | Ga0055543_1000270 | |||
| 695 | Ga0055543_1005877 | |||
| 696 | Ga0065165_1004394 | |||
| 697 | Ga0065165_1008423 | |||
| 698 | Ga0065714_10017429 | |||
| 699 | Ga0065714_10080960 | |||
| 700 | Ga0065704_10071856 | |||
| 701 | Ga0065704_10085617 | |||
| 702 | Ga0065707_10106764 | |||
| 703 | Ga0070676_10005696 | |||
| 704 | Ga0070670_100002652 | |||
| 705 | Ga0070670_100027701 | |||
| 706 | Ga0070670_100123525 | |||
| 707 | Ga0070670_100148216 | |||
| 708 | Ga0070677_10036034 | |||
| 709 | Ga0068869_100012209 | |||
| 710 | Ga0068869_100066228 | |||
| 711 | Ga0068869_100141443 | |||
| 712 | Ga0070666_10085581 | |||
| 713 | Ga0068868_100012831 | |||
| 714 | Ga0068868_100024677 | |||
| 715 | Ga0070689_100049223 | |||
| 716 | Ga0070687_100078289 | |||
| 717 | Ga0070668_100042712 | |||
| 718 | Ga0070668_100182609 | |||
| 719 | Ga0070669_100122845 | |||
| 720 | Ga0070675_100000243 | |||
| 721 | Ga0070675_100003727 | |||
| 722 | Ga0070675_100029315 | |||
| 723 | Ga0070675_100049676 | |||
| 724 | Ga0070675_100167953 | |||
| 725 | Ga0070671_100006003 | |||
| 726 | Ga0070671_100221576 | |||
| 727 | Ga0070673_100010639 | |||
| 728 | Ga0070673_100225270 | |||
| 729 | Ga0070673_100314204 | |||
| 730 | Ga0070667_100010689 | |||
| 731 | Ga0070667_100045883 | |||
| 732 | Ga0070667_100066289 | |||
| 733 | Ga0070667_100094495 | |||
| 734 | Ga0070667_100209868 | |||
| 735 | Ga0070678_100003356 | |||
| 736 | Ga0070678_100065650 | |||
| 737 | Ga0070678_100078872 | |||
| 738 | Ga0070678_100169210 | |||
| 739 | Ga0070662_100004403 | |||
| 740 | Ga0070662_100011286 | |||
| 741 | Ga0070662_100034829 | |||
| 742 | Ga0068867_100001303 | |||
| 743 | Ga0068867_100010378 | |||
| 744 | Ga0068867_100062429 | |||
| 745 | Ga0070685_10125285 | |||
| 746 | Ga0070706_100263470 | |||
| 747 | Ga0070672_100002056 | |||
| 748 | Ga0070672_100004518 | |||
| 749 | Ga0070672_100013934 | |||
| 750 | Ga0070672_100043606 | |||
| 751 | Ga0070672_100308954 | |||
| 752 | Ga0070665_100040676 | |||
| 753 | Ga0070664_100162821 | |||
| 754 | Ga0070664_100281773 | |||
| 755 | Ga0068857_100064216 | |||
| 756 | Ga0068857_100194812 | |||
| 757 | Ga0068857_100206267 | |||
| 758 | Ga0068854_100033089 | |||
| 759 | Ga0068854_100092842 | |||
| 760 | Ga0068854_100208643 | |||
| 761 | Ga0068854_100246885 | |||
| 762 | Ga0068859_100000664 | |||
| 763 | Ga0068864_100000649 | |||
| 764 | Ga0068864_100002170 | |||
| 765 | Ga0068864_100012522 | |||
| 766 | Ga0068866_10002429 | |||
| 767 | Ga0068866_10012183 | |||
| 768 | Ga0068861_100056642 | |||
| 769 | Ga0068861_100301240 | |||
| 770 | Ga0068851_10031521 | |||
| 771 | Ga0068863_100029931 | |||
| 772 | Ga0068863_100085517 | |||
| 773 | Ga0068863_100260196 | |||
| 774 | Ga0068858_100000753 | |||
| 775 | Ga0068858_100001308 | |||
| 776 | Ga0068860_100002605 | |||
