F473694

General Info

Members Datasets Scaffolds Average Seq Length
665 314 1330 167

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10606851|Ga0105237_106068512
Length 188
Sequence LDALVELCFNFIDSLNLFREIHMDLKSVQKPLKDRYRSDPASSRITLVAKGGQTDVPISCSVDIGRAIYNAEAHTGVGGAGTSACSGDLLLGALAACAQITCQMVATAMGIQTERIEVTVEGEMDLRGTLGVSKEVPVGFQAMRLRFAIAAPQATPEQLRALCEKSEQYCVVLQTLAHPPKLEIQWHR

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
219 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
281 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
282 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
283 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
286 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
287 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
288 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
289 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
290 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
291 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
292 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
296 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
297 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
300 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 6.17
Rhizosphere 92.33
Stem 0
Stem Tuber 0
Unclassified 21.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10606851 3300009545 Bacteria 1101
2 JGI25406J46586_10013510 3300003203 Bacteria 3503
3 JGI25406J46586_10023350 3300003203 Bacteria 2444
4 rootH1_10035651 3300003323 Bacteria 1337
5 Ga0065712_10021464 3300005290 Bacteria 1723
6 Ga0065715_10260204 3300005293 Bacteria 1140
7 Ga0070690_100570570 3300005330 Unclassified 855
8 Ga0070690_100634306 3300005330 Bacteria 814
9 Ga0070677_10160553 3300005333 Bacteria 1054
10 Ga0068869_100059875 3300005334 Bacteria 2789
11 Ga0068869_100357555 3300005334 Archaea 1192
12 Ga0068869_101353632 3300005334 Unclassified 629
13 Ga0070666_10097012 3300005335 Bacteria 2029
14 Ga0070666_10169726 3300005335 Bacteria 1527
15 Ga0070680_100000225 3300005336 Bacteria 37311
16 Ga0070680_100008524 3300005336 Bacteria 7852
17 Ga0070680_100156043 3300005336 Bacteria 1917
18 Ga0068868_100007947 3300005338 Bacteria 7578
19 Ga0068868_100010336 3300005338 Bacteria 6749
20 Ga0068868_100066443 3300005338 Bacteria 2867
21 Ga0068868_100093047 3300005338 Bacteria 2430
22 Ga0070660_100014363 3300005339 Bacteria 5702
23 Ga0070689_100249907 3300005340 Unclassified 1463
24 Ga0070691_10679162 3300005341 Bacteria 616
25 Ga0070692_10072915 3300005345 Bacteria 1833
26 Ga0070675_100056436 3300005354 Bacteria 3237
27 Ga0070671_100010848 3300005355 Bacteria 7311
28 Ga0070671_100018136 3300005355 Bacteria 5715
29 Ga0070671_100093492 3300005355 Bacteria 2520
30 Ga0070671_100254224 3300005355 Unclassified 1493
31 Ga0070674_100131946 3300005356 Bacteria 1864
32 Ga0070674_100624215 3300005356 Bacteria 913
33 Ga0070673_100140295 3300005364 Bacteria 2038
34 Ga0070673_101331583 3300005364 Unclassified 675
35 Ga0070659_100119506 3300005366 Bacteria 2133
36 Ga0070659_100245221 3300005366 Bacteria 1484
37 Ga0070667_101506752 3300005367 Bacteria 632
38 Ga0070667_101707819 3300005367 Unclassified 592
39 Ga0070709_10173097 3300005434 Bacteria 1510
40 Ga0070714_100000153 3300005435 Bacteria 55413
41 Ga0070714_100005905 3300005435 Bacteria 9392
42 Ga0070710_10025311 3300005437 Unclassified 3142
43 Ga0070711_100009386 3300005439 Bacteria 6026
44 Ga0070711_100022718 3300005439 Bacteria 4069
45 Ga0070711_100042584 3300005439 Bacteria 3070
46 Ga0070700_100000044 3300005441 Bacteria 98346
47 Ga0070700_100241637 3300005441 Unclassified 1291
48 Ga0070694_100026248 3300005444 Bacteria 3774
49 Ga0070694_100235020 3300005444 Bacteria 1380
50 Ga0070694_100310817 3300005444 Unclassified 1210
51 Ga0070694_100630345 3300005444 Bacteria 866
52 Ga0070708_100037429 3300005445 Bacteria 4233
53 Ga0070708_100066779 3300005445 Bacteria 3228
54 Ga0070663_100783914 3300005455 Unclassified 816
55 Ga0070681_10000648 3300005458 Bacteria 28721
56 Ga0070681_10113620 3300005458 Bacteria 2647
57 Ga0070681_10125205 3300005458 Bacteria 2502
58 Ga0070681_10482167 3300005458 Bacteria 1153
59 Ga0068867_100177075 3300005459 Bacteria 1693
60 Ga0068867_100394760 3300005459 Bacteria 1165
61 Ga0070706_100023537 3300005467 Bacteria 5673
62 Ga0070706_100075694 3300005467 Bacteria 3115
63 Ga0070707_100138269 3300005468 Unclassified 2370
64 Ga0070707_100151178 3300005468 Bacteria 2260
65 Ga0070707_100301251 3300005468 Unclassified 1558
66 Ga0070698_100824916 3300005471 Unclassified 872
67 Ga0070699_100001836 3300005518 Bacteria 19270
68 Ga0070699_100190843 3300005518 Bacteria 1820
69 Ga0070679_100000701 3300005530 Bacteria 28741
70 Ga0070679_100029901 3300005530 Bacteria 5375
71 Ga0070684_100305471 3300005535 Unclassified 1460
72 Ga0070697_100025562 3300005536 Bacteria 4709
73 Ga0070697_101359924 3300005536 Unclassified 634
74 Ga0068853_100111297 3300005539 Bacteria 2433
75 Ga0068853_101399420 3300005539 Unclassified 676
76 Ga0070686_100006768 3300005544 Bacteria 6381
77 Ga0070686_100224394 3300005544 Bacteria 1359
78 Ga0070686_101351417 3300005544 Unclassified 596
79 Ga0070695_100459563 3300005545 Bacteria 977
80 Ga0070696_100020188 3300005546 Bacteria 4517
81 Ga0070696_100042129 3300005546 Bacteria 3156
82 Ga0070696_100042478 3300005546 Bacteria 3142
83 Ga0070696_100073278 3300005546 Unclassified 2412
84 Ga0070696_100593131 3300005546 Bacteria 892
85 Ga0070696_100619234 3300005546 Bacteria 874
86 Ga0070693_100052598 3300005547 Bacteria 2335
87 Ga0070693_100366968 3300005547 Unclassified 989
88 Ga0070693_100388042 3300005547 Bacteria 965
89 Ga0070665_100000553 3300005548 Bacteria 52206
90 Ga0070665_100063388 3300005548 Bacteria 3706
91 Ga0070665_100113461 3300005548 Bacteria 2713
92 Ga0070665_100357169 3300005548 Unclassified 1467
93 Ga0070665_101598264 3300005548 Bacteria 660
94 Ga0070704_100182483 3300005549 Bacteria 1680
95 Ga0068855_100001324 3300005563 Bacteria 30667
96 Ga0068855_100745350 3300005563 Bacteria 1045
97 Ga0068855_101057451 3300005563 Unclassified 850
98 Ga0070664_100288288 3300005564 Bacteria 1482
99 Ga0070664_100656238 3300005564 Bacteria 975
100 Ga0068857_100045596 3300005577 Bacteria 3890
101 Ga0068857_100084722 3300005577 Unclassified 2832
102 Ga0068857_100643308 3300005577 Archaea 1004
103 Ga0068856_100016145 3300005614 Bacteria 7220
