F473667

General Info

Members Datasets Scaffolds Average Seq Length
665 350 576 296

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10007347|JGI24740J21852_100073472
Length 326
Sequence MMSQPDHHVPHAGTELYGVSRDELVADIPADMAAETLAADTATTSAPAKYNPLQRLVHRFSVLGLLGLVMVLFWLLVAFVGPLVAPYQGGALTSTEIFGRYSAAYPLGTDYLGRDMLSRILYGARYTVGLALAAAVLASVIGTFFGLLAAVSGKWVDEVLSRLFDALISIPSKVLALVVIAAFGSSIPMLTTVAALAYIPGAFRISRSLALNLMGLEYVQVARARGEGLLYIARVEVLPNMIHPMLADFGLRFVFIVLLLSGLSFLGLGVQPPNADWGSLVRENIGGLSEGAPAVLMPAVAIATLTIGMNLLIDNLRRRSRSHGDA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
11 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
14 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
15 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
16 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
17 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
18 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
19 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
20 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
21 2738541280 Massilia sp. GV090 Isolate Unclassified
22 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
23 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
24 2738541300 Massilia sp. GV016 Isolate Unclassified
25 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
26 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
27 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
28 2738543018 Massilia sp. GV045 Isolate Unclassified
29 2738543030 Massilia sp. GV097 Isolate Unclassified
30 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
31 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
32 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
33 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
34 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
35 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
36 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
37 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
38 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
39 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
40 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
41 2818991436 Collimonas arenae 515 Isolate Unclassified
42 2818991450 Burkholderia sp. 604 Isolate Unclassified
43 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
44 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
45 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
46 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
47 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
48 2857553236 Duganella sp. R-74557 Isolate Unclassified
49 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
50 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
51 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
52 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
53 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
54 2904424332 Duganella sp. 1411 Isolate Rhizosphere
55 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
56 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
57 2904504865 Serratia marcescens 1822 Isolate Unclassified
58 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
59 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
60 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
61 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
62 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
63 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
64 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
65 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
66 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
67 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
68 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
69 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
70 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
71 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
72 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
73 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
74 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
75 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
76 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
79 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
80 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
81 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
82 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
83 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
84 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
85 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
86 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
87 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
88 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
89 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
90 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
91 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
92 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
93 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
94 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
95 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
96 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
97 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
98 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
99 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
100 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
101 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
102 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
103 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
104 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
