F473721

General Info

Members Datasets Scaffolds Average Seq Length
665 360 1330 342

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0002401|Ga0439436_0002401_3392_4540
Length 364
Sequence VFPEGASLRLPRRLLVANKEASQTMRFIFKTSYAQDIALAKHGGHMFWYSLLGAALIAAPWMLPEYWLAQLTFVLIYGIVGLGLMLLAGFTGQFSIGHAAFLGTGAYTQAVLANMGVPFALPALRVKGIYLGIATLAFGFIVEEVFARWESVTGGNSGLHVKSPKLFGLDISSSEGFYMVCLVVAVICTLAILNLLRSPTGRAFVAIRDSEISAQSMGIHLARYKTMSFAISAALAGLGGALYAHKLSFISPEQFNILQSIDLLLMVVIGGLGSVHGAFLGAIFLIAMPQLIALGKDWLPPVIGQAPGLQGLVYGLVLIGFVLFEPLGLYGRWLKIRTYLQLFPFYRRGLFRRQKSFTKSDRLR

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
179 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
180 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
181 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
207 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
208 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
209 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
214 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
215 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
218 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
223 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
224 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
275 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
290 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
294 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
295 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
303 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
307 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
310 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
311 2547132374 Acidovorax radicis N35 Isolate Unclassified
312 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
313 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
314 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
315 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
316 2643221570 Acidovorax sp. Root568 Isolate Unclassified
317 2643221596 Acidovorax sp. Root70 Isolate Unclassified
318 2643221609 Acidovorax sp. Root217 Isolate Unclassified
319 2643221611 Acidovorax sp. Root219 Isolate Unclassified
320 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
321 2643221652 Acidovorax sp. Root402 Isolate Unclassified
322 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
323 2643221658 Variovorax sp. Root411 Isolate Unclassified
324 2643221672 Variovorax sp. Root434 Isolate Unclassified
325 2643221683 Variovorax sp. Root473 Isolate Unclassified
326 2643221717 Acidovorax sp. Root267 Isolate Unclassified
327 2738541277 Variovorax sp. GV051 Isolate Unclassified
328 2738541307 Variovorax sp. GV008 Isolate Unclassified
329 2738543012 Acidovorax sp. CF301 Isolate Unclassified
330 2738543013 Variovorax sp. BT01 Isolate Unclassified
331 2738543019 Variovorax sp. GV040 Isolate Unclassified
332 2816332133 Acidovorax radicis 2721A Isolate Unclassified
333 2818991446 Variovorax sp. 1180 Isolate Unclassified
334 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
335 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
336 2842677519 Variovorax sp. R-72495 Isolate Unclassified
337 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
338 2885198086 Variovorax sp. 679 Isolate Unclassified
339 2885211737 Variovorax sp. 553 Isolate Unclassified
340 2899924645 Variovorax sp. 369 Isolate Unclassified
341 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
342 2904456579 Variovorax sp. 2002 Isolate Unclassified
343 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
344 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
345 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
346 2928037797 Variovorax sp. 1126 Isolate Unclassified
347 2928044640 Variovorax sp. 1128 Isolate Unclassified
348 2928051484 Variovorax sp. 1133 Isolate Unclassified
349 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
350 2928070936 Variovorax gossypii 1167 Isolate Unclassified
351 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
352 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
353 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
354 2929520902 Variovorax beijingensis 502 Isolate Unclassified
355 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
356 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
357 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
358 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
359 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
360 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.03
Metatranscriptomes 0
Isolates 7.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.92
Nodule 0.75
Rhizoplane 2.56
Rhizosphere 59.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0002401 3300041404 Bacteria 5616
2 JGI25159J45721_1000390 3300002987 Bacteria 20396
3 JGI25159J45721_1009932 3300002987 Bacteria 2471
4 JGI25151J46595_10001225 3300003187 Bacteria 18346
5 JGI25151J46595_10006750 3300003187 Bacteria 5715
6 JGI25160J50197_1000587 3300003354 Bacteria 20382
7 JGI25160J50197_1015577 3300003354 Bacteria 2490
8 JGI25161J50226_1000046 3300003374 Bacteria 116165
9 JGI25161J50226_1003345 3300003374 Bacteria 3705
10 JGI25161J50226_1004119 3300003374 Bacteria 3120
11 Ga0055535_1000168 3300003761 Bacteria 70666
12 Ga0055542_1000214 3300003762 Bacteria 70682
13 Ga0055526_1001336 3300003771 Bacteria 17664
14 Ga0055526_1015004 3300003771 Bacteria 3140
15 Ga0055526_1019305 3300003771 Bacteria 2490
16 Ga0055537_1000333 3300003773 Bacteria 32239
17 Ga0055536_1004071 3300003781 Bacteria 7608
18 Ga0055536_1006559 3300003781 Bacteria 5398
19 Ga0055536_1013076 3300003781 Bacteria 3024
20 Ga0055534_1000265 3300003784 Bacteria 36441
21 Ga0055534_1003619 3300003784 Bacteria 4799
22 Ga0055528_1000471 3300003790 Bacteria 32238
23 Ga0055530_10001300 3300003791 Bacteria 18811
24 Ga0055540_1002601 3300003792 Bacteria 9395
25 Ga0055540_1003978 3300003792 Bacteria 6882
26 Ga0055540_1013665 3300003792 Bacteria 2465
27 Ga0055531_10000572 3300003794 Bacteria 32155
28 Ga0055531_10021507 3300003794 Bacteria 2499
29 Ga0055543_1000270 3300004625 Bacteria 38712
30 Ga0055543_1005877 3300004625 Bacteria 3063
31 Ga0065165_1004394 3300005262 Bacteria 8786
32 Ga0065165_1008423 3300005262 Bacteria 4828
33 Ga0065714_10017429 3300005288 Bacteria 2007
34 Ga0065714_10080960 3300005288 Bacteria 2406
35 Ga0065704_10071856 3300005289 Bacteria 9751
36 Ga0065704_10085617 3300005289 Bacteria 3204
37 Ga0065707_10106764 3300005295 Bacteria 2583
38 Ga0070676_10005696 3300005328 Bacteria 6636
39 Ga0070670_100002652 3300005331 Bacteria 14794
40 Ga0070670_100027701 3300005331 Bacteria 4874