104 Ga0068856_100376414 3300005614 Unclassified 1439
105 Ga0070702_100372556 3300005615 Bacteria 1013
106 Ga0068852_100089815 3300005616 Bacteria 2746
107 Ga0068859_100011796 3300005617 Bacteria 8780
108 Ga0068859_100014153 3300005617 Bacteria 8000
109 Ga0068859_100050073 3300005617 Plasmid 4196
110 Ga0068859_100592343 3300005617 Unclassified 1202
111 Ga0068859_100765298 3300005617 Unclassified 1054
112 Ga0068859_101359983 3300005617 Bacteria 783
113 Ga0068864_100006149 3300005618 Bacteria 9846
114 Ga0068864_100064001 3300005618 Bacteria 3188
115 Ga0068864_100136540 3300005618 Bacteria 2209
116 Ga0068864_100481889 3300005618 Bacteria 1191
117 Ga0068864_100575830 3300005618 Bacteria 1090
118 Ga0068864_101044749 3300005618 Unclassified 811
119 Ga0068866_10156381 3300005718 Bacteria 1325
120 Ga0068851_10076960 3300005834 Bacteria 1736
121 Ga0068851_10238448 3300005834 Bacteria 1027
122 Ga0068851_10282102 3300005834 Bacteria 950
123 Ga0068870_10572250 3300005840 Unclassified 764
124 Ga0068863_100003434 3300005841 Bacteria 15614
125 Ga0068863_100010998 3300005841 Bacteria 8776
126 Ga0068863_100073402 3300005841 Bacteria 3237
127 Ga0068863_100146170 3300005841 Bacteria 2261
128 Ga0068863_100571457 3300005841 Bacteria 1117
129 Ga0068858_100784710 3300005842 Bacteria 929
130 Ga0068858_100817395 3300005842 Unclassified 910
131 Ga0068858_101257875 3300005842 Unclassified 728
132 Ga0068858_101299010 3300005842 Unclassified 716
133 Ga0068860_100182476 3300005843 Archaea 2028
134 Ga0068860_100313036 3300005843 Bacteria 1540
135 Ga0068860_100473687 3300005843 Unclassified 1247
136 Ga0068860_100506284 3300005843 Bacteria 1206
137 Ga0068860_101021191 3300005843 Bacteria 845
138 Ga0081455_10571136 3300005937 Unclassified 743
139 Ga0070717_10060192 3300006028 Bacteria 3144
140 Ga0075365_10002558 3300006038 Bacteria 8975
141 Ga0075364_10055668 3300006051 Bacteria 2588
142 Ga0070716_100017067 3300006173 Bacteria 3757
143 Ga0070716_100224539 3300006173 Bacteria 1264
144 Ga0070712_100025989 3300006175 Bacteria 3896
145 Ga0070712_100041841 3300006175 Unclassified 3148
146 Ga0070712_100447653 3300006175 Bacteria 1075
147 Ga0075367_10060098 3300006178 Bacteria 2265
148 Ga0097621_100005123 3300006237 Bacteria 9207
149 Ga0097621_100006497 3300006237 Bacteria 8304
150 Ga0097621_100118888 3300006237 Bacteria 2240
151 Ga0097621_100147926 3300006237 Bacteria 2013
152 Ga0097621_100154509 3300006237 Bacteria 1969
153 Ga0097621_100273609 3300006237 Bacteria 1485
154 Ga0068871_100001057 3300006358 Bacteria 18467
155 Ga0068871_100012888 3300006358 Bacteria 6191
156 Ga0068871_100038878 3300006358 Bacteria 3804
157 Ga0068871_100325479 3300006358 Bacteria 1354
158 Ga0068871_100576292 3300006358 Unclassified 1021
159 Ga0075433_10016419 3300006852 Bacteria 6102
160 Ga0075433_10039129 3300006852 Unclassified 4099
161 Ga0075433_10078233 3300006852 Bacteria 2914
162 Ga0075433_10107852 3300006852 Bacteria 2469
163 Ga0075433_10245470 3300006852 Unclassified 1589
164 Ga0075433_11396388 3300006852 Unclassified 606
165 Ga0075434_100035525 3300006871 Bacteria 4928
166 Ga0075434_100219041 3300006871 Unclassified 1923
167 Ga0075434_100271899 3300006871 Unclassified 1714
168 Ga0075434_100406503 3300006871 Unclassified 1382
169 Ga0075434_100913004 3300006871 Bacteria 893
170 Ga0075434_101090983 3300006871 Bacteria 811
171 Ga0075434_101562688 3300006871 Unclassified 668
172 Ga0068865_100360323 3300006881 Bacteria 1181
173 Ga0068865_100533990 3300006881 Archaea 983
174 Ga0075436_100100346 3300006914 Bacteria 2016
175 Ga0075436_100193287 3300006914 Bacteria 1440
176 Ga0075436_100245065 3300006914 Bacteria 1275
177 Ga0075436_100890451 3300006914 Unclassified 665
178 Ga0097620_100011797 3300006931 Bacteria 8780
179 Ga0097620_100014153 3300006931 Bacteria 8000
180 Ga0097620_100050071 3300006931 Plasmid 4196
181 Ga0097620_100592401 3300006931 Unclassified 1202
182 Ga0097620_100765241 3300006931 Unclassified 1054
183 Ga0097620_101360111 3300006931 Bacteria 783
184 Ga0075435_100023334 3300007076 Bacteria 4783
185 Ga0075435_100044156 3300007076 Unclassified 3569
186 Ga0075435_100080899 3300007076 Bacteria 2668
187 Ga0075435_100140219 3300007076 Bacteria 2028
188 Ga0075435_100432400 3300007076 Bacteria 1134
189 Ga0075435_100652441 3300007076 Unclassified 913
190 Ga0075435_100901822 3300007076 Bacteria 771
191 Ga0105251_10109541 3300009011 Bacteria 1259
192 Ga0105240_10002142 3300009093 Bacteria 32242
193 Ga0105240_10188098 3300009093 Bacteria 2430
194 Ga0105240_10307229 3300009093 Unclassified 1812
195 Ga0105240_10386710 3300009093 Unclassified 1579
196 Ga0105240_10417414 3300009093 Unclassified 1508
197 Ga0105240_11823357 3300009093 Bacteria 634
198 Ga0111539_10112558 3300009094 Unclassified 3193
199 Ga0105245_10003265 3300009098 Bacteria 14548
200 Ga0105245_10023414 3300009098 Bacteria 5421
201 Ga0105245_10353368 3300009098 Unclassified 1457
202 Ga0105245_11049135 3300009098 Bacteria 860
203 Ga0105245_11292568 3300009098 Bacteria 778
204 Ga0114129_10006321 3300009147 Bacteria 16799
205 Ga0114129_10049726 3300009147 Bacteria 5890
206 Ga0114129_10098551 3300009147 Bacteria 4046
207 Ga0114129_10665486 3300009147 Bacteria 1342
208 Ga0105243_10061701 3300009148 Bacteria 2999
209 Ga0105243_10402121 3300009148 Unclassified 1272
210 Ga0105243_11735532 3300009148 Bacteria 654
211 Ga0105241_10048893 3300009174 Bacteria 3220
212 Ga0105241_10694835 3300009174 Unclassified 928
213 Ga0105241_10788022 3300009174 Unclassified 875
214 Ga0105241_11042512 3300009174 Unclassified 767
215 Ga0105242_10014948 3300009176 Bacteria 6017
216 Ga0105242_10061453 3300009176 Unclassified 3090
217 Ga0105242_10199794 3300009176 Bacteria 1775
218 Ga0105248_10000795 3300009177 Bacteria 35418
219 Ga0105248_10013938 3300009177 Bacteria 8846
220 Ga0105248_10020847 3300009177 Bacteria 7262
221 Ga0105248_10036209 3300009177 Bacteria 5519
222 Ga0105248_10471203 3300009177 Unclassified 1416
223 Ga0105248_11636295 3300009177 Bacteria 730
224 Ga0105248_11882039 3300009177 Bacteria 679
225 Ga0105237_10241270 3300009545 Bacteria 1808
226 Ga0105237_10259484 3300009545 Bacteria 1740
227 Ga0105237_10316175 3300009545 Bacteria 1565
228 Ga0105237_10650758 3300009545 Bacteria 1061
229 Ga0105238_10002104 3300009551 Bacteria 20114
230 Ga0105238_10034305 3300009551 Bacteria 5163
231 Ga0105238_10341312 3300009551 Unclassified 1486