| 777 | Ga0068860_100002764 | |||
| 778 | Ga0068860_100005264 | |||
| 779 | Ga0068862_100163419 | |||
| 780 | Ga0068862_100201791 | |||
| 781 | Ga0081455_10089108 | |||
| 782 | Ga0075365_10012259 | |||
| 783 | Ga0075365_10104328 | |||
| 784 | Ga0075365_10128389 | |||
| 785 | Ga0075365_10185421 | |||
| 786 | Ga0075365_10199188 | |||
| 787 | Ga0075368_10004034 | |||
| 788 | Ga0075363_100005537 | |||
| 789 | Ga0075363_100041448 | |||
| 790 | Ga0075363_100043855 | |||
| 791 | Ga0075364_10005816 | |||
| 792 | Ga0075364_10033290 | |||
| 793 | Ga0075364_10053443 | |||
| 794 | Ga0075432_10012307 | |||
| 795 | Ga0070716_100197628 | |||
| 796 | Ga0075362_10007426 | |||
| 797 | Ga0075362_10050019 | |||
| 798 | Ga0075367_10072773 | |||
| 799 | Ga0075367_10079223 | |||
| 800 | Ga0075369_10057668 | |||
| 801 | Ga0075366_10004449 | |||
| 802 | Ga0075366_10004609 | |||
| 803 | Ga0075366_10007302 | |||
| 804 | Ga0075366_10023123 | |||
| 805 | Ga0075366_10035706 | |||
| 806 | Ga0075366_10036931 | |||
| 807 | Ga0097621_100018401 | |||
| 808 | Ga0097621_100030835 | |||
| 809 | Ga0097621_100346637 | |||
| 810 | Ga0075370_10000228 | |||
| 811 | Ga0075370_10003908 | |||
| 812 | Ga0075370_10007388 | |||
| 813 | Ga0075370_10008651 | |||
| 814 | Ga0075370_10029533 | |||
| 815 | Ga0075370_10047414 | |||
| 816 | Ga0075370_10116276 | |||
| 817 | Ga0075430_100000318 | |||
| 818 | Ga0075430_100114647 | |||
| 819 | Ga0075431_100340803 | |||
| 820 | Ga0068865_100002181 | |||
| 821 | Ga0068865_100086459 | |||
| 822 | Ga0068865_100296017 | |||
| 823 | Ga0097620_100000664 | |||
| 824 | Ga0079104_1005414 | |||
| 825 | Ga0099826_10005686 | |||
| 826 | Ga0105244_10007097 | |||
| 827 | Ga0105244_10082806 | |||
| 828 | Ga0105240_10158043 | |||
| 829 | Ga0105245_10028047 | |||
| 830 | Ga0105245_10061457 | |||
| 831 | Ga0105245_10138678 | |||
| 832 | Ga0114129_10307032 | |||
| 833 | Ga0105243_10001208 | |||
| 834 | Ga0105243_10007703 | |||
| 835 | Ga0105243_10013939 | |||
| 836 | Ga0105243_10171051 | |||
| 837 | Ga0105243_10393137 | |||
| 838 | Ga0105248_10011097 | |||
| 839 | Ga0105248_10577210 | |||
| 840 | Ga0105248_10600103 | |||
| 841 | Ga0105238_10191826 | |||
| 842 | Ga0105249_10035236 | |||
| 843 | Ga0105239_10064107 | |||
| 844 | Ga0105246_10089187 | |||
| 845 | Ga0105246_10111627 | |||
| 846 | Ga0105246_10114497 | |||
| 847 | Ga0105246_10275131 | |||
| 848 | Ga0157347_1001782 | |||
| 849 | Ga0157373_10012523 | |||
| 850 | Ga0157373_10141198 | |||
| 851 | Ga0157373_10241855 | |||
| 852 | Ga0157370_10173203 | |||
| 853 | Ga0157369_10021938 | |||
| 854 | Ga0157374_10371824 | |||
| 855 | Ga0157378_10004511 | |||
| 856 | Ga0157378_10010562 | |||
| 857 | Ga0157378_10107814 | |||
| 858 | Ga0157378_10189611 | |||
| 859 | Ga0163162_10004677 | |||
| 860 | Ga0163162_10021485 | |||