41 Ga0070670_100123525 3300005331 Bacteria 2234
42 Ga0070670_100148216 3300005331 Bacteria 2030
43 Ga0070677_10036034 3300005333 Bacteria 1921
44 Ga0068869_100012209 3300005334 Bacteria 5667
45 Ga0068869_100066228 3300005334 Bacteria 2661
46 Ga0068869_100141443 3300005334 Bacteria 1858
47 Ga0070666_10085581 3300005335 Bacteria 2159
48 Ga0068868_100012831 3300005338 Bacteria 6130
49 Ga0068868_100024677 3300005338 Bacteria 4564
50 Ga0070689_100049223 3300005340 Bacteria 3253
51 Ga0070687_100078289 3300005343 Bacteria 1797
52 Ga0070668_100042712 3300005347 Bacteria 3475
53 Ga0070668_100182609 3300005347 Bacteria 1714
54 Ga0070669_100122845 3300005353 Bacteria 1983
55 Ga0070675_100000243 3300005354 Bacteria 35354
56 Ga0070675_100003727 3300005354 Bacteria 11585
57 Ga0070675_100029315 3300005354 Bacteria 4438
58 Ga0070675_100049676 3300005354 Bacteria 3443
59 Ga0070675_100167953 3300005354 Bacteria 1890
60 Ga0070671_100006003 3300005355 Bacteria 9679
61 Ga0070671_100221576 3300005355 Bacteria 1604
62 Ga0070673_100010639 3300005364 Bacteria 6237
63 Ga0070673_100225270 3300005364 Bacteria 1625
64 Ga0070673_100314204 3300005364 Bacteria 1383
65 Ga0070667_100010689 3300005367 Bacteria 7584
66 Ga0070667_100045883 3300005367 Bacteria 3676
67 Ga0070667_100066289 3300005367 Bacteria 3067
68 Ga0070667_100094495 3300005367 Bacteria 2576
69 Ga0070667_100209868 3300005367 Bacteria 1730
70 Ga0070678_100003356 3300005456 Bacteria 8919
71 Ga0070678_100065650 3300005456 Bacteria 2695
72 Ga0070678_100078872 3300005456 Bacteria 2489
73 Ga0070678_100169210 3300005456 Bacteria 1778
74 Ga0070662_100004403 3300005457 Bacteria 8902
75 Ga0070662_100011286 3300005457 Bacteria 5891
76 Ga0070662_100034829 3300005457 Bacteria 3552
77 Ga0068867_100001303 3300005459 Bacteria 17238
78 Ga0068867_100010378 3300005459 Bacteria 6572
79 Ga0068867_100062429 3300005459 Bacteria 2768
80 Ga0070685_10125285 3300005466 Bacteria 1600
81 Ga0070706_100263470 3300005467 Bacteria 1609
82 Ga0070672_100002056 3300005543 Bacteria 12677
83 Ga0070672_100004518 3300005543 Bacteria 9106
84 Ga0070672_100013934 3300005543 Bacteria 5688
85 Ga0070672_100043606 3300005543 Bacteria 3460
86 Ga0070672_100308954 3300005543 Bacteria 1342
87 Ga0070665_100040676 3300005548 Bacteria 4672
88 Ga0070664_100162821 3300005564 Bacteria 1975
89 Ga0070664_100281773 3300005564 Bacteria 1499
90 Ga0068857_100064216 3300005577 Bacteria 3264
91 Ga0068857_100194812 3300005577 Bacteria 1846
92 Ga0068857_100206267 3300005577 Bacteria 1793
93 Ga0068854_100033089 3300005578 Bacteria 3602
94 Ga0068854_100092842 3300005578 Bacteria 2249
95 Ga0068854_100208643 3300005578 Bacteria 1540
96 Ga0068854_100246885 3300005578 Bacteria 1424
97 Ga0068859_100000664 3300005617 Bacteria 34524
98 Ga0068864_100000649 3300005618 Bacteria 29069
99 Ga0068864_100002170 3300005618 Bacteria 16199
100 Ga0068864_100012522 3300005618 Bacteria 7015
101 Ga0068866_10002429 3300005718 Bacteria 7686
102 Ga0068866_10012183 3300005718 Bacteria 3743
103 Ga0068861_100056642 3300005719 Bacteria 2992
104 Ga0068861_100301240 3300005719 Bacteria 1388
105 Ga0068851_10031521 3300005834 Bacteria 2634
106 Ga0068863_100029931 3300005841 Bacteria 5201
107 Ga0068863_100085517 3300005841 Bacteria 2989
108 Ga0068863_100260196 3300005841 Bacteria 1677
109 Ga0068858_100000753 3300005842 Bacteria 33946
110 Ga0068858_100001308 3300005842 Bacteria 25722
111 Ga0068860_100002605 3300005843 Bacteria 18875
112 Ga0068860_100002764 3300005843 Bacteria 18265
113 Ga0068860_100005264 3300005843 Bacteria 13132
114 Ga0068862_100163419 3300005844 Bacteria 1989
115 Ga0068862_100201791 3300005844 Bacteria 1793
116 Ga0081455_10089108 3300005937 Bacteria 2504
117 Ga0075365_10012259 3300006038 Bacteria 5082
118 Ga0075365_10104328 3300006038 Bacteria 1944
119 Ga0075365_10128389 3300006038 Bacteria 1753
120 Ga0075365_10185421 3300006038 Bacteria 1455
121 Ga0075365_10199188 3300006038 Bacteria 1403
122 Ga0075368_10004034 3300006042 Bacteria 4940
123 Ga0075363_100005537 3300006048 Bacteria 5630
124 Ga0075363_100041448 3300006048 Bacteria 2428
125 Ga0075363_100043855 3300006048 Bacteria 2367
126 Ga0075364_10005816 3300006051 Bacteria 7198
127 Ga0075364_10033290 3300006051 Bacteria 3317
128 Ga0075364_10053443 3300006051 Bacteria 2641
129 Ga0075432_10012307 3300006058 Bacteria 2906
130 Ga0070716_100197628 3300006173 Bacteria 1334
131 Ga0075362_10007426 3300006177 Bacteria 4151
132 Ga0075362_10050019 3300006177 Bacteria 1868
133 Ga0075367_10072773 3300006178 Bacteria 2070
134 Ga0075367_10079223 3300006178 Bacteria 1985
135 Ga0075369_10057668 3300006186 Bacteria 1689
136 Ga0075366_10004449 3300006195 Bacteria 7522
137 Ga0075366_10004609 3300006195 Bacteria 7406
138 Ga0075366_10007302 3300006195 Bacteria 6096
139 Ga0075366_10023123 3300006195 Bacteria 3620
140 Ga0075366_10035706 3300006195 Bacteria 2931
141 Ga0075366_10036931 3300006195 Bacteria 2881
142 Ga0097621_100018401 3300006237 Bacteria 5335
143 Ga0097621_100030835 3300006237 Bacteria 4248
144 Ga0097621_100346637 3300006237 Bacteria 1320
145 Ga0075370_10000228 3300006353 Bacteria 20029
146 Ga0075370_10003908 3300006353 Bacteria 7151
147 Ga0075370_10007388 3300006353 Bacteria 5594
148 Ga0075370_10008651 3300006353 Bacteria 5247
149 Ga0075370_10029533 3300006353 Bacteria 3054
150 Ga0075370_10047414 3300006353 Bacteria 2433
151 Ga0075370_10116276 3300006353 Bacteria 1555
152 Ga0075430_100000318 3300006846 Bacteria 34303
153 Ga0075430_100114647 3300006846 Bacteria 2245
154 Ga0075431_100340803 3300006847 Bacteria 1508
155 Ga0068865_100002181 3300006881 Bacteria 11531
156 Ga0068865_100086459 3300006881 Bacteria 2263
157 Ga0068865_100296017 3300006881 Bacteria 1293
158 Ga0097620_100000664 3300006931 Bacteria 34524
159 Ga0079104_1005414 3300006946 Bacteria 5109
160 Ga0099826_10005686 3300006948 Bacteria 8978
161 Ga0105244_10007097 3300009036 Bacteria 7162
162 Ga0105244_10082806 3300009036 Bacteria 1586
163 Ga0105240_10158043 3300009093 Bacteria 2695
164 Ga0105245_10028047 3300009098 Bacteria 4962
165 Ga0105245_10061457 3300009098 Bacteria 3387
166 Ga0105245_10138678 3300009098 Bacteria 2288
167 Ga0114129_10307032 3300009147 Bacteria 2113
168 Ga0105243_10001208 3300009148 Bacteria 23242
169 Ga0105243_10007703 3300009148 Bacteria 8278
170 Ga0105243_10013939 3300009148 Bacteria 6082
171 Ga0105243_10171051 3300009148 Bacteria 1881
172 Ga0105243_10393137 3300009148 Bacteria 1286
173 Ga0105248_10011097 3300009177 Bacteria 9940
174 Ga0105248_10577210 3300009177 Bacteria 1269
175 Ga0105248_10600103 3300009177 Bacteria 1242
176 Ga0105238_10191826 3300009551 Bacteria 2019
177 Ga0105249_10035236 3300009553 Bacteria 4538