105 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
106 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
109 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
121 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
141 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
142 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
143 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
146 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
186 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
188 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
202 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
203 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
206 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
207 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
211 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
212 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
251 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
345 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
346 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
347 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
348 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
349 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
350 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.47
Metatranscriptomes 0
Isolates 13.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 10.38
Nodule 3.31
Rhizoplane 4.21
Rhizosphere 67.52
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007347 3300001979 Bacteria 4484
2 JGI24739J22299_10002344 3300001989 Bacteria 7299
3 JGI24739J22299_10005764 3300001989 Bacteria 4694
4 JGI24735J21928_10000337 3300002067 Bacteria 16306
5 JGI24735J21928_10002387 3300002067 Bacteria 6526
6 JGI24735J21928_10004539 3300002067 Bacteria 4669
7 JGI24735J21928_10010644 3300002067 Bacteria 2928
8 JGI25155J39150_1000782 3300002704 Bacteria 5145
9 JGI25156J39149_1001079 3300002705 Bacteria 12513
10 JGI25156J39149_1001365 3300002705 Bacteria 10475
11 JGI25156J39149_1018816 3300002705 Bacteria 1265
12 JGI25154J39366_1000101 3300002738 Bacteria 76597
13 JGI25151J46595_10001368 3300003187 Bacteria 16877
14 JGI25165J46597_1001396 3300003214 Bacteria 13229
15 rootH1_10113418 3300003316 Bacteria 2315
16 rootH1_10113418 3300003323 Bacteria 10728
17 rootH2_10043500 3300003320 Bacteria 1489
18 rootH2_10223114 3300003320 Bacteria 1486
19 rootL2_10012384 3300003322 Bacteria 21343
20 rootL2_10047863 3300003322 Bacteria 26820
21 JGI25160J50197_1000083 3300003354 Bacteria 97669
22 JGI25160J50197_1037495 3300003354 Bacteria 1160
23 Ga0055538_1000008 3300003751 Bacteria 398547
24 Ga0055539_1000012 3300003752 Bacteria 398547
25 Ga0055533_1000015 3300003756 Bacteria 398547
26 Ga0055533_1000521 3300003756 Bacteria 13887
27 Ga0055532_1000140 3300003758 Bacteria 71626
28 Ga0055525_1000017 3300003759 Bacteria 398547
29 Ga0055527_1000089 3300003760 Bacteria 71626
30 Ga0055527_1007591 3300003760 Bacteria 1319
31 Ga0055535_1000164 3300003761 Bacteria 71626
32 Ga0055542_1000208 3300003762 Bacteria 71626
33 Ga0055529_1000227 3300003763 Bacteria 71626
34 Ga0055526_1000140 3300003771 Bacteria 63275
35 Ga0055526_1001966 3300003771 Bacteria 14207
36 Ga0055537_1000113 3300003773 Bacteria 61047
37 Ga0055524_1000042 3300003775 Bacteria 155404
38 Ga0055524_1017504 3300003775 Bacteria 2527
39 Ga0055534_1000023 3300003784 Bacteria 135301
40 Ga0055528_1000030 3300003790 Bacteria 121679
41 Ga0055531_10000001 3300003794 Bacteria 543586
42 Ga0055541_1000009 3300003841 Bacteria 398547
43 Ga0058692_1000098 3300003856 Bacteria 57148
44 Ga0065165_1000445 3300005262 Bacteria 64885
45 Ga0070658_10007580 3300005327 Bacteria 8757
46 Ga0070660_100011491 3300005339 Bacteria 6295
47 Ga0070659_100017302 3300005366 Bacteria 5421
48 Ga0070663_100057523 3300005455 Bacteria 2790
49 Ga0070698_100005657 3300005471 Bacteria 13683
50 Ga0070697_100077091 3300005536 Bacteria 2741
51 Ga0068855_100006465 3300005563 Bacteria 14259
52 Ga0068855_100238474 3300005563 Bacteria 2033
53 Ga0068854_100050702 3300005578 Bacteria 2971
54 Ga0068856_100302128 3300005614 Bacteria 1618
55 Ga0081539_10017421 3300005985 Bacteria 5044
56 Ga0075365_10295536 3300006038 Bacteria 1140
57 Ga0075362_10000482 3300006177 Bacteria 11597
58 Ga0075369_10000823 3300006186 Bacteria 10212
59 Ga0075370_10072851 3300006353 Bacteria 1966
60 Ga0099824_1021235 3300006942 Bacteria 4579
61 Ga0099823_1010346 3300006944 Bacteria 9457
62 Ga0105251_10000589 3300009011 Bacteria 33409
63 Ga0105251_10001850 3300009011 Bacteria 17392
64 Ga0105251_10002303 3300009011 Bacteria 15136
65 Ga0105244_10000333 3300009036 Bacteria 44601
66 Ga0105244_10094085 3300009036 Bacteria 1472
67 Ga0105250_10000041 3300009092 Bacteria 133571
68 Ga0105250_10039797 3300009092 Bacteria 1885
69 Ga0105240_10006939 3300009093 Bacteria 16545
70 Ga0105240_10016580 3300009093 Bacteria 9968
71 Ga0105240_10028702 3300009093 Bacteria 7259
72 Ga0105240_10054043 3300009093 Bacteria 5035
73 Ga0105240_10216198 3300009093 Bacteria 2236
74 Ga0111539_10623984 3300009094 Bacteria 1255
75 Ga0105237_10026312 3300009545 Bacteria 5946
76 Ga0105237_10027720 3300009545 Bacteria 5776
77 Ga0105237_10059385 3300009545 Bacteria 3826
78 Ga0105238_10000111 3300009551 Bacteria 89931
79 Ga0105238_10164876 3300009551 Bacteria 2191
80 Ga0105238_10278131 3300009551 Bacteria 1655
81 Ga0105239_10060853 3300010375 Bacteria 4144
82 Ga0105239_10084523 3300010375 Bacteria 3496
83 Ga0157373_10006261 3300013100 Bacteria 8893
84 Ga0157371_10004251 3300013102 Bacteria 12593
85 Ga0157370_10000260 3300013104 Bacteria 66984
86 Ga0157370_10011214 3300013104 Bacteria 9398
87 Ga0157369_10000228 3300013105 Bacteria 77603