| 861 | Ga0163162_10296163 | |||
| 862 | Ga0163162_10449355 | |||
| 863 | Ga0157372_10489617 | |||
| 864 | Ga0157375_10143305 | |||
| 865 | Ga0157375_10236213 | |||
| 866 | Ga0157375_10367627 | |||
| 867 | Ga0157375_10421836 | |||
| 868 | Ga0163163_10003252 | |||
| 869 | Ga0163163_10198961 | |||
| 870 | Ga0163163_10408160 | |||
| 871 | Ga0157380_10028571 | |||
| 872 | Ga0182008_10065342 | |||
| 873 | Ga0157377_10000016 | |||
| 874 | Ga0157377_10100293 | |||
| 875 | Ga0157379_10000301 | |||
| 876 | Ga0157379_10062580 | |||
| 877 | Ga0157376_10046256 | |||
| 878 | Ga0182006_1005503 | |||
| 879 | Ga0182007_10003488 | |||
| 880 | Ga0182007_10004544 | |||
| 881 | Ga0182005_1020985 | |||
| 882 | Ga0183362_10015 | |||
| 883 | Ga0163161_10000669 | |||
| 884 | Ga0163161_10016093 | |||
| 885 | Ga0163161_10026203 | |||
| 886 | Ga0163161_10076572 | |||
| 887 | Ga0209436_106917 | |||
| 888 | Ga0209672_101344 | |||
| 889 | Ga0209147_100697 | |||
| 890 | Ga0209258_100015 | |||
| 891 | Ga0207425_1000696 | |||
| 892 | Ga0207425_1002191 | |||
| 893 | Ga0209148_1000183 | |||
| 894 | Ga0209129_1000049 | |||
| 895 | Ga0209129_1005391 | |||
| 896 | Ga0209565_1000357 | |||
| 897 | Ga0209565_1000670 | |||
| 898 | Ga0209565_1001468 | |||
| 899 | Ga0209565_1001490 | |||
| 900 | Ga0209673_1000849 | |||
| 901 | Ga0209673_1004621 | |||
| 902 | Ga0209130_1000064 | |||
| 903 | Ga0209130_1001757 | |||
| 904 | Ga0209130_1002259 | |||
| 905 | Ga0209675_1000352 | |||
| 906 | Ga0209675_1006237 | |||
| 907 | Ga0209675_1008030 | |||
| 908 | Ga0209675_1011745 | |||
| 909 | Ga0209675_1019464 | |||
| 910 | Ga0209675_1021893 | |||
| 911 | Ga0209676_1000137 | |||
| 912 | Ga0209676_1000385 | |||
| 913 | Ga0209676_1000873 | |||
| 914 | Ga0209676_1008682 | |||
| 915 | Ga0209676_1014082 | |||
| 916 | Ga0209676_1020259 | |||
| 917 | Ga0209025_1000290 | |||
| 918 | Ga0209025_1000313 | |||
| 919 | Ga0209025_1004032 | |||
| 920 | Ga0209025_1005627 | |||
| 921 | Ga0209025_1014190 | |||
| 922 | Ga0209025_1017484 | |||
| 923 | Ga0209025_1031447 | |||
| 924 | Ga0209025_1035892 | |||
| 925 | Ga0209564_1001545 | |||
| 926 | Ga0209564_1005054 | |||
| 927 | Ga0209564_1009323 | |||
| 928 | Ga0209564_1014249 | |||
| 929 | Ga0209564_1031976 | |||
| 930 | Ga0209758_1000135 | |||
| 931 | Ga0209050_1000015 | |||
| 932 | Ga0209050_1001437 | |||
| 933 | Ga0209050_1001535 | |||
| 934 | Ga0209256_1000129 | |||
| 935 | Ga0209256_1000224 | |||
| 936 | Ga0207426_1000062 | |||
| 937 | Ga0207426_1000171 | |||
| 938 | Ga0207426_1000185 | |||
| 939 | Ga0209051_1000010 | |||
| 940 | Ga0209051_1000137 | |||
| 941 | Ga0209051_1000859 | |||
| 942 | Ga0209051_1001741 | |||
| 943 | Ga0209257_1000026 | |||
| 944 | Ga0209257_1000205 | |||
| 945 | Ga0209257_1008774 | |||
| 946 | Ga0209257_1009859 | |||