178 Ga0105239_10064107 3300010375 Bacteria 4034
179 Ga0105246_10089187 3300011119 Bacteria 2218
180 Ga0105246_10111627 3300011119 Bacteria 2009
181 Ga0105246_10114497 3300011119 Bacteria 1987
182 Ga0105246_10275131 3300011119 Bacteria 1348
183 Ga0157347_1001782 3300012502 Bacteria 1750
184 Ga0157373_10012523 3300013100 Bacteria 6235
185 Ga0157373_10141198 3300013100 Bacteria 1694
186 Ga0157373_10241855 3300013100 Bacteria 1276
187 Ga0157370_10173203 3300013104 Bacteria 2006
188 Ga0157369_10021938 3300013105 Bacteria 7138
189 Ga0157374_10371824 3300013296 Bacteria 1423
190 Ga0157378_10004511 3300013297 Bacteria 12212
191 Ga0157378_10010562 3300013297 Bacteria 8070
192 Ga0157378_10107814 3300013297 Bacteria 2549
193 Ga0157378_10189611 3300013297 Bacteria 1938
194 Ga0163162_10004677 3300013306 Bacteria 13200
195 Ga0163162_10021485 3300013306 Bacteria 6358
196 Ga0163162_10296163 3300013306 Bacteria 1750
197 Ga0163162_10449355 3300013306 Bacteria 1421
198 Ga0157372_10489617 3300013307 Bacteria 1434
199 Ga0157375_10143305 3300013308 Bacteria 2518
200 Ga0157375_10236213 3300013308 Bacteria 1987
201 Ga0157375_10367627 3300013308 Bacteria 1604
202 Ga0157375_10421836 3300013308 Bacteria 1500
203 Ga0163163_10003252 3300014325 Bacteria 13780
204 Ga0163163_10198961 3300014325 Bacteria 2052
205 Ga0163163_10408160 3300014325 Bacteria 1417
206 Ga0157380_10028571 3300014326 Bacteria 4254
207 Ga0182008_10065342 3300014497 Bacteria 1790
208 Ga0157377_10000016 3300014745 Bacteria 190613
209 Ga0157377_10100293 3300014745 Bacteria 1724
210 Ga0157379_10000301 3300014968 Bacteria 39095
211 Ga0157379_10062580 3300014968 Bacteria 3328
212 Ga0157376_10046256 3300014969 Bacteria 3588
213 Ga0182006_1005503 3300015261 Bacteria 6027
214 Ga0182007_10003488 3300015262 Bacteria 7402
215 Ga0182007_10004544 3300015262 Bacteria 6271
216 Ga0182005_1020985 3300015265 Bacteria 1794
217 Ga0183362_10015 3300015683 Bacteria 36270
218 Ga0163161_10000669 3300017792 Bacteria 27400
219 Ga0163161_10016093 3300017792 Bacteria 5221
220 Ga0163161_10026203 3300017792 Bacteria 4130
221 Ga0163161_10076572 3300017792 Bacteria 2456
222 Ga0209436_106917 3300025208 Bacteria 2427
223 Ga0209672_101344 3300025228 Bacteria 9266
224 Ga0209147_100697 3300025229 Bacteria 17206
225 Ga0209258_100015 3300025242 Bacteria 706310
226 Ga0207425_1000696 3300025245 Bacteria 18207
227 Ga0207425_1002191 3300025245 Bacteria 7109
228 Ga0209148_1000183 3300025254 Bacteria 122620
229 Ga0209129_1000049 3300025258 Bacteria 268086
230 Ga0209129_1005391 3300025258 Bacteria 4552
231 Ga0209565_1000357 3300025263 Bacteria 39887
232 Ga0209565_1000670 3300025263 Bacteria 21669
233 Ga0209565_1001468 3300025263 Bacteria 10337
234 Ga0209565_1001490 3300025263 Bacteria 10226
235 Ga0209673_1000849 3300025273 Bacteria 39887
236 Ga0209673_1004621 3300025273 Bacteria 7291
237 Ga0209130_1000064 3300025284 Bacteria 196568
238 Ga0209130_1001757 3300025284 Bacteria 12863
239 Ga0209130_1002259 3300025284 Bacteria 9950
240 Ga0209675_1000352 3300025291 Bacteria 39879
241 Ga0209675_1006237 3300025291 Bacteria 4823
242 Ga0209675_1008030 3300025291 Bacteria 3943
243 Ga0209675_1011745 3300025291 Bacteria 2880
244 Ga0209675_1019464 3300025291 Bacteria 1868
245 Ga0209675_1021893 3300025291 Bacteria 1693
246 Ga0209676_1000137 3300025292 Bacteria 179437
247 Ga0209676_1000385 3300025292 Bacteria 81044
248 Ga0209676_1000873 3300025292 Bacteria 38608
249 Ga0209676_1008682 3300025292 Bacteria 4491
250 Ga0209676_1014082 3300025292 Bacteria 3030
251 Ga0209676_1020259 3300025292 Bacteria 2264
252 Ga0209025_1000290 3300025294 Bacteria 113067
253 Ga0209025_1000313 3300025294 Bacteria 107850
254 Ga0209025_1004032 3300025294 Bacteria 13154
255 Ga0209025_1005627 3300025294 Bacteria 10115
256 Ga0209025_1014190 3300025294 Bacteria 4930
257 Ga0209025_1017484 3300025294 Bacteria 4134
258 Ga0209025_1031447 3300025294 Bacteria 2510
259 Ga0209025_1035892 3300025294 Bacteria 2231
260 Ga0209564_1001545 3300025295 Bacteria 22749
261 Ga0209564_1005054 3300025295 Bacteria 7708
262 Ga0209564_1009323 3300025295 Bacteria 4691
263 Ga0209564_1014249 3300025295 Bacteria 3320
264 Ga0209564_1031976 3300025295 Bacteria 1594
265 Ga0209758_1000135 3300025297 Bacteria 177753
266 Ga0209050_1000015 3300025298 Bacteria 759102
267 Ga0209050_1001437 3300025298 Bacteria 25610
268 Ga0209050_1001535 3300025298 Bacteria 24230
269 Ga0209256_1000129 3300025299 Bacteria 163766
270 Ga0209256_1000224 3300025299 Bacteria 104436
271 Ga0207426_1000062 3300025302 Bacteria 362040
272 Ga0207426_1000171 3300025302 Bacteria 163766
273 Ga0207426_1000185 3300025302 Bacteria 154146
274 Ga0209051_1000010 3300025303 Bacteria 641298
275 Ga0209051_1000137 3300025303 Bacteria 137784
276 Ga0209051_1000859 3300025303 Bacteria 30952
277 Ga0209051_1001741 3300025303 Bacteria 17359
278 Ga0209257_1000026 3300025304 Bacteria 723225
279 Ga0209257_1000205 3300025304 Bacteria 143735
280 Ga0209257_1008774 3300025304 Bacteria 5619
281 Ga0209257_1009859 3300025304 Bacteria 4989
282 Ga0209257_1013535 3300025304 Bacteria 3613
283 Ga0207697_10020368 3300025315 Bacteria 2716
284 Ga0207655_1002202 3300025728 Bacteria 16179
285 Ga0207682_10031130 3300025893 Bacteria 2140
286 Ga0207642_10011627 3300025899 Bacteria 3148
287 Ga0207680_10000566 3300025903 Bacteria 17497
288 Ga0207645_10003023 3300025907 Bacteria 12988
289 Ga0207645_10006702 3300025907 Bacteria 8231
290 Ga0207645_10120181 3300025907 Bacteria 1705
291 Ga0207705_10190450 3300025909 Bacteria 1551
292 Ga0207695_10110197 3300025913 Bacteria 2733
293 Ga0207671_10096876 3300025914 Bacteria 2230
294 Ga0207662_10040248 3300025918 Bacteria 2746
295 Ga0207681_10025086 3300025923 Bacteria 3831
296 Ga0207681_10061636 3300025923 Bacteria 2579
297 Ga0207681_10254289 3300025923 Bacteria 1373
298 Ga0207694_10008501 3300025924 Bacteria 7752
299 Ga0207650_10081846 3300025925 Bacteria 2449
300 Ga0207650_10247554 3300025925 Bacteria 1442
301 Ga0207659_10000413 3300025926 Bacteria 25819
302 Ga0207659_10017569 3300025926 Bacteria 4674
303 Ga0207659_10106453 3300025926 Bacteria 2124
304 Ga0207687_10009580 3300025927 Bacteria 6334
305 Ga0207687_10177932 3300025927 Bacteria 1646
306 Ga0207687_10345752 3300025927 Bacteria 1210
307 Ga0207644_10010403 3300025931 Bacteria 6129
308 Ga0207644_10013414 3300025931 Bacteria 5462
309 Ga0207690_10221778 3300025932 Bacteria 1447
310 Ga0207706_10019318 3300025933 Bacteria 6129
311 Ga0207706_10038279 3300025933 Bacteria 4255
312 Ga0207706_10143824 3300025933 Bacteria 2098
313 Ga0207706_10156170 3300025933 Bacteria 2006
314 Ga0207706_10236860 3300025933 Bacteria 1596
315 Ga0207686_10118159 3300025934 Bacteria 1800