88 Ga0157369_10000602 3300013105 Bacteria 46869
89 Ga0157369_10002302 3300013105 Bacteria 22970
90 Ga0157369_10053954 3300013105 Bacteria 4341
91 Ga0157369_10188048 3300013105 Bacteria 2171
92 Ga0157369_10494188 3300013105 Bacteria 1266
93 Ga0157374_10000044 3300013296 Bacteria 144848
94 Ga0157374_10000370 3300013296 Bacteria 41402
95 Ga0157372_10116521 3300013307 Bacteria 3063
96 Ga0157375_10097142 3300013308 Bacteria 3019
97 Ga0182008_10077582 3300014497 Bacteria 1635
98 Ga0182006_1068970 3300015261 Bacteria 1316
99 Ga0182007_10002899 3300015262 Bacteria 8331
100 Ga0182007_10062862 3300015262 Bacteria 1217
101 Ga0183361_10008 3300016635 Bacteria 259171
102 Ga0214544_1016050 3300021320 Bacteria 7442
103 Ga0214542_1001265 3300021321 Bacteria 51403
104 Ga0214543_1001031 3300021327 Bacteria 51968
105 Ga0213872_10002444 3300021361 Bacteria 10922
106 Ga0209435_100360 3300025206 Bacteria 10351
107 Ga0209784_100005 3300025224 Bacteria 1040422
108 Ga0209566_100005 3300025225 Bacteria 1040422
109 Ga0209674_100009 3300025226 Bacteria 1040422
110 Ga0209674_100020 3300025226 Bacteria 672397
111 Ga0209672_100013 3300025228 Bacteria 740693
112 Ga0209672_101439 3300025228 Bacteria 8543
113 Ga0209147_100013 3300025229 Bacteria 660057
114 Ga0209563_100012 3300025230 Bacteria 1040422
115 Ga0209563_103261 3300025230 Bacteria 3400
116 Ga0207427_104529 3300025231 Bacteria 2300
117 Ga0209258_100328 3300025242 Bacteria 71792
118 Ga0209646_1000108 3300025246 Bacteria 158853
119 Ga0209026_1005613 3300025250 Bacteria 3316
120 Ga0209677_100006 3300025253 Bacteria 1040422
121 Ga0209148_1000020 3300025254 Bacteria 740693
122 Ga0209759_1000028 3300025256 Bacteria 298755
123 Ga0209759_1000279 3300025256 Bacteria 71943
124 Ga0209759_1000315 3300025256 Bacteria 64918
125 Ga0209759_1001092 3300025256 Bacteria 17633
126 Ga0209759_1007285 3300025256 Bacteria 3580
127 Ga0209759_1015299 3300025256 Bacteria 1985
128 Ga0209233_1000055 3300025261 Bacteria 439422
129 Ga0209565_1000003 3300025263 Bacteria 1099648
130 Ga0209455_1000017 3300025272 Bacteria 740693
131 Ga0209673_1000003 3300025273 Bacteria 980859
132 Ga0209130_1002091 3300025284 Bacteria 10724
133 Ga0209130_1006282 3300025284 Bacteria 3893
134 Ga0209675_1000003 3300025291 Bacteria 1003982
135 Ga0209025_1000014 3300025294 Bacteria 865448
136 Ga0209025_1000271 3300025294 Bacteria 120435
137 Ga0209564_1000012 3300025295 Bacteria 792078
138 Ga0209564_1000077 3300025295 Bacteria 281592
139 Ga0209564_1004776 3300025295 Bacteria 8090
140 Ga0209758_1001648 3300025297 Bacteria 25326
141 Ga0209050_1015041 3300025298 Bacteria 3283
142 Ga0209256_1000057 3300025299 Bacteria 281592
143 Ga0209256_1000235 3300025299 Bacteria 98834
144 Ga0207426_1000004 3300025302 Bacteria 1047900
145 Ga0207426_1000256 3300025302 Bacteria 115405
146 Ga0207426_1005502 3300025302 Bacteria 5765
147 Ga0209051_1015923 3300025303 Bacteria 3437
148 Ga0209257_1000033 3300025304 Bacteria 671006
149 Ga0207696_1000011 3300025711 Bacteria 530614
150 Ga0207696_1000021 3300025711 Bacteria 432606
151 Ga0207713_1000061 3300025735 Bacteria 209289
152 Ga0207713_1000948 3300025735 Bacteria 26051
153 Ga0207713_1017465 3300025735 Bacteria 3596
154 Ga0207713_1053016 3300025735 Bacteria 1601
155 Ga0207647_10000608 3300025904 Bacteria 27922
156 Ga0207647_10003763 3300025904 Bacteria 11343
157 Ga0207647_10059091 3300025904 Bacteria 2347
158 Ga0207647_10168648 3300025904 Bacteria 1275
159 Ga0207705_10000980 3300025909 Bacteria 23325
160 Ga0207705_10292981 3300025909 Bacteria 1247
161 Ga0207695_10009263 3300025913 Bacteria 12199
162 Ga0207695_10020394 3300025913 Bacteria 7594
163 Ga0207695_10036220 3300025913 Bacteria 5336
164 Ga0207695_10044552 3300025913 Bacteria 4717
165 Ga0207671_10019104 3300025914 Bacteria 5249
166 Ga0207671_10130825 3300025914 Bacteria 1926
167 Ga0207657_10000131 3300025919 Bacteria 75479
168 Ga0207657_10013430 3300025919 Bacteria 8036
169 Ga0207694_10000199 3300025924 Bacteria 60220
170 Ga0207694_10203157 3300025924 Bacteria 1612
171 Ga0207690_10013878 3300025932 Bacteria 4853
172 Ga0207667_10000028 3300025949 Bacteria 334510
173 Ga0207667_10029968 3300025949 Bacteria 5894
174 Ga0207667_10039402 3300025949 Bacteria 5037
175 Ga0207640_10028656 3300025981 Bacteria 3407
176 Ga0207678_10321698 3300026067 Bacteria 1331
177 Ga0209389_1007805 3300027296 Bacteria 9466
178 Ga0209371_1000102 3300027312 Bacteria 151286
179 Ga0209489_111119 3300027361 Bacteria 9466
180 Ga0209700_110564 3300027363 Bacteria 9466
181 Ga0307515_10050798 3300028794 Bacteria 6200
182 Ga0268256_1000035 3300030500 Bacteria 384794
183 Ga0307509_10188194 3300031507 Bacteria 1919
184 Ga0307408_100046811 3300031548 Bacteria 3095
185 Ga0307412_10000002 3300031911 Bacteria 743446
186 Ga0395899_0000005 3300037312 Bacteria 772966
187 Ga0395899_0005154 3300037312 Bacteria 10165
188 Ga0395899_0021416 3300037312 Bacteria 4903
189 Ga0395899_0083063 3300037312 Bacteria 2329
190 Ga0395900_0000003 3300037418 Bacteria 587648
191 Ga0395900_0000089 3300037418 Bacteria 170012
192 Ga0395900_0021122 3300037418 Bacteria 6653
193 Ga0395900_0027647 3300037418 Bacteria 5811
194 Ga0395900_0050809 3300037418 Bacteria 4270
195 Ga0395900_0144665 3300037418 Bacteria 2432
196 Ga0395900_0221336 3300037418 Bacteria 1907
197 Ga0395900_0223167 3300037418 Bacteria 1898
198 Ga0395900_0606692 3300037418 Bacteria 1034
199 Ga0395898_0000003 3300037466 Bacteria 772986
200 Ga0395898_0000195 3300037466 Bacteria 155796
201 Ga0395898_0023271 3300037466 Bacteria 6261
202 Ga0395898_0027732 3300037466 Bacteria 5679
203 Ga0395898_0189795 3300037466 Bacteria 1963
204 Ga0395905_0000035 3300037471 Bacteria 272014
205 Ga0395905_0000039 3300037471 Bacteria 253197
206 Ga0395905_0003786 3300037471 Bacteria 16005