| 947 | Ga0209257_1013535 | |||
| 948 | Ga0207697_10020368 | |||
| 949 | Ga0207655_1002202 | |||
| 950 | Ga0207682_10031130 | |||
| 951 | Ga0207642_10011627 | |||
| 952 | Ga0207680_10000566 | |||
| 953 | Ga0207645_10003023 | |||
| 954 | Ga0207645_10006702 | |||
| 955 | Ga0207645_10120181 | |||
| 956 | Ga0207705_10190450 | |||
| 957 | Ga0207695_10110197 | |||
| 958 | Ga0207671_10096876 | |||
| 959 | Ga0207662_10040248 | |||
| 960 | Ga0207681_10025086 | |||
| 961 | Ga0207681_10061636 | |||
| 962 | Ga0207681_10254289 | |||
| 963 | Ga0207694_10008501 | |||
| 964 | Ga0207650_10081846 | |||
| 965 | Ga0207650_10247554 | |||
| 966 | Ga0207659_10000413 | |||
| 967 | Ga0207659_10017569 | |||
| 968 | Ga0207659_10106453 | |||
| 969 | Ga0207687_10009580 | |||
| 970 | Ga0207687_10177932 | |||
| 971 | Ga0207687_10345752 | |||
| 972 | Ga0207644_10010403 | |||
| 973 | Ga0207644_10013414 | |||
| 974 | Ga0207690_10221778 | |||
| 975 | Ga0207706_10019318 | |||
| 976 | Ga0207706_10038279 | |||
| 977 | Ga0207706_10143824 | |||
| 978 | Ga0207706_10156170 | |||
| 979 | Ga0207706_10236860 | |||
| 980 | Ga0207686_10118159 | |||
| 981 | Ga0207709_10000497 | |||
| 982 | Ga0207709_10002246 | |||
| 983 | Ga0207709_10072389 | |||
| 984 | Ga0207709_10108671 | |||
| 985 | Ga0207670_10007925 | |||
| 986 | Ga0207669_10018533 | |||
| 987 | Ga0207669_10022637 | |||
| 988 | Ga0207704_10008514 | |||
| 989 | Ga0207704_10071544 | |||
| 990 | Ga0207704_10187857 | |||
| 991 | Ga0207665_10113227 | |||
| 992 | Ga0207691_10001908 | |||
| 993 | Ga0207691_10044683 | |||
| 994 | Ga0207691_10123327 | |||
| 995 | Ga0207691_10277340 | |||
| 996 | Ga0207691_10280468 | |||
| 997 | Ga0207711_10008859 | |||
| 998 | Ga0207711_10226348 | |||
| 999 | Ga0207711_10493940 | |||
| 1000 | Ga0207689_10001563 | |||
| 1001 | Ga0207689_10015963 | |||
| 1002 | Ga0207689_10082631 | |||
| 1003 | Ga0207689_10085451 | |||
| 1004 | Ga0207679_10368910 | |||
| 1005 | Ga0207651_10000989 | |||
| 1006 | Ga0207651_10004313 | |||
| 1007 | Ga0207651_10338289 | |||
| 1008 | Ga0207651_10387788 | |||
| 1009 | Ga0207712_10051703 | |||
| 1010 | Ga0207712_10079535 | |||
| 1011 | Ga0207668_10031689 | |||
| 1012 | Ga0207668_10250744 | |||
| 1013 | Ga0207640_10015485 | |||
| 1014 | Ga0207640_10173279 | |||
| 1015 | Ga0207658_10001221 | |||
| 1016 | Ga0207658_10002977 | |||
| 1017 | Ga0207658_10032821 | |||
| 1018 | Ga0207677_10011811 | |||
| 1019 | Ga0207677_10086809 | |||
| 1020 | Ga0207677_10146078 | |||
| 1021 | Ga0207703_10003078 | |||
| 1022 | Ga0207703_10004844 | |||
| 1023 | Ga0207703_10136899 | |||
| 1024 | Ga0207708_10010511 | |||
| 1025 | Ga0207708_10070867 | |||
| 1026 | Ga0207641_10003058 | |||
| 1027 | Ga0207641_10005904 | |||
| 1028 | Ga0207641_10007144 | |||
| 1029 | Ga0207641_10201166 | |||
| 1030 | Ga0207648_10000412 | |||