316 Ga0207709_10000497 3300025935 Bacteria 35233
317 Ga0207709_10002246 3300025935 Bacteria 12298
318 Ga0207709_10072389 3300025935 Bacteria 2192
319 Ga0207709_10108671 3300025935 Bacteria 1850
320 Ga0207670_10007925 3300025936 Bacteria 5964
321 Ga0207669_10018533 3300025937 Bacteria 3602
322 Ga0207669_10022637 3300025937 Bacteria 3341
323 Ga0207704_10008514 3300025938 Bacteria 4912
324 Ga0207704_10071544 3300025938 Bacteria 2201
325 Ga0207704_10187857 3300025938 Bacteria 1500
326 Ga0207665_10113227 3300025939 Bacteria 1908
327 Ga0207691_10001908 3300025940 Bacteria 20369
328 Ga0207691_10044683 3300025940 Bacteria 4076
329 Ga0207691_10123327 3300025940 Bacteria 2294
330 Ga0207691_10277340 3300025940 Bacteria 1443
331 Ga0207691_10280468 3300025940 Bacteria 1434
332 Ga0207711_10008859 3300025941 Bacteria 8413
333 Ga0207711_10226348 3300025941 Bacteria 1712
334 Ga0207711_10493940 3300025941 Bacteria 1140
335 Ga0207689_10001563 3300025942 Bacteria 21699
336 Ga0207689_10015963 3300025942 Bacteria 6356
337 Ga0207689_10082631 3300025942 Bacteria 2641
338 Ga0207689_10085451 3300025942 Bacteria 2593
339 Ga0207679_10368910 3300025945 Bacteria 1256
340 Ga0207651_10000989 3300025960 Bacteria 12556
341 Ga0207651_10004313 3300025960 Bacteria 7141
342 Ga0207651_10338289 3300025960 Bacteria 1264
343 Ga0207651_10387788 3300025960 Bacteria 1185
344 Ga0207712_10051703 3300025961 Bacteria 2875
345 Ga0207712_10079535 3300025961 Bacteria 2382
346 Ga0207668_10031689 3300025972 Bacteria 3485
347 Ga0207668_10250744 3300025972 Bacteria 1437
348 Ga0207640_10015485 3300025981 Bacteria 4415
349 Ga0207640_10173279 3300025981 Bacteria 1610
350 Ga0207658_10001221 3300025986 Bacteria 20333
351 Ga0207658_10002977 3300025986 Bacteria 12111
352 Ga0207658_10032821 3300025986 Bacteria 3699
353 Ga0207677_10011811 3300026023 Bacteria 4995
354 Ga0207677_10086809 3300026023 Bacteria 2263
355 Ga0207677_10146078 3300026023 Bacteria 1817
356 Ga0207703_10003078 3300026035 Bacteria 14106
357 Ga0207703_10004844 3300026035 Bacteria 10952
358 Ga0207703_10136899 3300026035 Bacteria 2121
359 Ga0207708_10010511 3300026075 Bacteria 6870
360 Ga0207708_10070867 3300026075 Bacteria 2669
361 Ga0207641_10003058 3300026088 Bacteria 15079
362 Ga0207641_10005904 3300026088 Bacteria 10385
363 Ga0207641_10007144 3300026088 Bacteria 9325
364 Ga0207641_10201166 3300026088 Bacteria 1837
365 Ga0207648_10000412 3300026089 Bacteria 47573
366 Ga0207648_10001863 3300026089 Bacteria 23045
367 Ga0207648_10030118 3300026089 Bacteria 4810
368 Ga0207648_10051461 3300026089 Bacteria 3600
369 Ga0207648_10201123 3300026089 Bacteria 1767
370 Ga0207676_10000325 3300026095 Bacteria 41139
371 Ga0207676_10004555 3300026095 Bacteria 9814
372 Ga0207676_10011788 3300026095 Bacteria 6253
373 Ga0207674_10086521 3300026116 Bacteria 3129
374 Ga0207674_10107002 3300026116 Bacteria 2774
375 Ga0207674_10333187 3300026116 Bacteria 1467
376 Ga0207675_100001409 3300026118 Bacteria 24039
377 Ga0207675_100010988 3300026118 Bacteria 8482
378 Ga0207675_100048452 3300026118 Bacteria 3966
379 Ga0207683_10008809 3300026121 Bacteria 8612
380 Ga0207683_10103368 3300026121 Bacteria 2545
381 Ga0207683_10153877 3300026121 Bacteria 2076
382 Ga0207683_10434459 3300026121 Bacteria 1210
383 Ga0207698_10096022 3300026142 Bacteria 2442
384 Ga0209281_1007682 3300027111 Bacteria 2687
385 Ga0209179_1003830 3300027512 Bacteria 2210
386 Ga0209970_1000334 3300027614 Bacteria 7879
387 Ga0209282_1007723 3300027666 Bacteria 6748
388 Ga0209971_1001676 3300027682 Bacteria 5478
389 Ga0209813_10003305 3300027866 Bacteria 3766
390 Ga0209974_10020977 3300027876 Bacteria 2165
391 Ga0268266_10127703 3300028379 Bacteria 2271
392 Ga0268266_10295094 3300028379 Bacteria 1511
393 Ga0268265_10006167 3300028380 Bacteria 8121
394 Ga0268265_10014920 3300028380 Bacteria 5304
395 Ga0268265_10086887 3300028380 Bacteria 2486
396 Ga0268265_10087158 3300028380 Bacteria 2483
397 Ga0268265_10158271 3300028380 Bacteria 1920
398 Ga0268264_10045799 3300028381 Bacteria 3633
399 Ga0268264_10094493 3300028381 Bacteria 2585
400 Ga0307517_10000575 3300028786 Bacteria 62687
401 Ga0307515_10000063 3300028794 Bacteria 245504
402 Ga0307515_10000150 3300028794 Bacteria 169644
403 Ga0307515_10005608 3300028794 Bacteria 25370
404 Ga0307515_10014322 3300028794 Bacteria 14720
405 Ga0307515_10158485 3300028794 Bacteria 2322
406 Ga0307511_10000082 3300030521 Bacteria 80315
407 Ga0307512_10149770 3300030522 Bacteria 1400
408 Ga0316178_1004833 3300030735 Bacteria 2042
409 Ga0316183_1047059 3300030742 Bacteria 1925
410 Ga0265332_10000023 3300031238 Bacteria 211994
411 Ga0265327_10000402 3300031251 Bacteria 80983
412 Ga0265327_10001540 3300031251 Bacteria 28437
413 Ga0265327_10009620 3300031251 Bacteria 6939
414 Ga0307513_10000008 3300031456 Bacteria 442128
415 Ga0307513_10000991 3300031456 Bacteria 41018
416 Ga0307513_10003892 3300031456 Bacteria 20086
417 Ga0307513_10042874 3300031456 Bacteria 4976
418 Ga0307513_10094269 3300031456 Bacteria 3039
419 Ga0307509_10126413 3300031507 Bacteria 2521
420 Ga0307408_100000873 3300031548 Bacteria 23699
421 Ga0307408_100051285 3300031548 Bacteria 2971
422 Ga0307408_100088075 3300031548 Bacteria 2337
423 Ga0307408_100110099 3300031548 Bacteria 2114
424 Ga0307408_100335824 3300031548 Bacteria 1277
425 Ga0307508_10025941 3300031616 Bacteria 5314
426 Ga0307514_10071442 3300031649 Bacteria 2603
427 Ga0316576_10047064 3300031727 Bacteria 3124
428 Ga0307516_10003416 3300031730 Bacteria 20413
429 Ga0307405_10010080 3300031731 Bacteria 4875
430 Ga0307406_10000831 3300031901 Bacteria 17357
431 Ga0307406_10060373 3300031901 Bacteria 2444
432 Ga0307412_10009966 3300031911 Bacteria 5465
433 Ga0307412_10013346 3300031911 Bacteria 4814
434 Ga0307412_10123223 3300031911 Bacteria 1870
435 Ga0307416_100010499 3300032002 Bacteria 6120
436 Ga0307416_100044766 3300032002 Bacteria 3478
437 Ga0307416_100206220 3300032002 Bacteria 1870
438 Ga0307411_10097694 3300032005 Bacteria 2068
439 Ga0307415_100086696 3300032126 Bacteria 2253
440 Ga0307507_10107478 3300033179 Bacteria 2299
441 Ga0307510_10009118 3300033180 Bacteria 11811
442 Ga0307510_10117023 3300033180 Bacteria 2384
443 Ga0373944_0025365 3300035089 Bacteria 1744
444 Ga0373946_0048795 3300035171 Bacteria 1764
445 Ga0316574_0076370 3300035398 Bacteria 2122
446 Ga0373947_0177837 3300035725 Bacteria 1384
447 Ga0373937_0133717 3300036401 Bacteria 2318
448 Ga0373925_0016509 3300037068 Bacteria 5349
449 Ga0373925_0029091 3300037068 Bacteria 4053
450 Ga0395905_0000027 3300037471 Bacteria 297239
451 Ga0395905_0000042 3300037471 Bacteria 247894
452 Ga0395905_0007865 3300037471 Bacteria 10559