207 Ga0395905_0021937 3300037471 Bacteria 6040
208 Ga0436364_0881046 3300037853 Bacteria 1572
209 Ga0395901_0000012 3300038443 Bacteria 381361
210 Ga0395901_0000038 3300038443 Bacteria 210534
211 Ga0395901_0000879 3300038443 Bacteria 33046
212 Ga0395901_0017496 3300038443 Bacteria 7316
213 Ga0395901_0168031 3300038443 Bacteria 2302
214 Ga0436361_0045959 3300039447 Bacteria 6941
215 Ga0439438_003271 3300041405 Bacteria 6622
216 Ga0439447_000113 3300041407 Bacteria 27299
217 Ga0439466_0000330 3300041411 Bacteria 18247
218 Ga0439448_0000202 3300042005 Bacteria 12407
219 Ga0439448_0000471 3300042005 Bacteria 9346
220 Ga0439432_003203 3300042006 Bacteria 6093
221 Ga0439432_003364 3300042006 Bacteria 5933
222 Ga0439452_000001 3300042010 Bacteria 1725439
223 Ga0439452_000669 3300042010 Bacteria 16880
224 Ga0439456_003706 3300042013 Bacteria 3110
225 Ga0450923_000576 3300042125 Bacteria 4172
226 Ga0439446_0000397 3300042156 Bacteria 8433
227 Ga0450909_011586 3300042185 Bacteria 1293
228 Ga0439434_0000322 3300042435 Bacteria 13631
229 Ga0439440_0000633 3300042993 Bacteria 5983
230 Ga0466969_0001893 3300044656 Bacteria 11189
231 Ga0466969_0014066 3300044656 Bacteria 4211
232 Ga0466972_0000441 3300044658 Bacteria 21473
233 Ga0466972_0003781 3300044658 Bacteria 7528
234 Ga0466972_0110074 3300044658 Bacteria 1302
235 Ga0466973_0115060 3300044659 Bacteria 2233
236 Ga0466965_0000248 3300044683 Bacteria 17387
237 Ga0466965_0023567 3300044683 Bacteria 2972
238 Ga0466965_0050382 3300044683 Bacteria 2065
239 Ga0466966_0000119 3300044684 Bacteria 49350
240 Ga0466966_0000278 3300044684 Bacteria 33540
241 Ga0466961_0000027 3300044693 Bacteria 89008
242 Ga0466961_0000541 3300044693 Bacteria 24113
243 Ga0466961_0029752 3300044693 Bacteria 3508
244 Ga0466963_0000853 3300044694 Bacteria 15386
245 Ga0466963_0015018 3300044694 Bacteria 4786
246 Ga0466963_0176402 3300044694 Bacteria 1491
247 Ga0466964_0004164 3300044706 Bacteria 5320
248 Ga0466971_0017491 3300044719 Bacteria 3172
249 Ga0466968_0006080 3300044735 Bacteria 4534
250 Ga0466968_0008533 3300044735 Bacteria 3925
251 Ga0466970_0001635 3300044765 Bacteria 10782
252 Ga0466970_0010556 3300044765 Bacteria 4690
253 Ga0466957_0001156 3300044842 Bacteria 13658
254 Ga0466957_0003348 3300044842 Bacteria 8785
255 Ga0466957_0072924 3300044842 Bacteria 2127
256 Ga0466959_0005503 3300045049 Bacteria 8685
257 Ga0466959_0016681 3300045049 Bacteria 5371
258 Ga0466959_0094285 3300045049 Bacteria 2147
259 Ga0451576_0001229 3300045051 Bacteria 45387
260 Ga0466958_0003615 3300045836 Bacteria 8057
261 Ga0466958_0006155 3300045836 Bacteria 6507
262 Ga0466958_0011314 3300045836 Bacteria 5024
263 Ga0466958_0013059 3300045836 Bacteria 4720
264 Ga0466967_0124237 3300045976 Bacteria 2389
265 Ga0495617_074927 3300046452 Bacteria 1110
266 Ga0495617_075434 3300046452 Bacteria 1106
267 Ga0495603_0000578 3300046455 Bacteria 20583
268 Ga0495603_0001261 3300046455 Bacteria 14748
269 Ga0495603_0046814 3300046455 Bacteria 2577
270 Ga0495590_0000661 3300046457 Bacteria 15936
271 Ga0495590_0012365 3300046457 Bacteria 3168
272 Ga0495590_0026334 3300046457 Bacteria 2041
273 Ga0495590_0046967 3300046457 Bacteria 1506
274 Ga0495590_0073148 3300046457 Bacteria 1204
275 Ga0495629_0000262 3300046459 Bacteria 45919
276 Ga0495629_0001323 3300046459 Bacteria 19481
277 Ga0495629_0003589 3300046459 Bacteria 11716
278 Ga0495629_0007991 3300046459 Bacteria 7783
279 Ga0495629_0019695 3300046459 Bacteria 4817
280 Ga0495638_0000126 3300046460 Bacteria 125113
281 Ga0495638_0007760 3300046460 Bacteria 7661
282 Ga0495638_0023309 3300046460 Bacteria 4049
283 Ga0495638_0055671 3300046460 Bacteria 2455
284 Ga0495638_0159445 3300046460 Bacteria 1303
285 Ga0495641_0007118 3300046461 Bacteria 7073
286 Ga0495651_0016750 3300046462 Bacteria 5676
287 Ga0495651_0055742 3300046462 Bacteria 3036
288 Ga0495653_0000323 3300046463 Bacteria 38936
289 Ga0495653_0003362 3300046463 Bacteria 12858
290 Ga0495653_0181480 3300046463 Bacteria 1444
291 Ga0495650_0002481 3300046471 Bacteria 14848
292 Ga0495650_0003508 3300046471 Bacteria 11375
293 Ga0495650_0004174 3300046471 Bacteria 10031
294 Ga0495650_0005548 3300046471 Bacteria 8150
295 Ga0495650_0032421 3300046471 Bacteria 2336
296 Ga0495580_0000147 3300046472 Bacteria 51023
297 Ga0495580_0001493 3300046472 Bacteria 20550
298 Ga0495580_0005017 3300046472 Bacteria 11032
299 Ga0495580_0006388 3300046472 Bacteria 9610
300 Ga0495580_0026887 3300046472 Bacteria 4191
301 Ga0495580_0032638 3300046472 Bacteria 3756
302 Ga0495580_0035644 3300046472 Bacteria 3577
303 Ga0495580_0046394 3300046472 Bacteria 3083
304 Ga0495582_0010842 3300046473 Bacteria 5015
305 Ga0495582_0019221 3300046473 Bacteria 3736
306 Ga0495582_0034963 3300046473 Bacteria 2762
307 Ga0495605_0000618 3300046474 Bacteria 27699
308 Ga0495605_0023809 3300046474 Bacteria 3214
309 Ga0495639_0012562 3300046475 Bacteria 3653
310 Ga0495662_0007341 3300046476 Bacteria 5450
311 Ga0495662_0042024 3300046476 Bacteria 2206
312 Ga0495664_0004555 3300046477 Bacteria 7584
313 Ga0495664_0013991 3300046477 Bacteria 4546
314 Ga0495664_0246129 3300046477 Bacteria 1081
315 Ga0495584_0000124 3300046491 Bacteria 52885
316 Ga0495584_0019591 3300046491 Bacteria 3436
317 Ga0495596_0000139 3300046500 Bacteria 49660
318 Ga0495596_0023354 3300046500 Bacteria 2510
319 Ga0495607_0000057 3300046501 Bacteria 110023
320 Ga0495607_0000463 3300046501 Bacteria 40722
321 Ga0495607_0001363 3300046501 Bacteria 21775
322 Ga0495607_0029522 3300046501 Bacteria 3373
323 Ga0495607_0061853 3300046501 Bacteria 2126
324 Ga0495583_0000045 3300046506 Bacteria 220503
325 Ga0495583_0000048 3300046506 Bacteria 217130
326 Ga0495583_0000051 3300046506 Bacteria 212400