| 1031 | Ga0207648_10001863 | |||
| 1032 | Ga0207648_10030118 | |||
| 1033 | Ga0207648_10051461 | |||
| 1034 | Ga0207648_10201123 | |||
| 1035 | Ga0207676_10000325 | |||
| 1036 | Ga0207676_10004555 | |||
| 1037 | Ga0207676_10011788 | |||
| 1038 | Ga0207674_10086521 | |||
| 1039 | Ga0207674_10107002 | |||
| 1040 | Ga0207674_10333187 | |||
| 1041 | Ga0207675_100001409 | |||
| 1042 | Ga0207675_100010988 | |||
| 1043 | Ga0207675_100048452 | |||
| 1044 | Ga0207683_10008809 | |||
| 1045 | Ga0207683_10103368 | |||
| 1046 | Ga0207683_10153877 | |||
| 1047 | Ga0207683_10434459 | |||
| 1048 | Ga0207698_10096022 | |||
| 1049 | Ga0209281_1007682 | |||
| 1050 | Ga0209179_1003830 | |||
| 1051 | Ga0209970_1000334 | |||
| 1052 | Ga0209282_1007723 | |||
| 1053 | Ga0209971_1001676 | |||
| 1054 | Ga0209813_10003305 | |||
| 1055 | Ga0209974_10020977 | |||
| 1056 | Ga0268266_10127703 | |||
| 1057 | Ga0268266_10295094 | |||
| 1058 | Ga0268265_10006167 | |||
| 1059 | Ga0268265_10014920 | |||
| 1060 | Ga0268265_10086887 | |||
| 1061 | Ga0268265_10087158 | |||
| 1062 | Ga0268265_10158271 | |||
| 1063 | Ga0268264_10045799 | |||
| 1064 | Ga0268264_10094493 | |||
| 1065 | Ga0307517_10000575 | |||
| 1066 | Ga0307515_10000063 | |||
| 1067 | Ga0307515_10000150 | |||
| 1068 | Ga0307515_10005608 | |||
| 1069 | Ga0307515_10014322 | |||
| 1070 | Ga0307515_10158485 | |||
| 1071 | Ga0307511_10000082 | |||
| 1072 | Ga0307512_10149770 | |||
| 1073 | Ga0316178_1004833 | |||
| 1074 | Ga0316183_1047059 | |||
| 1075 | Ga0265332_10000023 | |||
| 1076 | Ga0265327_10000402 | |||
| 1077 | Ga0265327_10001540 | |||
| 1078 | Ga0265327_10009620 | |||
| 1079 | Ga0307513_10000008 | |||
| 1080 | Ga0307513_10000991 | |||
| 1081 | Ga0307513_10003892 | |||
| 1082 | Ga0307513_10042874 | |||
| 1083 | Ga0307513_10094269 | |||
| 1084 | Ga0307509_10126413 | |||
| 1085 | Ga0307408_100000873 | |||
| 1086 | Ga0307408_100051285 | |||
| 1087 | Ga0307408_100088075 | |||
| 1088 | Ga0307408_100110099 | |||
| 1089 | Ga0307408_100335824 | |||
| 1090 | Ga0307508_10025941 | |||
| 1091 | Ga0307514_10071442 | |||
| 1092 | Ga0316576_10047064 | |||
| 1093 | Ga0307516_10003416 | |||
| 1094 | Ga0307405_10010080 | |||
| 1095 | Ga0307406_10000831 | |||
| 1096 | Ga0307406_10060373 | |||
| 1097 | Ga0307412_10009966 | |||
| 1098 | Ga0307412_10013346 | |||
| 1099 | Ga0307412_10123223 | |||
| 1100 | Ga0307416_100010499 | |||
| 1101 | Ga0307416_100044766 | |||
| 1102 | Ga0307416_100206220 | |||
| 1103 | Ga0307411_10097694 | |||
| 1104 | Ga0307415_100086696 | |||
| 1105 | Ga0307507_10107478 | |||
| 1106 | Ga0307510_10009118 | |||
| 1107 | Ga0307510_10117023 | |||
| 1108 | Ga0373944_0025365 | |||
| 1109 | Ga0373946_0048795 | |||
| 1110 | Ga0316574_0076370 | |||
| 1111 | Ga0373947_0177837 | |||
| 1112 | Ga0373937_0133717 | |||