453 Ga0395905_0023905 3300037471 Bacteria 5769
454 Ga0395905_0024594 3300037471 Bacteria 5683
455 Ga0395905_0103882 3300037471 Bacteria 2667
456 Ga0395905_0125407 3300037471 Bacteria 2414
457 Ga0439436_0017493 3300041404 Bacteria 2144
458 Ga0439447_015058 3300041407 Bacteria 2154
459 Ga0439447_021904 3300041407 Bacteria 1679
460 Ga0439453_0000445 3300041408 Bacteria 4507
461 Ga0439461_0013059 3300041410 Bacteria 1562
462 Ga0439466_0014116 3300041411 Bacteria 2914
463 Ga0439466_0020499 3300041411 Bacteria 2355
464 Ga0439465_0027141 3300041413 Bacteria 1812
465 Ga0451793_0428282 3300041452 Bacteria 1076
466 Ga0439433_0010675 3300041999 Bacteria 2008
467 Ga0439441_012683 3300042001 Bacteria 1450
468 Ga0439443_007604 3300042003 Bacteria 1512
469 Ga0439445_0001348 3300042004 Bacteria 5317
470 Ga0439432_018107 3300042006 Bacteria 2357
471 Ga0439432_051632 3300042006 Bacteria 1281
472 Ga0439449_0001315 3300042007 Bacteria 9735
473 Ga0439449_0005741 3300042007 Bacteria 4745
474 Ga0439449_0008350 3300042007 Bacteria 3938
475 Ga0439449_0066413 3300042007 Bacteria 1330
476 Ga0439452_031508 3300042010 Bacteria 1300
477 Ga0439455_0015898 3300042012 Bacteria 1735
478 Ga0439457_002947 3300042014 Bacteria 4730
479 Ga0439457_013800 3300042014 Bacteria 1813
480 Ga0439462_0029960 3300042015 Bacteria 1439
481 Ga0450911_000419 3300042115 Bacteria 13988
482 Ga0450921_000356 3300042123 Bacteria 2084
483 Ga0450906_005723 3300042145 Bacteria 2538
484 Ga0450906_018242 3300042145 Bacteria 1260
485 Ga0439446_0040259 3300042156 Bacteria 1375
486 Ga0439434_0011533 3300042435 Bacteria 2613
487 Ga0439435_0003265 3300042436 Bacteria 3351
488 Ga0439464_0002346 3300042439 Bacteria 4647
489 Ga0450918_001321 3300042531 Bacteria 4987
490 Ga0451577_0292932 3300042876 Bacteria 1475
491 Ga0466969_0010253 3300044656 Bacteria 4967
492 Ga0453683_0029476 3300044673 Bacteria 3469
493 Ga0466965_0045681 3300044683 Bacteria 2167
494 Ga0466966_0035793 3300044684 Bacteria 3206
495 Ga0451576_0235670 3300045051 Bacteria 1911
496 Ga0495627_005871 3300046453 Bacteria 4881
497 Ga0495582_0059884 3300046473 Bacteria 2101
498 Ga0495582_0091480 3300046473 Bacteria 1697
499 Ga0495610_0011528 3300046512 Bacteria 5396
500 Ga0495637_0040036 3300046520 Bacteria 2019
501 Ga0495654_0004374 3300046530 Bacteria 8405
502 Ga0495586_0114556 3300046535 Bacteria 1503
503 Ga0495598_0040159 3300046537 Bacteria 1363
504 Ga0495609_0090454 3300046538 Bacteria 1331
505 Ga0495656_0000047 3300046615 Bacteria 59690
506 Ga0495668_0121194 3300046616 Bacteria 1431
507 Ga0495625_0000360 3300046660 Bacteria 69587
508 Ga0495625_0011275 3300046660 Bacteria 7307
509 Ga0495625_0056546 3300046660 Bacteria 2792
510 Ga0495625_0174063 3300046660 Bacteria 1435
511 Ga0495588_0105831 3300046674 Bacteria 1480
512 Ga0495588_0154202 3300046674 Bacteria 1214
513 Ga0495658_0090841 3300046683 Bacteria 1808
514 Ga0495649_0005389 3300046694 Bacteria 8144
515 Ga0495676_0060279 3300047321 Bacteria 2975
516 Ga0495687_005310 3300047443 Bacteria 8260
517 Ga0495614_0009304 3300048089 Bacteria 4347
518 Ga0495615_0020198 3300048090 Bacteria 1489
519 Ga0496101_0012749 3300048904 Bacteria 5619
520 Ga0496101_0048044 3300048904 Bacteria 3065
521 Ga0496102_0067915 3300048905 Bacteria 3270
522 Ga0496102_0188930 3300048905 Bacteria 1941
523 Ga0496104_0088892 3300048907 Bacteria 2951
524 Ga0496105_0066379 3300048908 Bacteria 2978
525 Ga0496105_0067270 3300048908 Bacteria 2958
526 Ga0496106_0017056 3300048909 Bacteria 5375
527 Ga0496106_0105211 3300048909 Bacteria 2193
528 Ga0496108_0091338 3300048911 Bacteria 2588
529 Ga0496109_0080833 3300048912 Bacteria 2995
530 Ga0496110_0127250 3300048913 Bacteria 2299
531 Ga0496114_0103630 3300048917 Bacteria 2432
532 Ga0496116_0017638 3300048919 Bacteria 5532
533 Ga0496116_0021627 3300048919 Bacteria 4843
534 Ga0496117_0018643 3300048920 Bacteria 5738
535 Ga0496117_0025305 3300048920 Bacteria 4669
536 Ga0496117_0113310 3300048920 Bacteria 1684
537 Ga0496118_0005780 3300048921 Bacteria 13891
538 Ga0496121_0002801 3300048924 Bacteria 25834
539 Ga0496121_0013215 3300048924 Bacteria 8896
540 Ga0496121_0042409 3300048924 Bacteria 3958
541 Ga0496122_0069155 3300048925 Bacteria 2531
542 Ga0496123_0146868 3300048926 Bacteria 1279
543 Ga0496124_0147685 3300048927 Bacteria 1848
544 Ga0496125_0002671 3300048928 Bacteria 22776
545 Ga0496125_0014838 3300048928 Bacteria 7567
546 Ga0496125_0021834 3300048928 Bacteria 5957
547 Ga0496125_0061001 3300048928 Bacteria 3027
548 Ga0496125_0086771 3300048928 Bacteria 2365
549 Ga0496126_0321916 3300048929 Bacteria 1271
550 Ga0501031_0043130 3300049568 Bacteria 2945
551 Ga0501034_0227138 3300049571 Bacteria 1817
552 Ga0501249_003565 3300049679 Bacteria 3128
553 Ga0501225_0003789 3300049705 Bacteria 4544
554 nmdc:mga03683_10371_c1 3300050489 Bacteria 3340
555 nmdc:mga03683_21049_c1 3300050489 Bacteria 2509
556 nmdc:mga03683_6421_c1 3300050489 Bacteria 4024
557 nmdc:mga03683_70702_c1 3300050489 Bacteria 1491
558 nmdc:mga03683_74745_c1 3300050489 Bacteria 1454
559 nmdc:mga03n38_184772_c1 3300050490 Bacteria 1070
560 nmdc:mga00v17_144307_c1 3300050491 Bacteria 1528
561 nmdc:mga00v17_19953_c1 3300050491 Bacteria 3834
562 nmdc:mga0yw44_7818_c1 3300050492 Bacteria 5290
563 nmdc:mga0k408_13401_c1 3300050493 Bacteria 4495
564 nmdc:mga0k408_141384_c1 3300050493 Bacteria 1432
565 nmdc:mga0k408_14774_c1 3300050493 Bacteria 4308
566 nmdc:mga0k408_39477_c1 3300050493 Bacteria 2713
567 nmdc:mga0k408_51651_c1 3300050493 Bacteria 2382
568 nmdc:mga0k408_5868_c1 3300050493 Bacteria 6544
569 nmdc:mga0k408_6926_c1 3300050493 Bacteria 6046
570 nmdc:mga0k408_79998_c1 3300050493 Bacteria 1912
571 nmdc:mga06z11_146377_c1 3300050494 Bacteria 1339
572 nmdc:mga06z11_81246_c1 3300050494 Bacteria 1740
573 nmdc:mga04h51_14787_c1 3300050495 Bacteria 2238
574 nmdc:mga07m45_11400_c1 3300050496 Bacteria 4669
575 nmdc:mga07m45_131044_c1 3300050496 Bacteria 1451
576 nmdc:mga07m45_20133_c1 3300050496 Bacteria 3622
577 nmdc:mga07m45_25742_c1 3300050496 Bacteria 3229
578 nmdc:mga07m45_32352_c1 3300050496 Bacteria 2134
579 nmdc:mga07m45_36240_c1 3300050496 Bacteria 2747
580 nmdc:mga07m45_61715_c1 3300050496 Bacteria 2124
581 nmdc:mga07m45_8902_c1 3300050496 Bacteria 5183
582 nmdc:mga05p37_58073_c1 3300050507 Bacteria 4765
583 nmdc:mga09592_101130_c1 3300050508 Bacteria 2469
584 nmdc:mga0qj67_325226_c1 3300050509 Bacteria 1245
585 nmdc:mga0qj67_851_c1 3300050509 Bacteria 20946
586 nmdc:mga0sz30_21518_c1 3300050516 Bacteria 2611
587 nmdc:mga0sz30_8040_c1 3300050516 Bacteria 3973
588 Ga0500610_0004579 3300053079 Bacteria 5519
589 Ga0500610_0006383 3300053079 Bacteria 4938
590 Ga0500644_0014012 3300053088 Bacteria 2253