327 Ga0495583_0007823 3300046506 Bacteria 6640
328 Ga0495583_0021698 3300046506 Bacteria 3296
329 Ga0495583_0088876 3300046506 Bacteria 1333
330 Ga0495606_0022633 3300046507 Bacteria 4572
331 Ga0495606_0026054 3300046507 Bacteria 4172
332 Ga0495606_0026644 3300046507 Bacteria 4117
333 Ga0495606_0041605 3300046507 Bacteria 3080
334 Ga0495606_0046436 3300046507 Bacteria 2870
335 Ga0495608_0019408 3300046511 Bacteria 4678
336 Ga0495610_0003200 3300046512 Bacteria 12967
337 Ga0495610_0021749 3300046512 Bacteria 3521
338 Ga0495610_0028534 3300046512 Bacteria 2950
339 Ga0495616_0007504 3300046513 Bacteria 6529
340 Ga0495616_0013942 3300046513 Bacteria 4516
341 Ga0495616_0025799 3300046513 Bacteria 3134
342 Ga0495616_0028654 3300046513 Bacteria 2947
343 Ga0495618_0009084 3300046514 Bacteria 6000
344 Ga0495620_0004311 3300046515 Bacteria 8040
345 Ga0495628_0003789 3300046516 Bacteria 13464
346 Ga0495628_0015339 3300046516 Bacteria 6399
347 Ga0495628_0031002 3300046516 Bacteria 4325
348 Ga0495628_0087564 3300046516 Bacteria 2414
349 Ga0495628_0274379 3300046516 Bacteria 1253
350 Ga0495631_0023509 3300046518 Bacteria 2856
351 Ga0495631_0058922 3300046518 Bacteria 1669
352 Ga0495643_0000076 3300046522 Bacteria 166614
353 Ga0495643_0000383 3300046522 Bacteria 58554
354 Ga0495643_0083783 3300046522 Bacteria 1655
355 Ga0495644_0000939 3300046523 Bacteria 12061
356 Ga0495644_0001018 3300046523 Bacteria 11691
357 Ga0495644_0032616 3300046523 Bacteria 1968
358 Ga0495648_0000081 3300046524 Bacteria 125267
359 Ga0495648_0000245 3300046524 Bacteria 61457
360 Ga0495648_0051808 3300046524 Bacteria 2497
361 Ga0495663_0005115 3300046525 Bacteria 3658
362 Ga0495666_0000782 3300046526 Bacteria 14719
363 Ga0495666_0006329 3300046526 Bacteria 5961
364 Ga0495666_0008312 3300046526 Bacteria 5201
365 Ga0495642_0002948 3300046528 Bacteria 6781
366 Ga0495642_0003294 3300046528 Bacteria 6384
367 Ga0495642_0013441 3300046528 Bacteria 3166
368 Ga0495652_0014472 3300046529 Bacteria 7080
369 Ga0495665_0003388 3300046531 Bacteria 8651
370 Ga0495665_0123159 3300046531 Bacteria 1358
371 Ga0495586_0112773 3300046535 Bacteria 1514
372 Ga0495609_0000157 3300046538 Bacteria 70102
373 Ga0495609_0000481 3300046538 Bacteria 32044
374 Ga0495609_0000989 3300046538 Bacteria 20299
375 Ga0495609_0004887 3300046538 Bacteria 7205
376 Ga0495621_0150620 3300046539 Bacteria 915
377 Ga0495597_0001805 3300046542 Bacteria 14669
378 Ga0495597_0002312 3300046542 Bacteria 12365
379 Ga0495597_0021306 3300046542 Bacteria 3014
380 Ga0495597_0024114 3300046542 Bacteria 2809
381 Ga0495645_0015416 3300046543 Bacteria 5436
382 Ga0495645_0037197 3300046543 Bacteria 3547
383 Ga0495645_0052537 3300046543 Bacteria 2964
384 Ga0495622_0000017 3300046557 Bacteria 176313
385 Ga0495622_0000250 3300046557 Bacteria 41868
386 Ga0495622_0060908 3300046557 Bacteria 1748
387 Ga0495633_0000182 3300046558 Bacteria 81881
388 Ga0495633_0004087 3300046558 Bacteria 9416
389 Ga0495633_0005541 3300046558 Bacteria 7666
390 Ga0495656_0007237 3300046615 Bacteria 3918
391 Ga0495656_0010347 3300046615 Bacteria 3390
392 Ga0495656_0101840 3300046615 Bacteria 1329
393 Ga0495668_0000081 3300046616 Bacteria 157245
394 Ga0495668_0014989 3300046616 Bacteria 4535
395 Ga0495611_0000610 3300046648 Bacteria 20629
396 Ga0495611_0034846 3300046648 Bacteria 2227
397 Ga0495625_0000075 3300046660 Bacteria 163672
398 Ga0495625_0002235 3300046660 Bacteria 21378
399 Ga0495625_0003122 3300046660 Bacteria 16923
400 Ga0495625_0027744 3300046660 Bacteria 4255
401 Ga0495625_0070370 3300046660 Bacteria 2456
402 Ga0495659_0000003 3300046664 Bacteria 169166
403 Ga0495659_0000903 3300046664 Bacteria 10532
404 Ga0495659_0009486 3300046664 Bacteria 3107
405 Ga0495661_0000296 3300046665 Bacteria 56421
406 Ga0495661_0010739 3300046665 Bacteria 6236
407 Ga0495661_0029148 3300046665 Bacteria 3526
408 Ga0495661_0039714 3300046665 Bacteria 2923
409 Ga0495588_0003798 3300046674 Bacteria 6615
410 Ga0495599_0003773 3300046678 Bacteria 8899
411 Ga0495599_0010288 3300046678 Bacteria 5723
412 Ga0495623_0003778 3300046679 Bacteria 9981
413 Ga0495646_0000287 3300046680 Bacteria 25794
414 Ga0495646_0003464 3300046680 Bacteria 9819
415 Ga0495646_0005651 3300046680 Bacteria 7916
416 Ga0495646_0007639 3300046680 Bacteria 6871
417 Ga0495669_0001355 3300046684 Bacteria 10140
418 Ga0495669_0013609 3300046684 Bacteria 3470
419 Ga0495669_0020319 3300046684 Bacteria 2873
420 Ga0495669_0029487 3300046684 Bacteria 2406
421 Ga0495613_0135745 3300046689 Bacteria 1760
422 Ga0495613_0188066 3300046689 Bacteria 1460
423 Ga0495624_0004071 3300046690 Bacteria 10760
424 Ga0495624_0004857 3300046690 Bacteria 9768
425 Ga0495624_0007011 3300046690 Bacteria 7946
426 Ga0495624_0022935 3300046690 Bacteria 4119
427 Ga0495670_0061666 3300046691 Bacteria 1885
428 Ga0495670_0166231 3300046691 Bacteria 1161
429 Ga0495671_0000077 3300046692 Bacteria 93450
430 Ga0495671_0036750 3300046692 Bacteria 2480
431 Ga0495649_0002402 3300046694 Bacteria 13212
432 Ga0495649_0019697 3300046694 Bacteria 3788
433 Ga0495649_0023831 3300046694 Bacteria 3418
434 Ga0495649_0065671 3300046694 Bacteria 1947
435 Ga0495589_0000022 3300046794 Bacteria 196021
436 Ga0495589_0010783 3300046794 Bacteria 4750
437 Ga0495589_0042144 3300046794 Bacteria 2275
438 Ga0495589_0059318 3300046794 Bacteria 1881
439 Ga0495600_0004139 3300046809 Bacteria 8638
440 Ga0495660_0000044 3300046810 Bacteria 150926
441 Ga0495660_0000199 3300046810 Bacteria 62715
442 Ga0495660_0003903 3300046810 Bacteria 9114
443 Ga0495660_0040419 3300046810 Bacteria 2585
444 Ga0495581_0002490 3300047315 Bacteria 10434
445 Ga0495581_0026732 3300047315 Bacteria 3345
446 Ga0495604_0000860 3300047317 Bacteria 25329