232 Ga0105238_10457064 3300009551 Bacteria 1274
233 Ga0105249_10042155 3300009553 Bacteria 4150
234 Ga0105249_10079139 3300009553 Bacteria 3051
235 Ga0105249_10220825 3300009553 Bacteria 1865
236 Ga0105249_11358190 3300009553 Bacteria 782
237 Ga0105239_10012317 3300010375 Bacteria 9524
238 Ga0105239_10025787 3300010375 Bacteria 6474
239 Ga0105239_10076376 3300010375 Bacteria 3684
240 Ga0105239_10220337 3300010375 Unclassified 2128
241 Ga0105239_10267650 3300010375 Bacteria 1922
242 Ga0105239_10339965 3300010375 Bacteria 1694
243 Ga0105239_10782790 3300010375 Bacteria 1093
244 Ga0105246_10249115 3300011119 Unclassified 1409
245 Ga0105246_10274630 3300011119 Bacteria 1349
246 Ga0157373_10012071 3300013100 Bacteria 6349
247 Ga0157373_10035184 3300013100 Bacteria 3597
248 Ga0157369_10001363 3300013105 Bacteria 30141
249 Ga0157369_10210657 3300013105 Bacteria 2037
250 Ga0157369_10253949 3300013105 Unclassified 1834
251 Ga0157369_10293737 3300013105 Bacteria 1691
252 Ga0157374_10103924 3300013296 Bacteria 2727
253 Ga0157374_10307336 3300013296 Unclassified 1570
254 Ga0157374_10313955 3300013296 Bacteria 1552
255 Ga0157374_10416546 3300013296 Bacteria 1342
256 Ga0157374_10605380 3300013296 Bacteria 1106
257 Ga0157378_10001534 3300013297 Bacteria 20875
258 Ga0157378_10004237 3300013297 Bacteria 12651
259 Ga0157378_10034725 3300013297 Bacteria 4459
260 Ga0157378_10856221 3300013297 Unclassified 938
261 Ga0157378_11150119 3300013297 Bacteria 814
262 Ga0163162_10003234 3300013306 Bacteria 15592
263 Ga0163162_10076885 3300013306 Bacteria 3401
264 Ga0157372_10000968 3300013307 Bacteria 31318
265 Ga0157372_10030428 3300013307 Bacteria 5907
266 Ga0157372_10058846 3300013307 Unclassified 4296
267 Ga0157372_10124166 3300013307 Bacteria 2967
268 Ga0157372_10145411 3300013307 Bacteria 2734
269 Ga0157372_10466500 3300013307 Bacteria 1472
270 Ga0157372_11483027 3300013307 Bacteria 781
271 Ga0157375_10026570 3300013308 Bacteria 5398
272 Ga0157375_10236815 3300013308 Bacteria 1985
273 Ga0157375_12216720 3300013308 Unclassified 654
274 Ga0163163_10018109 3300014325 Bacteria 6583
275 Ga0163163_10169290 3300014325 Bacteria 2231
276 Ga0163163_10259009 3300014325 Bacteria 1790
277 Ga0163163_10292773 3300014325 Bacteria 1680
278 Ga0163163_10608493 3300014325 Bacteria 1156
279 Ga0163163_10644678 3300014325 Bacteria 1123
280 Ga0163163_11454031 3300014325 Bacteria 747
281 Ga0163163_12639076 3300014325 Unclassified 560
282 Ga0157380_10411074 3300014326 Bacteria 1287
283 Ga0182008_10069326 3300014497 Bacteria 1735
284 Ga0182008_10392630 3300014497 Unclassified 744
285 Ga0157379_10153196 3300014968 Bacteria 2079
286 Ga0157379_10215741 3300014968 Unclassified 1738
287 Ga0157379_10431137 3300014968 Bacteria 1215
288 Ga0157379_11234462 3300014968 Bacteria 720
289 Ga0157376_10000026 3300014969 Bacteria 204319
290 Ga0157376_10013954 3300014969 Bacteria 6010
291 Ga0157376_10034985 3300014969 Unclassified 4060
292 Ga0157376_10253261 3300014969 Bacteria 1646
293 Ga0157376_10305084 3300014969 Bacteria 1508
294 Ga0163161_10797167 3300017792 Bacteria 794
295 Ga0206353_12057520 3300020082 Bacteria 3439
296 Ga0207656_10075198 3300025321 Bacteria 1508
297 Ga0207692_10060566 3300025898 Unclassified 1958
298 Ga0207642_10167115 3300025899 Bacteria 1187
299 Ga0207710_10019512 3300025900 Bacteria 2892
300 Ga0207680_10480122 3300025903 Archaea 884
301 Ga0207680_10510747 3300025903 Bacteria 856
302 Ga0207680_10574600 3300025903 Unclassified 805
303 Ga0207647_10025040 3300025904 Bacteria 3929
304 Ga0207645_10282349 3300025907 Archaea 1103
305 Ga0207643_10210148 3300025908 Bacteria 1187
306 Ga0207684_10010899 3300025910 Bacteria 7972
307 Ga0207684_10020308 3300025910 Bacteria 5675
308 Ga0207654_10018842 3300025911 Bacteria 3629
309 Ga0207654_10094080 3300025911 Bacteria 1833
310 Ga0207654_10145146 3300025911 Unclassified 1518
311 Ga0207654_10208062 3300025911 Bacteria 1292
312 Ga0207707_10000118 3300025912 Bacteria 80806
313 Ga0207707_10062960 3300025912 Bacteria 3229
314 Ga0207707_10627623 3300025912 Archaea 907
315 Ga0207695_10000161 3300025913 Bacteria 199839
316 Ga0207695_10003501 3300025913 Bacteria 22022
317 Ga0207671_10047881 3300025914 Unclassified 3164
318 Ga0207671_10120363 3300025914 Bacteria 2006
319 Ga0207671_10201448 3300025914 Bacteria 1555
320 Ga0207671_10320577 3300025914 Bacteria 1226
321 Ga0207671_10382802 3300025914 Bacteria 1118
322 Ga0207671_11203233 3300025914 Unclassified 593
323 Ga0207693_10002784 3300025915 Bacteria 15138
324 Ga0207693_10023987 3300025915 Unclassified 4843
325 Ga0207663_10010639 3300025916 Bacteria 4907
326 Ga0207663_10969356 3300025916 Unclassified 681
327 Ga0207660_10001266 3300025917 Bacteria 16963
328 Ga0207660_10010755 3300025917 Bacteria 5946
329 Ga0207657_10052328 3300025919 Bacteria 3544
330 Ga0207652_10000634 3300025921 Bacteria 34768
331 Ga0207652_10078694 3300025921 Plasmid 2879
332 Ga0207652_10125259 3300025921 Bacteria 2288
333 Ga0207646_10007680 3300025922 Bacteria 10920
334 Ga0207646_10132153 3300025922 Bacteria 2247
335 Ga0207646_10297967 3300025922 Bacteria 1457
336 Ga0207646_10714892 3300025922 Bacteria 895
337 Ga0207681_11259606 3300025923 Archaea 621
338 Ga0207694_10002057 3300025924 Bacteria 16642
339 Ga0207694_10474237 3300025924 Bacteria 1046
340 Ga0207650_11003767 3300025925 Unclassified 710
341 Ga0207659_10077378 3300025926 Bacteria 2448
342 Ga0207687_10025011 3300025927 Unclassified 3994
343 Ga0207687_10066997 3300025927 Unclassified 2553
344 Ga0207700_10657840 3300025928 Bacteria 934
345 Ga0207664_10000117 3300025929 Bacteria 69794
346 Ga0207664_11512216 3300025929 Unclassified 593
347 Ga0207644_10017926 3300025931 Bacteria 4788
348 Ga0207644_10022847 3300025931 Bacteria 4276
349 Ga0207644_10477534 3300025931 Bacteria 1026
350 Ga0207690_10114246 3300025932 Bacteria 1950
351 Ga0207690_10250151 3300025932 Bacteria 1369
352 Ga0207690_11195497 3300025932 Unclassified 635
353 Ga0207706_10000098 3300025933 Bacteria 91173
354 Ga0207686_10022860 3300025934 Bacteria 3604
355 Ga0207686_10105472 3300025934 Bacteria 1890
356 Ga0207686_10193858 3300025934 Bacteria 1450
357 Ga0207669_11160759 3300025937 Unclassified 653
358 Ga0207704_10426535 3300025938 Archaea 1053
359 Ga0207665_10016356 3300025939 Bacteria 4870
360 Ga0207665_10056988 3300025939 Bacteria 2639
361 Ga0207711_10004621 3300025941 Bacteria 11706