| 1113 | Ga0373925_0016509 | |||
| 1114 | Ga0373925_0029091 | |||
| 1115 | Ga0395905_0000027 | |||
| 1116 | Ga0395905_0000042 | |||
| 1117 | Ga0395905_0007865 | |||
| 1118 | Ga0395905_0023905 | |||
| 1119 | Ga0395905_0024594 | |||
| 1120 | Ga0395905_0103882 | |||
| 1121 | Ga0395905_0125407 | |||
| 1122 | Ga0439436_0017493 | |||
| 1123 | Ga0439447_015058 | |||
| 1124 | Ga0439447_021904 | |||
| 1125 | Ga0439453_0000445 | |||
| 1126 | Ga0439461_0013059 | |||
| 1127 | Ga0439466_0014116 | |||
| 1128 | Ga0439466_0020499 | |||
| 1129 | Ga0439465_0027141 | |||
| 1130 | Ga0451793_0428282 | |||
| 1131 | Ga0439433_0010675 | |||
| 1132 | Ga0439441_012683 | |||
| 1133 | Ga0439443_007604 | |||
| 1134 | Ga0439445_0001348 | |||
| 1135 | Ga0439432_018107 | |||
| 1136 | Ga0439432_051632 | |||
| 1137 | Ga0439449_0001315 | |||
| 1138 | Ga0439449_0005741 | |||
| 1139 | Ga0439449_0008350 | |||
| 1140 | Ga0439449_0066413 | |||
| 1141 | Ga0439452_031508 | |||
| 1142 | Ga0439455_0015898 | |||
| 1143 | Ga0439457_002947 | |||
| 1144 | Ga0439457_013800 | |||
| 1145 | Ga0439462_0029960 | |||
| 1146 | Ga0450911_000419 | |||
| 1147 | Ga0450921_000356 | |||
| 1148 | Ga0450906_005723 | |||
| 1149 | Ga0450906_018242 | |||
| 1150 | Ga0439446_0040259 | |||
| 1151 | Ga0439434_0011533 | |||
| 1152 | Ga0439435_0003265 | |||
| 1153 | Ga0439464_0002346 | |||
| 1154 | Ga0450918_001321 | |||
| 1155 | Ga0451577_0292932 | |||
| 1156 | Ga0466969_0010253 | |||
| 1157 | Ga0453683_0029476 | |||
| 1158 | Ga0466965_0045681 | |||
| 1159 | Ga0466966_0035793 | |||
| 1160 | Ga0451576_0235670 | |||
| 1161 | Ga0495627_005871 | |||
| 1162 | Ga0495582_0059884 | |||
| 1163 | Ga0495582_0091480 | |||
| 1164 | Ga0495610_0011528 | |||
| 1165 | Ga0495637_0040036 | |||
| 1166 | Ga0495654_0004374 | |||
| 1167 | Ga0495586_0114556 | |||
| 1168 | Ga0495598_0040159 | |||
| 1169 | Ga0495609_0090454 | |||
| 1170 | Ga0495656_0000047 | |||
| 1171 | Ga0495668_0121194 | |||
| 1172 | Ga0495625_0000360 | |||
| 1173 | Ga0495625_0011275 | |||
| 1174 | Ga0495625_0056546 | |||
| 1175 | Ga0495625_0174063 | |||
| 1176 | Ga0495588_0105831 | |||
| 1177 | Ga0495588_0154202 | |||
| 1178 | Ga0495658_0090841 | |||
| 1179 | Ga0495649_0005389 | |||
| 1180 | Ga0495676_0060279 | |||
| 1181 | Ga0495687_005310 | |||
| 1182 | Ga0495614_0009304 | |||
| 1183 | Ga0495615_0020198 | |||
| 1184 | Ga0496101_0012749 | |||
| 1185 | Ga0496101_0048044 | |||
| 1186 | Ga0496102_0067915 | |||
| 1187 | Ga0496102_0188930 | |||
| 1188 | Ga0496104_0088892 | |||
| 1189 | Ga0496105_0066379 | |||
| 1190 | Ga0496105_0067270 | |||
| 1191 | Ga0496106_0017056 | |||
| 1192 | Ga0496106_0105211 | |||
| 1193 | Ga0496108_0091338 | |||
| 1194 | Ga0496109_0080833 | |||
| 1195 | Ga0496110_0127250 | |||
| 1196 | Ga0496114_0103630 | |||
| 1197 | Ga0496116_0017638 | |||