447 Ga0495604_0001940 3300047317 Bacteria 16729
448 Ga0495604_0004362 3300047317 Bacteria 11203
449 Ga0495604_0037994 3300047317 Bacteria 3788
450 Ga0495604_0053218 3300047317 Bacteria 3130
451 Ga0495604_0290774 3300047317 Bacteria 1100
452 Ga0495636_0000325 3300047318 Bacteria 18244
453 Ga0495636_0021392 3300047318 Bacteria 2611
454 Ga0495674_0010082 3300047319 Bacteria 8952
455 Ga0495674_0011983 3300047319 Bacteria 8175
456 Ga0495674_0049314 3300047319 Bacteria 3721
457 Ga0495674_0082212 3300047319 Bacteria 2761
458 Ga0495674_0082939 3300047319 Bacteria 2748
459 Ga0495672_0000023 3300047320 Bacteria 419080
460 Ga0495672_0000329 3300047320 Bacteria 62224
461 Ga0495672_0002598 3300047320 Bacteria 16368
462 Ga0495672_0010552 3300047320 Bacteria 6571
463 Ga0495672_0010884 3300047320 Bacteria 6453
464 Ga0495672_0044128 3300047320 Bacteria 2676
465 Ga0495672_0065376 3300047320 Bacteria 2079
466 Ga0495672_0071465 3300047320 Bacteria 1963
467 Ga0495676_0054861 3300047321 Bacteria 3164
468 Ga0495680_0002474 3300047322 Bacteria 18888
469 Ga0495680_0010022 3300047322 Bacteria 8478
470 Ga0495683_0001365 3300047323 Bacteria 16232
471 Ga0495683_0015304 3300047323 Bacteria 3994
472 Ga0495683_0060526 3300047323 Bacteria 1876
473 Ga0495683_0062596 3300047323 Bacteria 1840
474 Ga0495683_0084105 3300047323 Bacteria 1548
475 Ga0495683_0132810 3300047323 Bacteria 1172
476 Ga0495687_000005 3300047443 Bacteria 610401
477 Ga0495687_000099 3300047443 Bacteria 132139
478 Ga0495687_000156 3300047443 Bacteria 103711
479 Ga0495687_002286 3300047443 Bacteria 15670
480 Ga0495687_005206 3300047443 Bacteria 8392
481 Ga0495687_007732 3300047443 Bacteria 6266
482 Ga0495687_027300 3300047443 Bacteria 2674
483 Ga0495687_027825 3300047443 Bacteria 2640
484 Ga0495675_0006315 3300047444 Bacteria 7258
485 Ga0495675_0032714 3300047444 Bacteria 3317
486 Ga0495675_0050659 3300047444 Bacteria 2639
487 Ga0495675_0088000 3300047444 Bacteria 1951
488 Ga0495675_0256540 3300047444 Bacteria 1048
489 Ga0495677_0002168 3300047445 Bacteria 7771
490 Ga0495677_0009204 3300047445 Bacteria 3649
491 Ga0495679_000006 3300047446 Bacteria 449956
492 Ga0495685_000022 3300047447 Bacteria 71800
493 Ga0495685_028110 3300047447 Bacteria 1934
494 Ga0495673_0034718 3300047469 Bacteria 2330
495 Ga0495673_0041425 3300047469 Bacteria 2073
496 Ga0495673_0063343 3300047469 Bacteria 1576
497 Ga0495673_0111771 3300047469 Bacteria 1091
498 Ga0495681_0011961 3300047470 Bacteria 5126
499 Ga0495684_0144152 3300047471 Bacteria 1785
500 Ga0495686_0007017 3300047472 Bacteria 8511
501 Ga0495593_0008087 3300047673 Bacteria 6118
502 Ga0495593_0030295 3300047673 Bacteria 2962
503 Ga0495593_0033754 3300047673 Bacteria 2786
504 Ga0495602_0000401 3300048088 Bacteria 40552
505 Ga0495602_0018775 3300048088 Bacteria 6889
506 Ga0495614_0005558 3300048089 Bacteria 5685
507 Ga0495614_0047352 3300048089 Bacteria 1844
508 Ga0495626_0000021 3300048091 Bacteria 217213
509 Ga0495626_0035345 3300048091 Bacteria 2385
510 Ga0495626_0039305 3300048091 Bacteria 2240
511 Ga0495626_0050167 3300048091 Bacteria 1929
512 Ga0496100_0001004 3300048903 Bacteria 13602
513 Ga0496100_0019043 3300048903 Bacteria 4087
514 Ga0496100_0083149 3300048903 Bacteria 2166
515 Ga0496100_0296876 3300048903 Bacteria 1208
516 Ga0496101_0000509 3300048904 Bacteria 24411
517 Ga0496101_0003949 3300048904 Bacteria 9271
518 Ga0496101_0040754 3300048904 Bacteria 3308
519 Ga0496101_0214979 3300048904 Bacteria 1490
520 Ga0496102_0000252 3300048905 Bacteria 69917
521 Ga0496103_0000252 3300048906 Bacteria 51764
522 Ga0496103_0018234 3300048906 Bacteria 4209
523 Ga0496104_0092890 3300048907 Bacteria 2885
524 Ga0496104_0150849 3300048907 Bacteria 2231
525 Ga0496104_0493646 3300048907 Bacteria 1135
526 Ga0496105_0019613 3300048908 Bacteria 5455
527 Ga0496105_0262251 3300048908 Bacteria 1397
528 Ga0496106_0004785 3300048909 Bacteria 10012
529 Ga0496107_0059141 3300048910 Bacteria 2773
530 Ga0496110_0277856 3300048913 Bacteria 1525
531 Ga0496111_0003065 3300048914 Bacteria 10262
532 Ga0496112_0042543 3300048915 Bacteria 4444
533 Ga0496112_0486903 3300048915 Bacteria 1170
534 Ga0496113_0021213 3300048916 Bacteria 4580
535 Ga0496114_0224172 3300048917 Bacteria 1651
536 Ga0496114_0234726 3300048917 Bacteria 1612
537 Ga0496116_0000631 3300048919 Bacteria 46228
538 Ga0496116_0003487 3300048919 Bacteria 15476
539 Ga0496116_0030614 3300048919 Bacteria 3863
540 Ga0496117_0000138 3300048920 Bacteria 159456
541 Ga0496117_0000716 3300048920 Bacteria 52460
542 Ga0496117_0004925 3300048920 Bacteria 14339
543 Ga0496117_0050453 3300048920 Bacteria 2950
544 Ga0496117_0091491 3300048920 Bacteria 1956
545 Ga0496118_0000218 3300048921 Bacteria 100056
546 Ga0496118_0001574 3300048921 Bacteria 33838
547 Ga0496118_0006980 3300048921 Bacteria 12178
548 Ga0496118_0007142 3300048921 Bacteria 11965
549 Ga0496118_0008437 3300048921 Bacteria 10651
550 Ga0496118_0086256 3300048921 Bacteria 2182
551 Ga0496119_0096449 3300048922 Bacteria 1668
552 Ga0496121_0003199 3300048924 Bacteria 23586
553 Ga0496121_0008748 3300048924 Bacteria 11811
554 Ga0496121_0021824 3300048924 Bacteria 6252
555 Ga0496121_0051357 3300048924 Bacteria 3473
556 Ga0496122_0013824 3300048925 Bacteria 7860
557 Ga0496123_0055242 3300048926 Bacteria 2606
558 Ga0496124_0042678 3300048927 Bacteria 3903
559 Ga0496125_0010970 3300048928 Bacteria 9101
560 Ga0496126_0003191 3300048929 Bacteria 21050
561 Ga0495678_000032 3300049459 Bacteria 212537
562 Ga0495678_000615 3300049459 Bacteria 33335
563 Ga0495678_001681 3300049459 Bacteria 16787
564 Ga0495678_030648 3300049459 Bacteria 2249
565 Ga0495682_0000679 3300049460 Bacteria 22394
566 Ga0495682_0002613 3300049460 Bacteria 8443
567 Ga0495682_0063338 3300049460 Bacteria 1333