362 Ga0207711_10041506 3300025941 Bacteria 3918
363 Ga0207711_10062434 3300025941 Bacteria 3214
364 Ga0207711_10086711 3300025941 Unclassified 2746
365 Ga0207689_10042414 3300025942 Bacteria 3764
366 Ga0207689_10073869 3300025942 Bacteria 2802
367 Ga0207689_10346172 3300025942 Bacteria 1235
368 Ga0207661_10314685 3300025944 Archaea 1406
369 Ga0207679_10033676 3300025945 Bacteria 3607
370 Ga0207679_10053039 3300025945 Bacteria 2977
371 Ga0207667_10002772 3300025949 Bacteria 21680
372 Ga0207667_10004035 3300025949 Bacteria 18038
373 Ga0207667_10239833 3300025949 Unclassified 1856
374 Ga0207667_11584407 3300025949 Unclassified 624
375 Ga0207651_10092323 3300025960 Bacteria 2220
376 Ga0207651_11299559 3300025960 Unclassified 654
377 Ga0207712_10088186 3300025961 Unclassified 2277
378 Ga0207640_10102368 3300025981 Bacteria 2011
379 Ga0207640_11281524 3300025981 Unclassified 654
380 Ga0207658_11472157 3300025986 Bacteria 623
381 Ga0207677_10080699 3300026023 Bacteria 2331
382 Ga0207677_10411710 3300026023 Archaea 1149
383 Ga0207677_10919937 3300026023 Unclassified 789
384 Ga0207677_11062836 3300026023 Bacteria 736
385 Ga0207703_10125628 3300026035 Bacteria 2208
386 Ga0207703_10554528 3300026035 Bacteria 1084
387 Ga0207703_10593937 3300026035 Unclassified 1047
388 Ga0207639_10059693 3300026041 Bacteria 2939
389 Ga0207639_10109335 3300026041 Bacteria 2249
390 Ga0207639_10632111 3300026041 Archaea 989
391 Ga0207678_10016641 3300026067 Bacteria 6460
392 Ga0207678_10569599 3300026067 Unclassified 991
393 Ga0207708_10000031 3300026075 Bacteria 155478
394 Ga0207708_10056643 3300026075 Bacteria 2990
395 Ga0207702_10025497 3300026078 Bacteria 4907
396 Ga0207702_10028768 3300026078 Bacteria 4621
397 Ga0207702_10321672 3300026078 Bacteria 1473
398 Ga0207641_10065836 3300026088 Bacteria 3100
399 Ga0207641_10157634 3300026088 Bacteria 2061
400 Ga0207641_10265296 3300026088 Bacteria 1609
401 Ga0207641_10334313 3300026088 Bacteria 1440
402 Ga0207641_10426578 3300026088 Unclassified 1278
403 Ga0207648_10266471 3300026089 Bacteria 1529
404 Ga0207676_10076768 3300026095 Bacteria 2700
405 Ga0207676_10092291 3300026095 Bacteria 2490
406 Ga0207676_10542893 3300026095 Bacteria 1110
407 Ga0207676_10583978 3300026095 Bacteria 1071
408 Ga0207676_11509042 3300026095 Bacteria 669
409 Ga0207674_10032011 3300026116 Bacteria 5519
410 Ga0207674_10036323 3300026116 Bacteria 5136
411 Ga0207683_10028265 3300026121 Bacteria 4848
412 Ga0207683_10613446 3300026121 Bacteria 1007
413 Ga0207698_10196507 3300026142 Unclassified 1802
414 Ga0209995_1003113 3300027471 Bacteria 2634
415 Ga0209968_1000323 3300027526 Bacteria 8012
416 Ga0210002_1046585 3300027617 Bacteria 743
417 Ga0209983_1000088 3300027665 Bacteria 14848
418 Ga0209998_10001783 3300027717 Bacteria 5096
419 Ga0209813_10016179 3300027866 Archaea 2032
420 Ga0209974_10000056 3300027876 Bacteria 29313
421 Ga0268266_10000140 3300028379 Bacteria 140387
422 Ga0268266_10013233 3300028379 Bacteria 7113
423 Ga0268266_10077469 3300028379 Bacteria 2891
424 Ga0268266_10447011 3300028379 Bacteria 1228
425 Ga0268266_11415729 3300028379 Bacteria 671
426 Ga0268264_10131768 3300028381 Bacteria 2217
427 Ga0268264_10532208 3300028381 Archaea 1150
428 Ga0268264_10803921 3300028381 Bacteria 940
429 Ga0268264_10880573 3300028381 Bacteria 898
430 Ga0265326_10070567 3300028558 Bacteria 988
431 Ga0265319_1006659 3300028563 Bacteria 5319
432 Ga0265318_10024817 3300028577 Bacteria 2373
433 Ga0265318_10055505 3300028577 Bacteria 1482
434 Ga0265322_10007950 3300028654 Bacteria 3093
435 Ga0265322_10009942 3300028654 Bacteria 2760
436 Ga0265336_10027082 3300028666 Bacteria 1797
437 Ga0265336_10048205 3300028666 Bacteria 1292
438 Ga0265338_10039850 3300028800 Bacteria 4422
439 Ga0265324_10002387 3300029957 Bacteria 9669
440 Ga0265324_10151633 3300029957 Bacteria 787
441 Ga0265760_10166152 3300031090 Unclassified 731
442 Ga0265332_10023863 3300031238 Bacteria 2695
443 Ga0265320_10016759 3300031240 Bacteria 4093
444 Ga0265320_10049419 3300031240 Bacteria 2048
445 Ga0265325_10016915 3300031241 Bacteria 4066
446 Ga0265325_10090002 3300031241 Unclassified 1515
447 Ga0265329_10030971 3300031242 Bacteria 1740
448 Ga0265329_10226423 3300031242 Unclassified 620
449 Ga0265340_10012647 3300031247 Bacteria 4455
450 Ga0265339_10004230 3300031249 Bacteria 9838
451 Ga0265339_10012152 3300031249 Bacteria 5269
452 Ga0265339_10043461 3300031249 Bacteria 2485
453 Ga0265331_10075836 3300031250 Bacteria 1567
454 Ga0265331_10214705 3300031250 Bacteria 865
455 Ga0265316_10033154 3300031344 Bacteria 4209
456 Ga0265316_10218137 3300031344 Bacteria 1409
457 Ga0307408_100106921 3300031548 Unclassified 2141
458 Ga0265314_10005816 3300031711 Bacteria 11045
459 Ga0265342_10022696 3300031712 Bacteria 3986
460 Ga0307405_10003463 3300031731 Bacteria 7248
461 Ga0307413_10007482 3300031824 Bacteria 5076
462 Ga0307410_10012068 3300031852 Bacteria 4974
463 Ga0307406_10002945 3300031901 Bacteria 9271
464 Ga0307407_10217720 3300031903 Unclassified 1289
465 Ga0307412_10012215 3300031911 Bacteria 4995
466 Ga0307409_100136418 3300031995 Bacteria 2106
467 Ga0307416_100003432 3300032002 Bacteria 9307
468 Ga0307414_10002214 3300032004 Bacteria 10135
469 Ga0307415_100003854 3300032126 Bacteria 7696
470 Ga0373930_0001154 3300034816 Bacteria 3858
471 Ga0373926_0022333 3300035083 Bacteria 2196
472 Ga0373934_0011159 3300035086 Unclassified 3382
473 Ga0373944_0028028 3300035089 Bacteria 1674
474 Ga0373936_0001799 3300035113 Bacteria 7880
475 Ga0373941_0007323 3300035115 Bacteria 2697
476 Ga0373941_0173862 3300035115 Bacteria 804
477 Ga0373945_0010455 3300035116 Unclassified 3056
478 Ga0373953_0037530 3300035117 Unclassified 1912
479 Ga0373956_0126619 3300035119 Bacteria 1194
480 Ga0373960_0043463 3300035121 Archaea 1309
481 Ga0373943_0000076 3300035170 Bacteria 34863
482 Ga0373943_0034842 3300035170 Bacteria 2403
483 Ga0373946_0025416 3300035171 Bacteria 2328
484 Ga0373955_0447703 3300035172 Unclassified 787
485 Ga0373924_0277611 3300035410 Bacteria 743
486 Ga0373931_0104988 3300035691 Bacteria 1594
487 Ga0373931_0135363 3300035691 Unclassified 1422
488 Ga0373931_0263989 3300035691 Unclassified 1052
489 Ga0373931_0294340 3300035691 Bacteria 1000
490 Ga0373935_0002253 3300035692 Bacteria 10976
491 Ga0373927_0003198 3300035695 Bacteria 11800
492 Ga0373933_0050577 3300035724 Bacteria 2481