591 Ga0500646_0001449 3300053090 Bacteria 6280
592 Ga0500583_0013199 3300053092 Bacteria 3186
593 Ga0500651_0000169 3300053093 Bacteria 42653
594 Ga0500651_0038181 3300053093 Bacteria 3026
595 Ga0500650_0055005 3300053098 Bacteria 1853
596 Ga0500571_003984 3300053110 Bacteria 7698
597 Ga0500594_0030322 3300053118 Bacteria 1419
598 Ga0500607_010031 3300053121 Bacteria 5669
599 Ga0500607_074334 3300053121 Bacteria 1747
600 Ga0500608_006441 3300053122 Bacteria 4779
601 Ga0500655_006786 3300053133 Bacteria 2060
602 Ga0500658_0001494 3300053134 Bacteria 9361
603 Ga0500658_0003092 3300053134 Bacteria 6357
604 Ga0500559_0000339 3300053136 Bacteria 35031
605 Ga0500568_0002114 3300053139 Bacteria 11996
606 Ga0500574_006630 3300053141 Bacteria 2345
607 Ga0500588_0026567 3300053146 Bacteria 1621
608 Ga0500616_0044193 3300053153 Bacteria 2377
609 Ga0500622_0018453 3300053156 Bacteria 3709
610 Ga0500634_0037851 3300053161 Bacteria 2623
611 Ga0500638_044852 3300053162 Bacteria 2145
612 Ga0500645_000657 3300053730 Bacteria 21741
613 2511243526 2511231002 Bacteria 5042903
614 2513227334 2513020051 Bacteria 6053213
615 2548499287 2547132374 Bacteria 5530232
616 2599627101 2599185214 Bacteria 8209958
617 2599676538 2599185226 Bacteria 8233575
618 2599684806 2599185227 Bacteria 8246414
619 2599696758 2599185229 Bacteria 8216126
620 2643866120 2643221570 Bacteria 5103772
621 2643994110 2643221596 Bacteria 5006805
622 2644057656 2643221609 Bacteria 6756331
623 2644072257 2643221611 Bacteria 6820941
624 2644160062 2643221628 Bacteria 5745828
625 2644292934 2643221652 Bacteria 5140275
626 2644302030 2643221654 Bacteria 5273570
627 2644329451 2643221658 Bacteria 6064537
628 2644401027 2643221672 Bacteria 6322190
629 2644464277 2643221683 Bacteria 5749203
630 2644466352 2643221683 Bacteria 5749203
631 2644647950 2643221717 Bacteria 5676132
632 2738723459 2738541277 Bacteria 7458140
633 2738882241 2738541307 Bacteria 8606193
634 2739241930 2738543012 Bacteria 7115078
635 2739251219 2738543013 Bacteria 5618633
636 2739284190 2738543019 Bacteria 7459457
637 2816470768 2816332133 Bacteria 7249298
638 2819598170 2818991446 Bacteria 7757362
639 2831269157 2831265667 Bacteria 7184833
640 2838058587 2838054893 Bacteria 7451788
641 2842682426 2842677519 Bacteria 5615038
642 2885196442 2885192300 Bacteria 5882526
643 2885200022 2885198086 Bacteria 7212419
644 2885213748 2885211737 Bacteria 7212420
645 2899929592 2899924645 Bacteria 7487985
646 2904456405 2904449895 Bacteria 6927402
647 2904462914 2904456579 Bacteria 6819253
648 2904549062 2904541872 Bacteria 8915136
649 2919465832 2919462493 Bacteria 5817112
650 2919706166 2919704043 Bacteria 5560311
651 2928039965 2928037797 Bacteria 7273642
652 2928047286 2928044640 Bacteria 7271509
653 2928057510 2928051484 Bacteria 7773759
654 2928068104 2928064002 Bacteria 7419480
655 2928072689 2928070936 Bacteria 8062541
656 2928085852 2928084124 Bacteria 7159212
657 2928120191 2928115317 Bacteria 6477646
658 2929160690 2929160207 Bacteria 9075316
659 2929523769 2929520902 Bacteria 6765052
660 2939634122 2939631187 Bacteria 6118131
661 2945914814 2945909444 Bacteria 7065066
662 2945951121 2945945610 Bacteria 5951079
663 2945974221 2945972063 Bacteria 6086495
664 2945989787 2945984333 Bacteria 7358892
665 2990714175 2990710928 Bacteria 5002431
666 Ga0439436_0002401
667 JGI25159J45721_1000390
668 JGI25159J45721_1009932
669 JGI25151J46595_10001225
670 JGI25151J46595_10006750
671 JGI25160J50197_1000587
672 JGI25160J50197_1015577
673 JGI25161J50226_1000046
674 JGI25161J50226_1003345
675 JGI25161J50226_1004119
676 Ga0055535_1000168
677 Ga0055542_1000214
678 Ga0055526_1001336
679 Ga0055526_1015004
680 Ga0055526_1019305
681 Ga0055537_1000333
682 Ga0055536_1004071
683 Ga0055536_1006559
684 Ga0055536_1013076
685 Ga0055534_1000265
686 Ga0055534_1003619
687 Ga0055528_1000471
688 Ga0055530_10001300
689 Ga0055540_1002601
690 Ga0055540_1003978
691 Ga0055540_1013665
692 Ga0055531_10000572
693 Ga0055531_10021507
694 Ga0055543_1000270
695 Ga0055543_1005877
696 Ga0065165_1004394
697 Ga0065165_1008423
698 Ga0065714_10017429
699 Ga0065714_10080960
700 Ga0065704_10071856
701 Ga0065704_10085617
702 Ga0065707_10106764
703 Ga0070676_10005696
704 Ga0070670_100002652
705 Ga0070670_100027701
706 Ga0070670_100123525
707 Ga0070670_100148216
708 Ga0070677_10036034
709 Ga0068869_100012209
710 Ga0068869_100066228
711 Ga0068869_100141443
712 Ga0070666_10085581
713 Ga0068868_100012831
714 Ga0068868_100024677
715 Ga0070689_100049223
716 Ga0070687_100078289
717 Ga0070668_100042712
718 Ga0070668_100182609
719 Ga0070669_100122845
720 Ga0070675_100000243
721 Ga0070675_100003727
722 Ga0070675_100029315
723 Ga0070675_100049676
724 Ga0070675_100167953
725 Ga0070671_100006003
726 Ga0070671_100221576
727 Ga0070673_100010639
728 Ga0070673_100225270
729 Ga0070673_100314204
730 Ga0070667_100010689
731 Ga0070667_100045883
732 Ga0070667_100066289
733 Ga0070667_100094495
734 Ga0070667_100209868
735 Ga0070678_100003356
736 Ga0070678_100065650
737 Ga0070678_100078872
738 Ga0070678_100169210
739 Ga0070662_100004403
740 Ga0070662_100011286
741 Ga0070662_100034829
742 Ga0068867_100001303
743 Ga0068867_100010378
744 Ga0068867_100062429
745 Ga0070685_10125285
746 Ga0070706_100263470
747 Ga0070672_100002056
748 Ga0070672_100004518
749 Ga0070672_100013934
750 Ga0070672_100043606
751 Ga0070672_100308954
752 Ga0070665_100040676
753 Ga0070664_100162821
754 Ga0070664_100281773
755 Ga0068857_100064216
756 Ga0068857_100194812
757 Ga0068857_100206267
758 Ga0068854_100033089
759 Ga0068854_100092842
760 Ga0068854_100208643
761 Ga0068854_100246885
762 Ga0068859_100000664
763 Ga0068864_100000649
764 Ga0068864_100002170
765 Ga0068864_100012522
766 Ga0068866_10002429
767 Ga0068866_10012183
768 Ga0068861_100056642
769 Ga0068861_100301240
770 Ga0068851_10031521
771 Ga0068863_100029931
772 Ga0068863_100085517
773 Ga0068863_100260196
774 Ga0068858_100000753
775 Ga0068858_100001308
776 Ga0068860_100002605
777 Ga0068860_100002764
778 Ga0068860_100005264
779 Ga0068862_100163419
780 Ga0068862_100201791
781 Ga0081455_10089108
782 Ga0075365_10012259
783 Ga0075365_10104328
784 Ga0075365_10128389
785 Ga0075365_10185421
786 Ga0075365_10199188
787 Ga0075368_10004034
788 Ga0075363_100005537
789 Ga0075363_100041448
790 Ga0075363_100043855
791 Ga0075364_10005816
792 Ga0075364_10033290
793 Ga0075364_10053443
794 Ga0075432_10012307
795 Ga0070716_100197628
796 Ga0075362_10007426
797 Ga0075362_10050019
798 Ga0075367_10072773
799 Ga0075367_10079223
800 Ga0075369_10057668
801 Ga0075366_10004449
802 Ga0075366_10004609
803 Ga0075366_10007302
804 Ga0075366_10023123
805 Ga0075366_10035706