568 Ga0501037_0215418 3300049573 Bacteria 1353
569 nmdc:mga03683_6352_c1 3300050489 Bacteria 4042
570 nmdc:mga0yw44_87739_c1 3300050492 Bacteria 1961
571 nmdc:mga0k408_14882_c1 3300050493 Bacteria 4294
572 nmdc:mga06z11_5692_c1 3300050494 Bacteria 5019
573 nmdc:mga07m45_58752_c1 3300050496 Bacteria 2176
574 nmdc:mga0sz30_1484_c1 3300050516 Bacteria 8373
575 Ga0466962_0004168 3300061719 Bacteria 6929
576 Ga0466962_0030410 3300061719 Bacteria 2586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10005764 JGI24739J22299_100057643 256
2 3300025735 Ga0207713_1053016 Ga0207713_10530162 256
3 3300037853 Ga0436364_0881046 Ga0436364_0881046_27_875 256
4 3300046501 Ga0495607_0000463 Ga0495607_0000463_19475_20341 257
5 3300003856 Ga0058692_1000098 Ga0058692_10000989 258
6 3300009011 Ga0105251_10001850 Ga0105251_1000185010 258
7 3300009036 Ga0105244_10000333 Ga0105244_1000033342 258
8 3300009092 Ga0105250_10039797 Ga0105250_100397972 258
9 3300013102 Ga0157371_10004251 Ga0157371_100042519 258
10 3300013104 Ga0157370_10000260 Ga0157370_1000026019 258
11 3300015261 Ga0182006_1068970 Ga0182006_10689702 258
12 3300027312 Ga0209371_1000102 Ga0209371_100010216 258
13 3300030500 Ga0268256_1000035 Ga0268256_1000035208 258
14 3300039447 Ga0436361_0045959 Ga0436361_0045959_3186_3974 258
15 3300042010 Ga0439452_000001 Ga0439452_000001_1475942_1476802 258
16 3300048919 Ga0496116_0000631 Ga0496116_0000631_15568_16428 258
17 3300048920 Ga0496117_0000138 Ga0496117_0000138_131661_132521 258
18 3300048921 Ga0496118_0001574 Ga0496118_0001574_14469_15329 258
19 iso_pu_bacteria 2521172590 2521557021 258
20 3300031507 Ga0307509_10188194 Ga0307509_101881942 262
21 3300037312 Ga0395899_0005154 Ga0395899_0005154_1735_2589 262
22 3300037418 Ga0395900_0050809 Ga0395900_0050809_1665_2519 262
23 3300037471 Ga0395905_0003786 Ga0395905_0003786_9709_10563 262
24 3300046680 Ga0495646_0003464 Ga0495646_0003464_5230_6174 262
25 3300046461 Ga0495641_0007118 Ga0495641_0007118_3343_4290 263
26 3300046472 Ga0495580_0032638 Ga0495580_0032638_390_1337 263
27 3300046473 Ga0495582_0010842 Ga0495582_0010842_3079_4026 263
28 3300046477 Ga0495664_0004555 Ga0495664_0004555_4480_5427 263
29 3300046511 Ga0495608_0019408 Ga0495608_0019408_1909_2856 263
30 3300046514 Ga0495618_0009084 Ga0495618_0009084_2328_3275 263
31 3300046526 Ga0495666_0006329 Ga0495666_0006329_1001_1948 263
32 3300046529 Ga0495652_0014472 Ga0495652_0014472_4738_5685 263
33 3300046809 Ga0495600_0004139 Ga0495600_0004139_6503_7450 263
34 3300047317 Ga0495604_0290774 Ga0495604_0290774_86_1033 263
35 3300047321 Ga0495676_0054861 Ga0495676_0054861_68_1015 263
36 3300047471 Ga0495684_0144152 Ga0495684_0144152_827_1774 263
37 3300048089 Ga0495614_0005558 Ga0495614_0005558_3663_4610 263
38 3300028794 Ga0307515_10050798 Ga0307515_100507983 264
39 3300006186 Ga0075369_10000823 Ga0075369_100008233 265
40 3300025904 Ga0207647_10168648 Ga0207647_101686482 265
41 3300046455 Ga0495603_0046814 Ga0495603_0046814_237_1184 265
42 3300046459 Ga0495629_0001323 Ga0495629_0001323_4805_5752 265
43 3300046471 Ga0495650_0032421 Ga0495650_0032421_329_1276 265
44 3300046476 Ga0495662_0042024 Ga0495662_0042024_184_1131 265
45 3300046516 Ga0495628_0274379 Ga0495628_0274379_296_1243 265
46 3300047315 Ga0495581_0002490 Ga0495581_0002490_7569_8516 265
47 3300047319 Ga0495674_0082212 Ga0495674_0082212_491_1438 265
48 3300047323 Ga0495683_0062596 Ga0495683_0062596_822_1769 265
49 3300047444 Ga0495675_0256540 Ga0495675_0256540_77_1024 265
50 3300050516 nmdc:mga0sz30_1484_c1 nmdc:mga0sz30_1484_c1_6662_7501 265
51 3300002705 JGI25156J39149_1001365 JGI25156J39149_10013657 266
52 3300025256 Ga0209759_1000028 Ga0209759_1000028269 266
53 3300042993 Ga0439440_0000633 Ga0439440_0000633_2470_3273 266
54 3300005536 Ga0070697_100077091 Ga0070697_1000770913 267
55 3300005985 Ga0081539_10017421 Ga0081539_100174212 267
56 3300006038 Ga0075365_10295536 Ga0075365_102955362 267
57 3300009094 Ga0111539_10623984 Ga0111539_106239842 267
58 3300044683 Ga0466965_0050382 Ga0466965_0050382_785_1594 267
59 3300044842 Ga0466957_0072924 Ga0466957_0072924_1286_2095 267
60 3300005471 Ga0070698_100005657 Ga0070698_10000565712 268
61 3300006177 Ga0075362_10000482 Ga0075362_100004829 268
62 3300006353 Ga0075370_10072851 Ga0075370_100728512 268
63 3300025949 Ga0207667_10000028 Ga0207667_1000002854 268
64 3300050489 nmdc:mga03683_6352_c1 nmdc:mga03683_6352_c1_1324_2163 268
65 3300050493 nmdc:mga0k408_14882_c1 nmdc:mga0k408_14882_c1_2716_3555 268
66 3300050494 nmdc:mga06z11_5692_c1 nmdc:mga06z11_5692_c1_108_947 268
67 3300050496 nmdc:mga07m45_58752_c1 nmdc:mga07m45_58752_c1_586_1425 268
68 iso_pu_bacteria 2894772417 2894777075 269
69 3300003187 JGI25151J46595_10001368 JGI25151J46595_100013687 270
70 3300025294 Ga0209025_1000271 Ga0209025_100027175 270
71 3300025297 Ga0209758_1001648 Ga0209758_100164810 270
72 3300002704 JGI25155J39150_1000782 JGI25155J39150_10007822 271
73 3300002705 JGI25156J39149_1018816 JGI25156J39149_10188162 271
74 3300002738 JGI25154J39366_1000101 JGI25154J39366_100010173 271
75 3300003354 JGI25160J50197_1037495 JGI25160J50197_10374952 271
76 3300005578 Ga0068854_100050702 Ga0068854_1000507021 271
77 3300009036 Ga0105244_10094085 Ga0105244_100940852 271
78 3300009092 Ga0105250_10000041 Ga0105250_1000004190 271
79 3300009093 Ga0105240_10054043 Ga0105240_100540435 271
80 3300009545 Ga0105237_10026312 Ga0105237_100263122 271
81 3300009551 Ga0105238_10000111 Ga0105238_1000011143 271
82 3300010375 Ga0105239_10084523 Ga0105239_100845232 271
83 3300025206 Ga0209435_100360 Ga0209435_1003608 271
84 3300025246 Ga0209646_1000108 Ga0209646_100010815 271
85 3300025250 Ga0209026_1005613 Ga0209026_10056133 271