493 Ga0373947_0008228 3300035725 Bacteria 6014
494 Ga0373947_0144408 3300035725 Unclassified 1529
495 Ga0373937_0538257 3300036401 Unclassified 1109
496 Ga0373937_1287035 3300036401 Bacteria 679
497 Ga0373937_1501488 3300036401 Unclassified 621
498 Ga0373925_0166676 3300037068 Unclassified 1737
499 Ga0373925_0408112 3300037068 Bacteria 1109
500 Ga0373925_0921860 3300037068 Bacteria 720
501 Ga0395900_0227457 3300037418 Unclassified 1878
502 Ga0395898_0569543 3300037466 Archaea 1075
503 Ga0436364_0703510 3300037853 Bacteria 2799
504 Ga0242419_006994 3300038698 Bacteria 827
505 Ga0242420_002068 3300038996 Bacteria 2812
506 Ga0242420_005962 3300038996 Bacteria 1911
507 Ga0436363_0605540 3300039450 Bacteria 1683
508 Ga0436362_0642670 3300039453 Unclassified 987
509 Ga0451577_0665125 3300042876 Bacteria 944
510 Ga0453683_0132270 3300044673 Bacteria 1573
511 Ga0453683_0653680 3300044673 Unclassified 687
512 Ga0466965_0281917 3300044683 Unclassified 898
513 Ga0466961_0232962 3300044693 Bacteria 1133
514 Ga0466963_0839484 3300044694 Unclassified 648
515 Ga0466971_0137156 3300044719 Unclassified 1138
516 Ga0466960_0224025 3300044901 Archaea 1036
517 Ga0451576_0978489 3300045051 Unclassified 887
518 Ga0466967_0040748 3300045976 Bacteria 4000
519 Ga0466967_1357394 3300045976 Bacteria 708
520 Ga0495592_0276137 3300046454 Bacteria 1101
521 Ga0495592_0725742 3300046454 Unclassified 596
522 Ga0495603_0050624 3300046455 Bacteria 2470
523 Ga0495603_0066443 3300046455 Bacteria 2124
524 Ga0495641_0129233 3300046461 Unclassified 1127
525 Ga0495651_0012398 3300046462 Bacteria 6572
526 Ga0495651_0259188 3300046462 Bacteria 1184
527 Ga0495653_0352283 3300046463 Bacteria 946
528 Ga0495653_0632492 3300046463 Bacteria 655
529 Ga0495580_0008136 3300046472 Bacteria 8359
530 Ga0495580_0099936 3300046472 Bacteria 2018
531 Ga0495580_0134872 3300046472 Unclassified 1712
532 Ga0495582_0153387 3300046473 Unclassified 1308
533 Ga0495582_0547196 3300046473 Bacteria 669
534 Ga0495608_0127368 3300046511 Bacteria 1631
535 Ga0495628_0468616 3300046516 Bacteria 913
536 Ga0495630_0082282 3300046517 Bacteria 2430
537 Ga0495630_0304988 3300046517 Bacteria 1217
538 Ga0495652_0912381 3300046529 Bacteria 579
539 Ga0495645_0091497 3300046543 Bacteria 2173
540 Ga0495634_0593840 3300046642 Unclassified 643
541 Ga0495588_0352448 3300046674 Unclassified 773
542 Ga0495657_0025165 3300046675 Bacteria 4231
543 Ga0495623_0050238 3300046679 Bacteria 2641
544 Ga0495623_0343159 3300046679 Bacteria 815
545 Ga0495646_0170877 3300046680 Bacteria 1198
546 Ga0495647_0002226 3300046681 Bacteria 6073
547 Ga0495647_0015607 3300046681 Bacteria 2664
548 Ga0495658_0029250 3300046683 Bacteria 2981
549 Ga0495658_0091533 3300046683 Unclassified 1802
550 Ga0495669_0171154 3300046684 Bacteria 1033
551 Ga0495669_0399786 3300046684 Unclassified 666
552 Ga0495624_0366652 3300046690 Bacteria 866
553 Ga0495604_0202357 3300047317 Bacteria 1377
554 Ga0495604_0890125 3300047317 Unclassified 557
555 Ga0495674_0014390 3300047319 Bacteria 7406
556 Ga0495674_0069376 3300047319 Bacteria 3048
557 Ga0495676_0029524 3300047321 Bacteria 4667
558 Ga0495680_0059026 3300047322 Bacteria 2963
559 Ga0495680_0081115 3300047322 Bacteria 2450
560 Ga0495684_0423696 3300047471 Bacteria 930
561 Ga0495602_0053920 3300048088 Bacteria 3556
562 Ga0495602_0054853 3300048088 Bacteria 3515
563 Ga0496100_0019195 3300048903 Bacteria 4073
564 Ga0496101_0026163 3300048904 Bacteria 4055
565 Ga0496101_0367755 3300048904 Bacteria 1131
566 Ga0496102_0007757 3300048905 Bacteria 9172
567 Ga0496102_0067659 3300048905 Bacteria 3277
568 Ga0496102_0085143 3300048905 Bacteria 2918
569 Ga0496102_0171241 3300048905 Bacteria 2044
570 Ga0496102_0294729 3300048905 Bacteria 1529
571 Ga0496102_0660061 3300048905 Bacteria 969
572 Ga0496102_0780539 3300048905 Bacteria 878
573 Ga0496103_0011226 3300048906 Bacteria 5306
574 Ga0496103_0171578 3300048906 Bacteria 1393
575 Ga0496104_0168604 3300048907 Bacteria 2099
576 Ga0496104_0829914 3300048907 Bacteria 830
577 Ga0496105_0015608 3300048908 Bacteria 6057
578 Ga0496105_0059599 3300048908 Bacteria 3150
579 Ga0496106_0014317 3300048909 Bacteria 5860
580 Ga0496106_0144980 3300048909 Unclassified 1870
581 Ga0496106_1203391 3300048909 Unclassified 591
582 Ga0496106_1245164 3300048909 Bacteria 579
583 Ga0496107_0036106 3300048910 Bacteria 3544
584 Ga0496107_0204688 3300048910 Archaea 1467
585 Ga0496108_0092007 3300048911 Bacteria 2578
586 Ga0496108_0192289 3300048911 Unclassified 1769
587 Ga0496109_0322245 3300048912 Unclassified 1458
588 Ga0496109_0501470 3300048912 Bacteria 1146
589 Ga0496110_0087391 3300048913 Unclassified 2784
590 Ga0496110_0849022 3300048913 Archaea 818
591 Ga0496111_0008256 3300048914 Bacteria 6884
592 Ga0496112_0016839 3300048915 Bacteria 6858
593 Ga0496112_0530096 3300048915 Unclassified 1112
594 Ga0496113_0024771 3300048916 Bacteria 4270
595 Ga0496113_0153480 3300048916 Unclassified 1818
596 Ga0496113_0237166 3300048916 Bacteria 1455
597 Ga0496113_0397134 3300048916 Archaea 1107
598 Ga0496114_0005109 3300048917 Bacteria 10226
599 Ga0496114_0059314 3300048917 Bacteria 3196
600 Ga0496114_0316017 3300048917 Bacteria 1380
601 Ga0496115_0007814 3300048918 Bacteria 7885
602 Ga0496115_0014042 3300048918 Bacteria 6063
603 Ga0496115_0572417 3300048918 Bacteria 901
604 Ga0501032_0428956 3300049569 Bacteria 848
605 Ga0501042_0048199 3300049578 Bacteria 3038
606 Ga0501046_0242155 3300049580 Bacteria 1330
607 Ga0501072_0141236 3300049588 Bacteria 1920
608 Ga0501075_0081291 3300049591 Bacteria 2453
609 Ga0501076_0331657 3300049592 Bacteria 1248
610 Ga0501198_000195 3300049649 Bacteria 7896
611 Ga0501202_004292 3300049652 Bacteria 2493
612 Ga0501209_026628 3300049656 Unclassified 1429
613 Ga0501216_002413 3300049660 Bacteria 2651
614 Ga0501217_001335 3300049661 Bacteria 4592
615 Ga0501223_001390 3300049663 Bacteria 5588
616 Ga0501227_000809 3300049665 Bacteria 6827
617 Ga0501233_000838 3300049668 Bacteria 5170
618 Ga0501235_002441 3300049669 Bacteria 4009
619 Ga0501240_014815 3300049673 Unclassified 1100
620 Ga0501219_002524 3300049703 Unclassified 1395
621 Ga0501225_0000510 3300049705 Bacteria 12115
622 Ga0501245_014151 3300049708 Unclassified 1188
623 Ga0501080_0540260 3300049742 Bacteria 1039
624 Ga0501081_0629868 3300049743 Bacteria 803
625 Ga0501266_010081 3300049763 Unclassified 1199
626 Ga0501272_017345 3300049769 Unclassified 847