806 Ga0075366_10036931
807 Ga0097621_100018401
808 Ga0097621_100030835
809 Ga0097621_100346637
810 Ga0075370_10000228
811 Ga0075370_10003908
812 Ga0075370_10007388
813 Ga0075370_10008651
814 Ga0075370_10029533
815 Ga0075370_10047414
816 Ga0075370_10116276
817 Ga0075430_100000318
818 Ga0075430_100114647
819 Ga0075431_100340803
820 Ga0068865_100002181
821 Ga0068865_100086459
822 Ga0068865_100296017
823 Ga0097620_100000664
824 Ga0079104_1005414
825 Ga0099826_10005686
826 Ga0105244_10007097
827 Ga0105244_10082806
828 Ga0105240_10158043
829 Ga0105245_10028047
830 Ga0105245_10061457
831 Ga0105245_10138678
832 Ga0114129_10307032
833 Ga0105243_10001208
834 Ga0105243_10007703
835 Ga0105243_10013939
836 Ga0105243_10171051
837 Ga0105243_10393137
838 Ga0105248_10011097
839 Ga0105248_10577210
840 Ga0105248_10600103
841 Ga0105238_10191826
842 Ga0105249_10035236
843 Ga0105239_10064107
844 Ga0105246_10089187
845 Ga0105246_10111627
846 Ga0105246_10114497
847 Ga0105246_10275131
848 Ga0157347_1001782
849 Ga0157373_10012523
850 Ga0157373_10141198
851 Ga0157373_10241855
852 Ga0157370_10173203
853 Ga0157369_10021938
854 Ga0157374_10371824
855 Ga0157378_10004511
856 Ga0157378_10010562
857 Ga0157378_10107814
858 Ga0157378_10189611
859 Ga0163162_10004677
860 Ga0163162_10021485
861 Ga0163162_10296163
862 Ga0163162_10449355
863 Ga0157372_10489617
864 Ga0157375_10143305
865 Ga0157375_10236213
866 Ga0157375_10367627
867 Ga0157375_10421836
868 Ga0163163_10003252
869 Ga0163163_10198961
870 Ga0163163_10408160
871 Ga0157380_10028571
872 Ga0182008_10065342
873 Ga0157377_10000016
874 Ga0157377_10100293
875 Ga0157379_10000301
876 Ga0157379_10062580
877 Ga0157376_10046256
878 Ga0182006_1005503
879 Ga0182007_10003488
880 Ga0182007_10004544
881 Ga0182005_1020985
882 Ga0183362_10015
883 Ga0163161_10000669
884 Ga0163161_10016093
885 Ga0163161_10026203
886 Ga0163161_10076572
887 Ga0209436_106917
888 Ga0209672_101344
889 Ga0209147_100697
890 Ga0209258_100015
891 Ga0207425_1000696
892 Ga0207425_1002191
893 Ga0209148_1000183
894 Ga0209129_1000049
895 Ga0209129_1005391
896 Ga0209565_1000357
897 Ga0209565_1000670
898 Ga0209565_1001468
899 Ga0209565_1001490
900 Ga0209673_1000849
901 Ga0209673_1004621
902 Ga0209130_1000064
903 Ga0209130_1001757
904 Ga0209130_1002259
905 Ga0209675_1000352
906 Ga0209675_1006237
907 Ga0209675_1008030
908 Ga0209675_1011745
909 Ga0209675_1019464
910 Ga0209675_1021893
911 Ga0209676_1000137
912 Ga0209676_1000385
913 Ga0209676_1000873
914 Ga0209676_1008682
915 Ga0209676_1014082
916 Ga0209676_1020259
917 Ga0209025_1000290
918 Ga0209025_1000313
919 Ga0209025_1004032
920 Ga0209025_1005627
921 Ga0209025_1014190
922 Ga0209025_1017484
923 Ga0209025_1031447
924 Ga0209025_1035892
925 Ga0209564_1001545
926 Ga0209564_1005054
927 Ga0209564_1009323
928 Ga0209564_1014249
929 Ga0209564_1031976
930 Ga0209758_1000135
931 Ga0209050_1000015
932 Ga0209050_1001437
933 Ga0209050_1001535
934 Ga0209256_1000129
935 Ga0209256_1000224
936 Ga0207426_1000062
937 Ga0207426_1000171
938 Ga0207426_1000185
939 Ga0209051_1000010
940 Ga0209051_1000137
941 Ga0209051_1000859
942 Ga0209051_1001741
943 Ga0209257_1000026
944 Ga0209257_1000205
945 Ga0209257_1008774
946 Ga0209257_1009859
947 Ga0209257_1013535
948 Ga0207697_10020368
949 Ga0207655_1002202
950 Ga0207682_10031130
951 Ga0207642_10011627
952 Ga0207680_10000566
953 Ga0207645_10003023
954 Ga0207645_10006702
955 Ga0207645_10120181
956 Ga0207705_10190450
957 Ga0207695_10110197
958 Ga0207671_10096876
959 Ga0207662_10040248
960 Ga0207681_10025086
961 Ga0207681_10061636
962 Ga0207681_10254289
963 Ga0207694_10008501
964 Ga0207650_10081846
965 Ga0207650_10247554
966 Ga0207659_10000413
967 Ga0207659_10017569
968 Ga0207659_10106453
969 Ga0207687_10009580
970 Ga0207687_10177932
971 Ga0207687_10345752
972 Ga0207644_10010403
973 Ga0207644_10013414
974 Ga0207690_10221778
975 Ga0207706_10019318
976 Ga0207706_10038279
977 Ga0207706_10143824
978 Ga0207706_10156170
979 Ga0207706_10236860
980 Ga0207686_10118159
981 Ga0207709_10000497
982 Ga0207709_10002246
983 Ga0207709_10072389
984 Ga0207709_10108671
985 Ga0207670_10007925
986 Ga0207669_10018533
987 Ga0207669_10022637
988 Ga0207704_10008514
989 Ga0207704_10071544
990 Ga0207704_10187857
991 Ga0207665_10113227
992 Ga0207691_10001908
993 Ga0207691_10044683
994 Ga0207691_10123327
995 Ga0207691_10277340
996 Ga0207691_10280468
997 Ga0207711_10008859
998 Ga0207711_10226348
999 Ga0207711_10493940
1000 Ga0207689_10001563
1001 Ga0207689_10015963
1002 Ga0207689_10082631
1003 Ga0207689_10085451
1004 Ga0207679_10368910
1005 Ga0207651_10000989
1006 Ga0207651_10004313
1007 Ga0207651_10338289
1008 Ga0207651_10387788
1009 Ga0207712_10051703
1010 Ga0207712_10079535
1011 Ga0207668_10031689
1012 Ga0207668_10250744
1013 Ga0207640_10015485
1014 Ga0207640_10173279
1015 Ga0207658_10001221
1016 Ga0207658_10002977
1017 Ga0207658_10032821
1018 Ga0207677_10011811
1019 Ga0207677_10086809
1020 Ga0207677_10146078
1021 Ga0207703_10003078
1022 Ga0207703_10004844
1023 Ga0207703_10136899
1024 Ga0207708_10010511
1025 Ga0207708_10070867
1026 Ga0207641_10003058
1027 Ga0207641_10005904
1028 Ga0207641_10007144
1029 Ga0207641_10201166
1030 Ga0207648_10000412
1031 Ga0207648_10001863
1032 Ga0207648_10030118
1033 Ga0207648_10051461
1034 Ga0207648_10201123
1035 Ga0207676_10000325
1036 Ga0207676_10004555
1037 Ga0207676_10011788
1038 Ga0207674_10086521
1039 Ga0207674_10107002
1040 Ga0207674_10333187
1041 Ga0207675_100001409
1042 Ga0207675_100010988
1043 Ga0207675_100048452
1044 Ga0207683_10008809
1045 Ga0207683_10103368
1046 Ga0207683_10153877
1047 Ga0207683_10434459
1048 Ga0207698_10096022
1049 Ga0209281_1007682
1050 Ga0209179_1003830
1051 Ga0209970_1000334
1052 Ga0209282_1007723
1053 Ga0209971_1001676
1054 Ga0209813_10003305
1055 Ga0209974_10020977
1056 Ga0268266_10127703
1057 Ga0268266_10295094
1058 Ga0268265_10006167
1059 Ga0268265_10014920
1060 Ga0268265_10086887
1061 Ga0268265_10087158
1062 Ga0268265_10158271
1063 Ga0268264_10045799
1064 Ga0268264_10094493
1065 Ga0307517_10000575
1066 Ga0307515_10000063
1067 Ga0307515_10000150
1068 Ga0307515_10005608
1069 Ga0307515_10014322
1070 Ga0307515_10158485
1071 Ga0307511_10000082
1072 Ga0307512_10149770
1073 Ga0316178_1004833
1074 Ga0316183_1047059
1075 Ga0265332_10000023
1076 Ga0265327_10000402
1077 Ga0265327_10001540
1078 Ga0265327_10009620
1079 Ga0307513_10000008
1080 Ga0307513_10000991
1081 Ga0307513_10003892
1082 Ga0307513_10042874
1083 Ga0307513_10094269
1084 Ga0307509_10126413
1085 Ga0307408_100000873
1086 Ga0307408_100051285
1087 Ga0307408_100088075
1088 Ga0307408_100110099
1089 Ga0307408_100335824
1090 Ga0307508_10025941
1091 Ga0307514_10071442
1092 Ga0316576_10047064