| 1198 | Ga0496116_0021627 | |||
| 1199 | Ga0496117_0018643 | |||
| 1200 | Ga0496117_0025305 | |||
| 1201 | Ga0496117_0113310 | |||
| 1202 | Ga0496118_0005780 | |||
| 1203 | Ga0496121_0002801 | |||
| 1204 | Ga0496121_0013215 | |||
| 1205 | Ga0496121_0042409 | |||
| 1206 | Ga0496122_0069155 | |||
| 1207 | Ga0496123_0146868 | |||
| 1208 | Ga0496124_0147685 | |||
| 1209 | Ga0496125_0002671 | |||
| 1210 | Ga0496125_0014838 | |||
| 1211 | Ga0496125_0021834 | |||
| 1212 | Ga0496125_0061001 | |||
| 1213 | Ga0496125_0086771 | |||
| 1214 | Ga0496126_0321916 | |||
| 1215 | Ga0501031_0043130 | |||
| 1216 | Ga0501034_0227138 | |||
| 1217 | Ga0501249_003565 | |||
| 1218 | Ga0501225_0003789 | |||
| 1219 | nmdc:mga03683_10371_c1 | |||
| 1220 | nmdc:mga03683_21049_c1 | |||
| 1221 | nmdc:mga03683_6421_c1 | |||
| 1222 | nmdc:mga03683_70702_c1 | |||
| 1223 | nmdc:mga03683_74745_c1 | |||
| 1224 | nmdc:mga03n38_184772_c1 | |||
| 1225 | nmdc:mga00v17_144307_c1 | |||
| 1226 | nmdc:mga00v17_19953_c1 | |||
| 1227 | nmdc:mga0yw44_7818_c1 | |||
| 1228 | nmdc:mga0k408_13401_c1 | |||
| 1229 | nmdc:mga0k408_141384_c1 | |||
| 1230 | nmdc:mga0k408_14774_c1 | |||
| 1231 | nmdc:mga0k408_39477_c1 | |||
| 1232 | nmdc:mga0k408_51651_c1 | |||
| 1233 | nmdc:mga0k408_5868_c1 | |||
| 1234 | nmdc:mga0k408_6926_c1 | |||
| 1235 | nmdc:mga0k408_79998_c1 | |||
| 1236 | nmdc:mga06z11_146377_c1 | |||
| 1237 | nmdc:mga06z11_81246_c1 | |||
| 1238 | nmdc:mga04h51_14787_c1 | |||
| 1239 | nmdc:mga07m45_11400_c1 | |||
| 1240 | nmdc:mga07m45_131044_c1 | |||
| 1241 | nmdc:mga07m45_20133_c1 | |||
| 1242 | nmdc:mga07m45_25742_c1 | |||
| 1243 | nmdc:mga07m45_32352_c1 | |||
| 1244 | nmdc:mga07m45_36240_c1 | |||
| 1245 | nmdc:mga07m45_61715_c1 | |||
| 1246 | nmdc:mga07m45_8902_c1 | |||
| 1247 | nmdc:mga05p37_58073_c1 | |||
| 1248 | nmdc:mga09592_101130_c1 | |||
| 1249 | nmdc:mga0qj67_325226_c1 | |||
| 1250 | nmdc:mga0qj67_851_c1 | |||
| 1251 | nmdc:mga0sz30_21518_c1 | |||
| 1252 | nmdc:mga0sz30_8040_c1 | |||
| 1253 | Ga0500610_0004579 | |||
| 1254 | Ga0500610_0006383 | |||
| 1255 | Ga0500644_0014012 | |||
| 1256 | Ga0500646_0001449 | |||
| 1257 | Ga0500583_0013199 | |||
| 1258 | Ga0500651_0000169 | |||
| 1259 | Ga0500651_0038181 | |||
| 1260 | Ga0500650_0055005 | |||
| 1261 | Ga0500571_003984 | |||
| 1262 | Ga0500594_0030322 | |||
| 1263 | Ga0500607_010031 | |||
| 1264 | Ga0500607_074334 | |||
| 1265 | Ga0500608_006441 | |||
| 1266 | Ga0500655_006786 | |||
| 1267 | Ga0500658_0001494 | |||
| 1268 | Ga0500658_0003092 | |||
| 1269 | Ga0500559_0000339 | |||
| 1270 | Ga0500568_0002114 | |||
| 1271 | Ga0500574_006630 | |||
| 1272 | Ga0500588_0026567 | |||
| 1273 | Ga0500616_0044193 | |||
| 1274 | Ga0500622_0018453 | |||
| 1275 | Ga0500634_0037851 | |||
| 1276 | Ga0500638_044852 | |||
| 1277 | Ga0500645_000657 | |||