627 Ga0501273_012544 3300049770 Unclassified 1070
628 Ga0501045_0307799 3300049824 Bacteria 1179
629 Ga0501212_001603 3300049851 Bacteria 2578
630 Ga0501226_002234 3300049853 Bacteria 2388
631 nmdc:mga00v17_156567_c1 3300050491 Archaea 1465
632 nmdc:mga06z11_178419_c1 3300050494 Unclassified 1223
633 nmdc:mga04h51_93511_c1 3300050495 Archaea 1085
634 nmdc:mga05p37_132501_c1 3300050507 Bacteria 3058
635 nmdc:mga05p37_16070_c1 3300050507 Bacteria 6916
636 nmdc:mga05p37_584184_c1 3300050507 Bacteria 1264
637 nmdc:mga0n895_222725_c1 3300050512 Unclassified 1915
638 nmdc:mga0n895_49063_c1 3300050512 Bacteria 4134
639 nmdc:mga0n895_525483_c1 3300050512 Bacteria 1191
640 nmdc:mga0n895_653548_c1 3300050512 Bacteria 1050
641 nmdc:mga0n895_67494_c1 3300050512 Unclassified 3542
642 nmdc:mga0n895_7742_c1 3300050512 Bacteria 9249
643 nmdc:mga0n895_89539_c1 3300050512 Bacteria 3078
644 nmdc:mga0rr50_1115552_c1 3300050513 Archaea 671
645 nmdc:mga0rr50_64894_c1 3300050513 Bacteria 2764
646 nmdc:mga0rr50_68354_c1 3300050513 Unclassified 2701
647 nmdc:mga0rr50_71026_c1 3300050513 Bacteria 2655
648 nmdc:mga08x19_153338_c1 3300050514 Bacteria 1561
649 nmdc:mga08x19_459607_c1 3300050514 Bacteria 896
650 nmdc:mga08x19_852868_c1 3300050514 Bacteria 647
651 nmdc:mga0a205_140210_c1 3300050515 Archaea 2318
652 nmdc:mga0a205_228716_c1 3300050515 Unclassified 1744
653 nmdc:mga0a205_369473_c1 3300050515 Bacteria 1300
654 nmdc:mga0a205_396652_c1 3300050515 Unclassified 1244
655 nmdc:mga0a205_53255_c1 3300050515 Bacteria 3906
656 nmdc:mga0a205_69738_c1 3300050515 Bacteria 3394
657 nmdc:mga0a205_78669_c1 3300050515 Bacteria 3186
658 Ga0495601_0060089 3300053077 Bacteria 2411
659 Ga0495601_0210909 3300053077 Bacteria 1269
660 Ga0495612_0257745 3300053078 Unclassified 777
661 Ga0495619_0034713 3300053085 Bacteria 3280
662 Ga0495619_0060154 3300053085 Bacteria 2524
663 Ga0501084_0601354 3300054114 Bacteria 929
664 Ga0501082_1634027 3300060353 Archaea 562
665 Ga0530510_0026141 3300061734 Bacteria 4176
666 Ga0105237_10606851
667 JGI25406J46586_10013510
668 JGI25406J46586_10023350
669 rootH1_10035651
670 Ga0065712_10021464
671 Ga0065715_10260204
672 Ga0070690_100570570
673 Ga0070690_100634306
674 Ga0070677_10160553
675 Ga0068869_100059875
676 Ga0068869_100357555
677 Ga0068869_101353632
678 Ga0070666_10097012
679 Ga0070666_10169726
680 Ga0070680_100000225
681 Ga0070680_100008524
682 Ga0070680_100156043
683 Ga0068868_100007947
684 Ga0068868_100010336
685 Ga0068868_100066443
686 Ga0068868_100093047
687 Ga0070660_100014363
688 Ga0070689_100249907
689 Ga0070691_10679162
690 Ga0070692_10072915
691 Ga0070675_100056436
692 Ga0070671_100010848
693 Ga0070671_100018136
694 Ga0070671_100093492
695 Ga0070671_100254224
696 Ga0070674_100131946
697 Ga0070674_100624215
698 Ga0070673_100140295
699 Ga0070673_101331583
700 Ga0070659_100119506
701 Ga0070659_100245221
702 Ga0070667_101506752
703 Ga0070667_101707819
704 Ga0070709_10173097
705 Ga0070714_100000153
706 Ga0070714_100005905
707 Ga0070710_10025311
708 Ga0070711_100009386
709 Ga0070711_100022718
710 Ga0070711_100042584
711 Ga0070700_100000044
712 Ga0070700_100241637
713 Ga0070694_100026248
714 Ga0070694_100235020
715 Ga0070694_100310817
716 Ga0070694_100630345
717 Ga0070708_100037429
718 Ga0070708_100066779
719 Ga0070663_100783914
720 Ga0070681_10000648
721 Ga0070681_10113620
722 Ga0070681_10125205
723 Ga0070681_10482167
724 Ga0068867_100177075
725 Ga0068867_100394760
726 Ga0070706_100023537
727 Ga0070706_100075694
728 Ga0070707_100138269
729 Ga0070707_100151178
730 Ga0070707_100301251
731 Ga0070698_100824916
732 Ga0070699_100001836
733 Ga0070699_100190843
734 Ga0070679_100000701
735 Ga0070679_100029901
736 Ga0070684_100305471
737 Ga0070697_100025562
738 Ga0070697_101359924
739 Ga0068853_100111297
740 Ga0068853_101399420
741 Ga0070686_100006768
742 Ga0070686_100224394
743 Ga0070686_101351417
744 Ga0070695_100459563
745 Ga0070696_100020188
746 Ga0070696_100042129
747 Ga0070696_100042478
748 Ga0070696_100073278
749 Ga0070696_100593131
750 Ga0070696_100619234
751 Ga0070693_100052598
752 Ga0070693_100366968
753 Ga0070693_100388042
754 Ga0070665_100000553
755 Ga0070665_100063388
756 Ga0070665_100113461
757 Ga0070665_100357169
758 Ga0070665_101598264
759 Ga0070704_100182483
760 Ga0068855_100001324
761 Ga0068855_100745350
762 Ga0068855_101057451
763 Ga0070664_100288288
764 Ga0070664_100656238
765 Ga0068857_100045596
766 Ga0068857_100084722
767 Ga0068857_100643308
768 Ga0068856_100016145
769 Ga0068856_100376414
770 Ga0070702_100372556
771 Ga0068852_100089815
772 Ga0068859_100011796
773 Ga0068859_100014153
774 Ga0068859_100050073
775 Ga0068859_100592343
776 Ga0068859_100765298
777 Ga0068859_101359983
778 Ga0068864_100006149
779 Ga0068864_100064001
780 Ga0068864_100136540
781 Ga0068864_100481889
782 Ga0068864_100575830
783 Ga0068864_101044749
784 Ga0068866_10156381
785 Ga0068851_10076960
786 Ga0068851_10238448
787 Ga0068851_10282102
788 Ga0068870_10572250
789 Ga0068863_100003434
790 Ga0068863_100010998
791 Ga0068863_100073402
792 Ga0068863_100146170
793 Ga0068863_100571457
794 Ga0068858_100784710
795 Ga0068858_100817395
796 Ga0068858_101257875
797 Ga0068858_101299010
798 Ga0068860_100182476
799 Ga0068860_100313036
800 Ga0068860_100473687
801 Ga0068860_100506284
802 Ga0068860_101021191
803 Ga0081455_10571136
804 Ga0070717_10060192
805 Ga0075365_10002558
806 Ga0075364_10055668
807 Ga0070716_100017067
808 Ga0070716_100224539
809 Ga0070712_100025989
810 Ga0070712_100041841
811 Ga0070712_100447653
812 Ga0075367_10060098
813 Ga0097621_100005123
814 Ga0097621_100006497
815 Ga0097621_100118888
816 Ga0097621_100147926
817 Ga0097621_100154509
818 Ga0097621_100273609
819 Ga0068871_100001057
820 Ga0068871_100012888
821 Ga0068871_100038878
822 Ga0068871_100325479
823 Ga0068871_100576292
824 Ga0075433_10016419
825 Ga0075433_10039129
826 Ga0075433_10078233
827 Ga0075433_10107852
828 Ga0075433_10245470
829 Ga0075433_11396388
830 Ga0075434_100035525
831 Ga0075434_100219041
832 Ga0075434_100271899
833 Ga0075434_100406503
834 Ga0075434_100913004
835 Ga0075434_101090983
836 Ga0075434_101562688
837 Ga0068865_100360323
838 Ga0068865_100533990
839 Ga0075436_100100346
840 Ga0075436_100193287
841 Ga0075436_100245065
842 Ga0075436_100890451
843 Ga0097620_100011797
844 Ga0097620_100014153
845 Ga0097620_100050071
846 Ga0097620_100592401