1093 Ga0307516_10003416
1094 Ga0307405_10010080
1095 Ga0307406_10000831
1096 Ga0307406_10060373
1097 Ga0307412_10009966
1098 Ga0307412_10013346
1099 Ga0307412_10123223
1100 Ga0307416_100010499
1101 Ga0307416_100044766
1102 Ga0307416_100206220
1103 Ga0307411_10097694
1104 Ga0307415_100086696
1105 Ga0307507_10107478
1106 Ga0307510_10009118
1107 Ga0307510_10117023
1108 Ga0373944_0025365
1109 Ga0373946_0048795
1110 Ga0316574_0076370
1111 Ga0373947_0177837
1112 Ga0373937_0133717
1113 Ga0373925_0016509
1114 Ga0373925_0029091
1115 Ga0395905_0000027
1116 Ga0395905_0000042
1117 Ga0395905_0007865
1118 Ga0395905_0023905
1119 Ga0395905_0024594
1120 Ga0395905_0103882
1121 Ga0395905_0125407
1122 Ga0439436_0017493
1123 Ga0439447_015058
1124 Ga0439447_021904
1125 Ga0439453_0000445
1126 Ga0439461_0013059
1127 Ga0439466_0014116
1128 Ga0439466_0020499
1129 Ga0439465_0027141
1130 Ga0451793_0428282
1131 Ga0439433_0010675
1132 Ga0439441_012683
1133 Ga0439443_007604
1134 Ga0439445_0001348
1135 Ga0439432_018107
1136 Ga0439432_051632
1137 Ga0439449_0001315
1138 Ga0439449_0005741
1139 Ga0439449_0008350
1140 Ga0439449_0066413
1141 Ga0439452_031508
1142 Ga0439455_0015898
1143 Ga0439457_002947
1144 Ga0439457_013800
1145 Ga0439462_0029960
1146 Ga0450911_000419
1147 Ga0450921_000356
1148 Ga0450906_005723
1149 Ga0450906_018242
1150 Ga0439446_0040259
1151 Ga0439434_0011533
1152 Ga0439435_0003265
1153 Ga0439464_0002346
1154 Ga0450918_001321
1155 Ga0451577_0292932
1156 Ga0466969_0010253
1157 Ga0453683_0029476
1158 Ga0466965_0045681
1159 Ga0466966_0035793
1160 Ga0451576_0235670
1161 Ga0495627_005871
1162 Ga0495582_0059884
1163 Ga0495582_0091480
1164 Ga0495610_0011528
1165 Ga0495637_0040036
1166 Ga0495654_0004374
1167 Ga0495586_0114556
1168 Ga0495598_0040159
1169 Ga0495609_0090454
1170 Ga0495656_0000047
1171 Ga0495668_0121194
1172 Ga0495625_0000360
1173 Ga0495625_0011275
1174 Ga0495625_0056546
1175 Ga0495625_0174063
1176 Ga0495588_0105831
1177 Ga0495588_0154202
1178 Ga0495658_0090841
1179 Ga0495649_0005389
1180 Ga0495676_0060279
1181 Ga0495687_005310
1182 Ga0495614_0009304
1183 Ga0495615_0020198
1184 Ga0496101_0012749
1185 Ga0496101_0048044
1186 Ga0496102_0067915
1187 Ga0496102_0188930
1188 Ga0496104_0088892
1189 Ga0496105_0066379
1190 Ga0496105_0067270
1191 Ga0496106_0017056
1192 Ga0496106_0105211
1193 Ga0496108_0091338
1194 Ga0496109_0080833
1195 Ga0496110_0127250
1196 Ga0496114_0103630
1197 Ga0496116_0017638
1198 Ga0496116_0021627
1199 Ga0496117_0018643
1200 Ga0496117_0025305
1201 Ga0496117_0113310
1202 Ga0496118_0005780
1203 Ga0496121_0002801
1204 Ga0496121_0013215
1205 Ga0496121_0042409
1206 Ga0496122_0069155
1207 Ga0496123_0146868
1208 Ga0496124_0147685
1209 Ga0496125_0002671
1210 Ga0496125_0014838
1211 Ga0496125_0021834
1212 Ga0496125_0061001
1213 Ga0496125_0086771
1214 Ga0496126_0321916
1215 Ga0501031_0043130
1216 Ga0501034_0227138
1217 Ga0501249_003565
1218 Ga0501225_0003789
1219 nmdc:mga03683_10371_c1
1220 nmdc:mga03683_21049_c1
1221 nmdc:mga03683_6421_c1
1222 nmdc:mga03683_70702_c1
1223 nmdc:mga03683_74745_c1
1224 nmdc:mga03n38_184772_c1
1225 nmdc:mga00v17_144307_c1
1226 nmdc:mga00v17_19953_c1
1227 nmdc:mga0yw44_7818_c1
1228 nmdc:mga0k408_13401_c1
1229 nmdc:mga0k408_141384_c1
1230 nmdc:mga0k408_14774_c1
1231 nmdc:mga0k408_39477_c1
1232 nmdc:mga0k408_51651_c1
1233 nmdc:mga0k408_5868_c1
1234 nmdc:mga0k408_6926_c1
1235 nmdc:mga0k408_79998_c1
1236 nmdc:mga06z11_146377_c1
1237 nmdc:mga06z11_81246_c1
1238 nmdc:mga04h51_14787_c1
1239 nmdc:mga07m45_11400_c1
1240 nmdc:mga07m45_131044_c1
1241 nmdc:mga07m45_20133_c1
1242 nmdc:mga07m45_25742_c1
1243 nmdc:mga07m45_32352_c1
1244 nmdc:mga07m45_36240_c1
1245 nmdc:mga07m45_61715_c1
1246 nmdc:mga07m45_8902_c1
1247 nmdc:mga05p37_58073_c1
1248 nmdc:mga09592_101130_c1
1249 nmdc:mga0qj67_325226_c1
1250 nmdc:mga0qj67_851_c1
1251 nmdc:mga0sz30_21518_c1
1252 nmdc:mga0sz30_8040_c1
1253 Ga0500610_0004579
1254 Ga0500610_0006383
1255 Ga0500644_0014012
1256 Ga0500646_0001449
1257 Ga0500583_0013199
1258 Ga0500651_0000169
1259 Ga0500651_0038181
1260 Ga0500650_0055005
1261 Ga0500571_003984
1262 Ga0500594_0030322
1263 Ga0500607_010031
1264 Ga0500607_074334
1265 Ga0500608_006441
1266 Ga0500655_006786
1267 Ga0500658_0001494
1268 Ga0500658_0003092
1269 Ga0500559_0000339
1270 Ga0500568_0002114
1271 Ga0500574_006630
1272 Ga0500588_0026567
1273 Ga0500616_0044193
1274 Ga0500622_0018453
1275 Ga0500634_0037851
1276 Ga0500638_044852
1277 Ga0500645_000657
1278 2511243526
1279 2513227334
1280 2548499287
1281 2599627101
1282 2599676538
1283 2599684806
1284 2599696758
1285 2643866120
1286 2643994110
1287 2644057656
1288 2644072257
1289 2644160062
1290 2644292934
1291 2644302030
1292 2644329451
1293 2644401027
1294 2644464277
1295 2644466352
1296 2644647950
1297 2738723459
1298 2738882241
1299 2739241930
1300 2739251219
1301 2739284190
1302 2816470768
1303 2819598170
1304 2831269157
1305 2838058587
1306 2842682426
1307 2885196442
1308 2885200022
1309 2885213748
1310 2899929592
1311 2904456405
1312 2904462914
1313 2904549062
1314 2919465832
1315 2919706166
1316 2928039965
1317 2928047286
1318 2928057510
1319 2928068104
1320 2928072689
1321 2928085852
1322 2928120191
1323 2929160690
1324 2929523769
1325 2939634122
1326 2945914814
1327 2945951121
1328 2945974221
1329 2945989787
1330 2990714175

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

66

322

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.2328 22 288
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.2238 22 288
8j7w-assembly1.cif.gz_A cryo-em structure of hznt7-fab complex in zinc state 2, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-bound conformation 0.2224 14 210
5jdl-assembly1.cif.gz_A structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 1mm sr2+ 0.2027 49 255
5jdq-assembly1.cif.gz_A structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and 10mm sr2+ 0.1996 30 255
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.696 66 287 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6606 49 283 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6459 49 283 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6457 49 283 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6331 49 279 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3C1TUR0-F1-model_v4 deleted 0.9465 49 221
AF-A0A3C1TUR0-F1-model_v4 deleted 0.9259 49 221
AF-A0A2V7G0E4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9134 49 208 GO:0005886
GO:0015658
AF-A0A5N5E3J3-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.8836 49 218 GO:0005886
GO:0015658
AF-X1KHB3-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8639 49 240 GO:0005886
GO:0015658

Map