| 1278 | 2511243526 | |||
| 1279 | 2513227334 | |||
| 1280 | 2548499287 | |||
| 1281 | 2599627101 | |||
| 1282 | 2599676538 | |||
| 1283 | 2599684806 | |||
| 1284 | 2599696758 | |||
| 1285 | 2643866120 | |||
| 1286 | 2643994110 | |||
| 1287 | 2644057656 | |||
| 1288 | 2644072257 | |||
| 1289 | 2644160062 | |||
| 1290 | 2644292934 | |||
| 1291 | 2644302030 | |||
| 1292 | 2644329451 | |||
| 1293 | 2644401027 | |||
| 1294 | 2644464277 | |||
| 1295 | 2644466352 | |||
| 1296 | 2644647950 | |||
| 1297 | 2738723459 | |||
| 1298 | 2738882241 | |||
| 1299 | 2739241930 | |||
| 1300 | 2739251219 | |||
| 1301 | 2739284190 | |||
| 1302 | 2816470768 | |||
| 1303 | 2819598170 | |||
| 1304 | 2831269157 | |||
| 1305 | 2838058587 | |||
| 1306 | 2842682426 | |||
| 1307 | 2885196442 | |||
| 1308 | 2885200022 | |||
| 1309 | 2885213748 | |||
| 1310 | 2899929592 | |||
| 1311 | 2904456405 | |||
| 1312 | 2904462914 | |||
| 1313 | 2904549062 | |||
| 1314 | 2919465832 | |||
| 1315 | 2919706166 | |||
| 1316 | 2928039965 | |||
| 1317 | 2928047286 | |||
| 1318 | 2928057510 | |||
| 1319 | 2928068104 | |||
| 1320 | 2928072689 | |||
| 1321 | 2928085852 | |||
| 1322 | 2928120191 | |||
| 1323 | 2929160690 | |||
| 1324 | 2929523769 | |||
| 1325 | 2939634122 | |||
| 1326 | 2945914814 | |||
| 1327 | 2945951121 | |||
| 1328 | 2945974221 | |||
| 1329 | 2945989787 | |||
| 1330 | 2990714175 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.2328 | 22 | 288 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.2238 | 22 | 288 |
| 8j7w-assembly1.cif.gz_A | cryo-em structure of hznt7-fab complex in zinc state 2, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-bound conformation | 0.2224 | 14 | 210 |
| 5jdl-assembly1.cif.gz_A | structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 1mm sr2+ | 0.2027 | 49 | 255 |
| 5jdq-assembly1.cif.gz_A | structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and 10mm sr2+ | 0.1996 | 30 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.696 | 66 | 287 | 1.10.3470.10 |
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6606 | 49 | 283 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6459 | 49 | 283 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6457 | 49 | 283 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6331 | 49 | 279 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1TUR0-F1-model_v4 | deleted | 0.9465 | 49 | 221 |
|
| AF-A0A3C1TUR0-F1-model_v4 | deleted | 0.9259 | 49 | 221 |
|
| AF-A0A2V7G0E4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9134 | 49 | 208 |
GO:0005886
GO:0015658 |
| AF-A0A5N5E3J3-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.8836 | 49 | 218 |
GO:0005886
GO:0015658 |
| AF-X1KHB3-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8639 | 49 | 240 |
GO:0005886
GO:0015658 |