847 Ga0097620_100765241
848 Ga0097620_101360111
849 Ga0075435_100023334
850 Ga0075435_100044156
851 Ga0075435_100080899
852 Ga0075435_100140219
853 Ga0075435_100432400
854 Ga0075435_100652441
855 Ga0075435_100901822
856 Ga0105251_10109541
857 Ga0105240_10002142
858 Ga0105240_10188098
859 Ga0105240_10307229
860 Ga0105240_10386710
861 Ga0105240_10417414
862 Ga0105240_11823357
863 Ga0111539_10112558
864 Ga0105245_10003265
865 Ga0105245_10023414
866 Ga0105245_10353368
867 Ga0105245_11049135
868 Ga0105245_11292568
869 Ga0114129_10006321
870 Ga0114129_10049726
871 Ga0114129_10098551
872 Ga0114129_10665486
873 Ga0105243_10061701
874 Ga0105243_10402121
875 Ga0105243_11735532
876 Ga0105241_10048893
877 Ga0105241_10694835
878 Ga0105241_10788022
879 Ga0105241_11042512
880 Ga0105242_10014948
881 Ga0105242_10061453
882 Ga0105242_10199794
883 Ga0105248_10000795
884 Ga0105248_10013938
885 Ga0105248_10020847
886 Ga0105248_10036209
887 Ga0105248_10471203
888 Ga0105248_11636295
889 Ga0105248_11882039
890 Ga0105237_10241270
891 Ga0105237_10259484
892 Ga0105237_10316175
893 Ga0105237_10650758
894 Ga0105238_10002104
895 Ga0105238_10034305
896 Ga0105238_10341312
897 Ga0105238_10457064
898 Ga0105249_10042155
899 Ga0105249_10079139
900 Ga0105249_10220825
901 Ga0105249_11358190
902 Ga0105239_10012317
903 Ga0105239_10025787
904 Ga0105239_10076376
905 Ga0105239_10220337
906 Ga0105239_10267650
907 Ga0105239_10339965
908 Ga0105239_10782790
909 Ga0105246_10249115
910 Ga0105246_10274630
911 Ga0157373_10012071
912 Ga0157373_10035184
913 Ga0157369_10001363
914 Ga0157369_10210657
915 Ga0157369_10253949
916 Ga0157369_10293737
917 Ga0157374_10103924
918 Ga0157374_10307336
919 Ga0157374_10313955
920 Ga0157374_10416546
921 Ga0157374_10605380
922 Ga0157378_10001534
923 Ga0157378_10004237
924 Ga0157378_10034725
925 Ga0157378_10856221
926 Ga0157378_11150119
927 Ga0163162_10003234
928 Ga0163162_10076885
929 Ga0157372_10000968
930 Ga0157372_10030428
931 Ga0157372_10058846
932 Ga0157372_10124166
933 Ga0157372_10145411
934 Ga0157372_10466500
935 Ga0157372_11483027
936 Ga0157375_10026570
937 Ga0157375_10236815
938 Ga0157375_12216720
939 Ga0163163_10018109
940 Ga0163163_10169290
941 Ga0163163_10259009
942 Ga0163163_10292773
943 Ga0163163_10608493
944 Ga0163163_10644678
945 Ga0163163_11454031
946 Ga0163163_12639076
947 Ga0157380_10411074
948 Ga0182008_10069326
949 Ga0182008_10392630
950 Ga0157379_10153196
951 Ga0157379_10215741
952 Ga0157379_10431137
953 Ga0157379_11234462
954 Ga0157376_10000026
955 Ga0157376_10013954
956 Ga0157376_10034985
957 Ga0157376_10253261
958 Ga0157376_10305084
959 Ga0163161_10797167
960 Ga0206353_12057520
961 Ga0207656_10075198
962 Ga0207692_10060566
963 Ga0207642_10167115
964 Ga0207710_10019512
965 Ga0207680_10480122
966 Ga0207680_10510747
967 Ga0207680_10574600
968 Ga0207647_10025040
969 Ga0207645_10282349
970 Ga0207643_10210148
971 Ga0207684_10010899
972 Ga0207684_10020308
973 Ga0207654_10018842
974 Ga0207654_10094080
975 Ga0207654_10145146
976 Ga0207654_10208062
977 Ga0207707_10000118
978 Ga0207707_10062960
979 Ga0207707_10627623
980 Ga0207695_10000161
981 Ga0207695_10003501
982 Ga0207671_10047881
983 Ga0207671_10120363
984 Ga0207671_10201448
985 Ga0207671_10320577
986 Ga0207671_10382802
987 Ga0207671_11203233
988 Ga0207693_10002784
989 Ga0207693_10023987
990 Ga0207663_10010639
991 Ga0207663_10969356
992 Ga0207660_10001266
993 Ga0207660_10010755
994 Ga0207657_10052328
995 Ga0207652_10000634
996 Ga0207652_10078694
997 Ga0207652_10125259
998 Ga0207646_10007680
999 Ga0207646_10132153
1000 Ga0207646_10297967
1001 Ga0207646_10714892
1002 Ga0207681_11259606
1003 Ga0207694_10002057
1004 Ga0207694_10474237
1005 Ga0207650_11003767
1006 Ga0207659_10077378
1007 Ga0207687_10025011
1008 Ga0207687_10066997
1009 Ga0207700_10657840
1010 Ga0207664_10000117
1011 Ga0207664_11512216
1012 Ga0207644_10017926
1013 Ga0207644_10022847
1014 Ga0207644_10477534
1015 Ga0207690_10114246
1016 Ga0207690_10250151
1017 Ga0207690_11195497
1018 Ga0207706_10000098
1019 Ga0207686_10022860
1020 Ga0207686_10105472
1021 Ga0207686_10193858
1022 Ga0207669_11160759
1023 Ga0207704_10426535
1024 Ga0207665_10016356
1025 Ga0207665_10056988
1026 Ga0207711_10004621
1027 Ga0207711_10041506
1028 Ga0207711_10062434
1029 Ga0207711_10086711
1030 Ga0207689_10042414
1031 Ga0207689_10073869
1032 Ga0207689_10346172
1033 Ga0207661_10314685
1034 Ga0207679_10033676
1035 Ga0207679_10053039
1036 Ga0207667_10002772
1037 Ga0207667_10004035
1038 Ga0207667_10239833
1039 Ga0207667_11584407
1040 Ga0207651_10092323
1041 Ga0207651_11299559
1042 Ga0207712_10088186
1043 Ga0207640_10102368
1044 Ga0207640_11281524
1045 Ga0207658_11472157
1046 Ga0207677_10080699
1047 Ga0207677_10411710
1048 Ga0207677_10919937
1049 Ga0207677_11062836
1050 Ga0207703_10125628
1051 Ga0207703_10554528
1052 Ga0207703_10593937
1053 Ga0207639_10059693
1054 Ga0207639_10109335
1055 Ga0207639_10632111
1056 Ga0207678_10016641
1057 Ga0207678_10569599
1058 Ga0207708_10000031
1059 Ga0207708_10056643
1060 Ga0207702_10025497
1061 Ga0207702_10028768
1062 Ga0207702_10321672
1063 Ga0207641_10065836
1064 Ga0207641_10157634
1065 Ga0207641_10265296
1066 Ga0207641_10334313
1067 Ga0207641_10426578
1068 Ga0207648_10266471
1069 Ga0207676_10076768
1070 Ga0207676_10092291
1071 Ga0207676_10542893
1072 Ga0207676_10583978
1073 Ga0207676_11509042
1074 Ga0207674_10032011
1075 Ga0207674_10036323
1076 Ga0207683_10028265
1077 Ga0207683_10613446
1078 Ga0207698_10196507
1079 Ga0209995_1003113
1080 Ga0209968_1000323
1081 Ga0210002_1046585
1082 Ga0209983_1000088
1083 Ga0209998_10001783
1084 Ga0209813_10016179
1085 Ga0209974_10000056
1086 Ga0268266_10000140
1087 Ga0268266_10013233
1088 Ga0268266_10077469
1089 Ga0268266_10447011
1090 Ga0268266_11415729
1091 Ga0268264_10131768
1092 Ga0268264_10532208
1093 Ga0268264_10803921
1094 Ga0268264_10880573
1095 Ga0265326_10070567
1096 Ga0265319_1006659
1097 Ga0265318_10024817
1098 Ga0265318_10055505
1099 Ga0265322_10007950
1100 Ga0265322_10009942
1101 Ga0265336_10027082
1102 Ga0265336_10048205
1103 Ga0265338_10039850
1104 Ga0265324_10002387
1105 Ga0265324_10151633
1106 Ga0265760_10166152
1107 Ga0265332_10023863
1108 Ga0265320_10016759
1109 Ga0265320_10049419
1110 Ga0265325_10016915
1111 Ga0265325_10090002
1112 Ga0265329_10030971
1113 Ga0265329_10226423
1114 Ga0265340_10012647
1115 Ga0265339_10004230
1116 Ga0265339_10012152
1117 Ga0265339_10043461
1118 Ga0265331_10075836
1119 Ga0265331_10214705
1120 Ga0265316_10033154
1121 Ga0265316_10218137
1122 Ga0307408_100106921
1123 Ga0265314_10005816
1124 Ga0265342_10022696
1125 Ga0307405_10003463
1126 Ga0307413_10007482
1127 Ga0307410_10012068
1128 Ga0307406_10002945
1129 Ga0307407_10217720
1130 Ga0307412_10012215
1131 Ga0307409_100136418
1132 Ga0307416_100003432
1133 Ga0307414_10002214
1134 Ga0307415_100003854
1135 Ga0373930_0001154
1136 Ga0373926_0022333
1137 Ga0373934_0011159
1138 Ga0373944_0028028
1139 Ga0373936_0001799
1140 Ga0373941_0007323
1141 Ga0373941_0173862
1142 Ga0373945_0010455
1143 Ga0373953_0037530
1144 Ga0373956_0126619
1145 Ga0373960_0043463
1146 Ga0373943_0000076
1147 Ga0373943_0034842
1148 Ga0373946_0025416
1149 Ga0373955_0447703
1150 Ga0373924_0277611
1151 Ga0373931_0104988
1152 Ga0373931_0135363
1153 Ga0373931_0263989
1154 Ga0373931_0294340
1155 Ga0373935_0002253
1156 Ga0373927_0003198
1157 Ga0373933_0050577
1158 Ga0373947_0008228
1159 Ga0373947_0144408
1160 Ga0373937_0538257
1161 Ga0373937_1287035
1162 Ga0373937_1501488
1163 Ga0373925_0166676
1164 Ga0373925_0408112
1165 Ga0373925_0921860
1166 Ga0395900_0227457
1167 Ga0395898_0569543
1168 Ga0436364_0703510
1169 Ga0242419_006994
1170 Ga0242420_002068
1171 Ga0242420_005962
1172 Ga0436363_0605540
1173 Ga0436362_0642670
1174 Ga0451577_0665125
1175 Ga0453683_0132270
1176 Ga0453683_0653680
1177 Ga0466965_0281917
1178 Ga0466961_0232962
1179 Ga0466963_0839484
1180 Ga0466971_0137156
1181 Ga0466960_0224025
1182 Ga0451576_0978489
1183 Ga0466967_0040748
1184 Ga0466967_1357394
1185 Ga0495592_0276137
1186 Ga0495592_0725742
1187 Ga0495603_0050624
1188 Ga0495603_0066443
1189 Ga0495641_0129233
1190 Ga0495651_0012398
1191 Ga0495651_0259188
1192 Ga0495653_0352283
1193 Ga0495653_0632492
1194 Ga0495580_0008136
1195 Ga0495580_0099936
1196 Ga0495580_0134872
1197 Ga0495582_0153387
1198 Ga0495582_0547196
1199 Ga0495608_0127368
1200 Ga0495628_0468616
1201 Ga0495630_0082282
1202 Ga0495630_0304988
1203 Ga0495652_0912381
1204 Ga0495645_0091497
1205 Ga0495634_0593840
1206 Ga0495588_0352448
1207 Ga0495657_0025165
1208 Ga0495623_0050238
1209 Ga0495623_0343159
1210 Ga0495646_0170877
1211 Ga0495647_0002226
1212 Ga0495647_0015607
1213 Ga0495658_0029250
1214 Ga0495658_0091533
1215 Ga0495669_0171154
1216 Ga0495669_0399786
1217 Ga0495624_0366652
1218 Ga0495604_0202357
1219 Ga0495604_0890125
1220 Ga0495674_0014390
1221 Ga0495674_0069376
1222 Ga0495676_0029524
1223 Ga0495680_0059026
1224 Ga0495680_0081115
1225 Ga0495684_0423696
1226 Ga0495602_0053920
1227 Ga0495602_0054853
1228 Ga0496100_0019195
1229 Ga0496101_0026163
1230 Ga0496101_0367755
1231 Ga0496102_0007757
1232 Ga0496102_0067659
1233 Ga0496102_0085143
1234 Ga0496102_0171241
1235 Ga0496102_0294729
1236 Ga0496102_0660061
1237 Ga0496102_0780539
1238 Ga0496103_0011226
1239 Ga0496103_0171578
1240 Ga0496104_0168604
1241 Ga0496104_0829914
1242 Ga0496105_0015608
1243 Ga0496105_0059599
1244 Ga0496106_0014317
1245 Ga0496106_0144980
1246 Ga0496106_1203391
1247 Ga0496106_1245164
1248 Ga0496107_0036106
1249 Ga0496107_0204688
1250 Ga0496108_0092007
1251 Ga0496108_0192289
1252 Ga0496109_0322245
1253 Ga0496109_0501470
1254 Ga0496110_0087391
1255 Ga0496110_0849022
1256 Ga0496111_0008256
1257 Ga0496112_0016839
1258 Ga0496112_0530096
1259 Ga0496113_0024771
1260 Ga0496113_0153480
1261 Ga0496113_0237166
1262 Ga0496113_0397134
1263 Ga0496114_0005109
1264 Ga0496114_0059314
1265 Ga0496114_0316017
1266 Ga0496115_0007814
1267 Ga0496115_0014042
1268 Ga0496115_0572417
1269 Ga0501032_0428956
1270 Ga0501042_0048199
1271 Ga0501046_0242155
1272 Ga0501072_0141236
1273 Ga0501075_0081291
1274 Ga0501076_0331657
1275 Ga0501198_000195
1276 Ga0501202_004292
1277 Ga0501209_026628
1278 Ga0501216_002413
1279 Ga0501217_001335
1280 Ga0501223_001390
1281 Ga0501227_000809
1282 Ga0501233_000838
1283 Ga0501235_002441
1284 Ga0501240_014815
1285 Ga0501219_002524
1286 Ga0501225_0000510
1287 Ga0501245_014151
1288 Ga0501080_0540260
1289 Ga0501081_0629868
1290 Ga0501266_010081
1291 Ga0501272_017345
1292 Ga0501273_012544
1293 Ga0501045_0307799
1294 Ga0501212_001603
1295 Ga0501226_002234
1296 nmdc:mga00v17_156567_c1
1297 nmdc:mga06z11_178419_c1
1298 nmdc:mga04h51_93511_c1
1299 nmdc:mga05p37_132501_c1
1300 nmdc:mga05p37_16070_c1
1301 nmdc:mga05p37_584184_c1
1302 nmdc:mga0n895_222725_c1
1303 nmdc:mga0n895_49063_c1
1304 nmdc:mga0n895_525483_c1
1305 nmdc:mga0n895_653548_c1
1306 nmdc:mga0n895_67494_c1
1307 nmdc:mga0n895_7742_c1
1308 nmdc:mga0n895_89539_c1
1309 nmdc:mga0rr50_1115552_c1
1310 nmdc:mga0rr50_64894_c1
1311 nmdc:mga0rr50_68354_c1
1312 nmdc:mga0rr50_71026_c1
1313 nmdc:mga08x19_153338_c1
1314 nmdc:mga08x19_459607_c1
1315 nmdc:mga08x19_852868_c1
1316 nmdc:mga0a205_140210_c1
1317 nmdc:mga0a205_228716_c1
1318 nmdc:mga0a205_369473_c1
1319 nmdc:mga0a205_396652_c1
1320 nmdc:mga0a205_53255_c1
1321 nmdc:mga0a205_69738_c1
1322 nmdc:mga0a205_78669_c1
1323 Ga0495601_0060089
1324 Ga0495601_0210909
1325 Ga0495612_0257745
1326 Ga0495619_0034713
1327 Ga0495619_0060154
1328 Ga0501084_0601354
1329 Ga0501082_1634027
1330 Ga0530510_0026141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

79

185

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8245 52 157
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8189 56 157
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.7851 59 155
6d9n-assembly1.cif.gz_A crystal structure of an organic hydroperoxide resistance protein from elizabethkingia anophelis with crystallant-derived thiocyanate bound 0.7459 61 157
3cje-assembly1.cif.gz_A-2 crystal structure of an osmc-like hydroperoxide resistance protein (jann_2040) from jannaschia sp. ccs1 at 1.70 a resolution 0.7273 21 165
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.899 66 157 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8223 60 153 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7899 52 159 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7531 64 153 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7472 66 157 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A838KVL7-F1-model_v4 OsmC family protein 0.9707 73 165
AF-A0A2E0LIH4-F1-model_v4 Osmotically inducible protein OsmC 0.9676 68 165
AF-A0A4P5WPR6-F1-model_v4 Peroxiredoxin 0.9671 60 165
AF-A0A838KVL7-F1-model_v4 OsmC family protein 0.9607 73 165
AF-A0A4P5WPR6-F1-model_v4 Peroxiredoxin 0.9495 60 165

Map