86 3300025256 Ga0209759_1001092 Ga0209759_10010921 271
87 3300025284 Ga0209130_1002091 Ga0209130_10020912 271
88 3300025302 Ga0207426_1000256 Ga0207426_10002562 271
89 3300025711 Ga0207696_1000011 Ga0207696_1000011125 271
90 3300025735 Ga0207713_1000061 Ga0207713_1000061171 271
91 3300025913 Ga0207695_10009263 Ga0207695_1000926310 271
92 3300025914 Ga0207671_10019104 Ga0207671_100191043 271
93 3300025924 Ga0207694_10000199 Ga0207694_1000019913 271
94 3300025949 Ga0207667_10029968 Ga0207667_100299682 271
95 3300025981 Ga0207640_10028656 Ga0207640_100286561 271
96 iso_pu_bacteria 2791355137 2792838442 271
97 3300003751 Ga0055538_1000008 Ga0055538_1000008320 272
98 3300003752 Ga0055539_1000012 Ga0055539_1000012320 272
99 3300003756 Ga0055533_1000015 Ga0055533_1000015320 272
100 3300003759 Ga0055525_1000017 Ga0055525_100001723 272
101 3300003841 Ga0055541_1000009 Ga0055541_1000009320 272
102 3300009093 Ga0105240_10028702 Ga0105240_100287022 272
103 3300021361 Ga0213872_10002444 Ga0213872_100024442 272
104 3300025224 Ga0209784_100005 Ga0209784_100005317 272
105 3300025225 Ga0209566_100005 Ga0209566_100005317 272
106 3300025226 Ga0209674_100009 Ga0209674_100009317 272
107 3300025230 Ga0209563_100012 Ga0209563_100012317 272
108 3300025253 Ga0209677_100006 Ga0209677_100006317 272
109 3300025913 Ga0207695_10036220 Ga0207695_100362204 272
110 3300048924 Ga0496121_0051357 Ga0496121_0051357_1389_2264 272
111 iso_pu_bacteria 2511231003 2511251054 272
112 iso_pu_bacteria 2929199973 2929203783 272
113 iso_pu_bacteria 8055909800 8055915624 272
114 3300045051 Ga0451576_0001229 Ga0451576_0001229_8884_9708 273
115 iso_pu_bacteria 2818991436 2819543699 273
116 iso_pu_bacteria 2928130867 2928134550 273
117 3300002067 JGI24735J21928_10010644 JGI24735J21928_100106442 274
118 3300002705 JGI25156J39149_1001079 JGI25156J39149_10010799 274
119 3300003214 JGI25165J46597_1001396 JGI25165J46597_10013969 274
120 3300003756 Ga0055533_1000521 Ga0055533_10005216 274
121 3300003758 Ga0055532_1000140 Ga0055532_100014067 274
122 3300003760 Ga0055527_1000089 Ga0055527_10000898 274
123 3300003761 Ga0055535_1000164 Ga0055535_100016467 274
124 3300003762 Ga0055542_1000208 Ga0055542_100020867 274
125 3300003763 Ga0055529_1000227 Ga0055529_100022767 274
126 3300025226 Ga0209674_100020 Ga0209674_100020545 274
127 3300025228 Ga0209672_100013 Ga0209672_100013660 274
128 3300025229 Ga0209147_100013 Ga0209147_100013536 274
129 3300025230 Ga0209563_103261 Ga0209563_1032614 274
130 3300025231 Ga0207427_104529 Ga0207427_1045292 274
131 3300025242 Ga0209258_100328 Ga0209258_1003288 274
132 3300025254 Ga0209148_1000020 Ga0209148_1000020660 274
133 3300025256 Ga0209759_1000279 Ga0209759_10002799 274
134 3300025261 Ga0209233_1000055 Ga0209233_1000055400 274
135 3300025272 Ga0209455_1000017 Ga0209455_1000017660 274
136 3300046457 Ga0495590_0012365 Ga0495590_0012365_174_1121 274
137 3300046507 Ga0495606_0026054 Ga0495606_0026054_1449_2396 274
138 3300046543 Ga0495645_0015416 Ga0495645_0015416_2072_2944 274
139 3300046680 Ga0495646_0000287 Ga0495646_0000287_5304_6176 274
140 3300046690 Ga0495624_0022935 Ga0495624_0022935_2657_3529 274
141 3300046694 Ga0495649_0002402 Ga0495649_0002402_7339_8286 274
142 3300047317 Ga0495604_0053218 Ga0495604_0053218_34_981 274
143 3300047444 Ga0495675_0032714 Ga0495675_0032714_2294_3241 274
144 3300048091 Ga0495626_0035345 Ga0495626_0035345_297_1244 274
145 iso_pu_bacteria 2599185299 2599926277 274
146 iso_pu_bacteria 2648501693 2650897038 274
147 iso_pu_bacteria 2684622997 2686353932 274
148 iso_pu_bacteria 2808606414 2809125496 274
149 iso_pu_bacteria 2847797336 2847799211 274
150 iso_pu_bacteria 2904439833 2904440277 274
151 iso_pu_bacteria 2904530477 2904530811 274
152 iso_pu_bacteria 2904584206 2904585775 274
153 iso_pu_bacteria 2904589729 2904592412 274
154 iso_pu_bacteria 2904601388 2904601454 274
155 iso_pu_bacteria 2919079590 2919082895 274
156 iso_pu_bacteria 2984494565 2984497241 274
157 iso_pu_bacteria 2990261002 2990261193 274
158 3300046522 Ga0495643_0000076 Ga0495643_0000076_57401_58237 275
159 3300046542 Ga0495597_0001805 Ga0495597_0001805_12344_13180 275
160 3300046810 Ga0495660_0040419 Ga0495660_0040419_634_1470 275
161 3300047443 Ga0495687_007732 Ga0495687_007732_2316_3152 275
162 3300025711 Ga0207696_1000021 Ga0207696_1000021369 277
163 3300046462 Ga0495651_0055742 Ga0495651_0055742_1069_2019 277
164 iso_pu_bacteria 2834578030 2834581460 277
165 iso_pu_bacteria 2904504865 2904508720 277
166 3300003794 Ga0055531_10000001 Ga0055531_10000001374 279
167 3300025298 Ga0209050_1015041 Ga0209050_10150412 279
168 3300025303 Ga0209051_1015923 Ga0209051_10159232 279
169 3300025304 Ga0209257_1000033 Ga0209257_1000033462 279
170 3300044684 Ga0466966_0000119 Ga0466966_0000119_31246_32157 279
171 3300044693 Ga0466961_0000541 Ga0466961_0000541_3514_4425 279
172 3300044694 Ga0466963_0176402 Ga0466963_0176402_93_1004 279
173 3300044719 Ga0466971_0017491 Ga0466971_0017491_814_1725 279
174 3300045049 Ga0466959_0005503 Ga0466959_0005503_978_1889 279
175 3300045836 Ga0466958_0011314 Ga0466958_0011314_3080_3991 279
176 3300061719 Ga0466962_0030410 Ga0466962_0030410_881_1792 279
177 iso_pu_bacteria 2551306416 2553004818 279
178 iso_pu_bacteria 2857553236 2857556042 279
179 iso_pu_bacteria 2923510766 2923515651 279
180 3300003771 Ga0055526_1000140 Ga0055526_100014024 280
181 3300003773 Ga0055537_1000113 Ga0055537_100011350 280
182 3300003775 Ga0055524_1017504 Ga0055524_10175041 280
183 3300003784 Ga0055534_1000023 Ga0055534_100002341 280
184 3300003790 Ga0055528_1000030 Ga0055528_100003041 280
185 3300009093 Ga0105240_10006939 Ga0105240_1000693910 280
186 3300013105 Ga0157369_10002302 Ga0157369_100023027 280
187 3300013296 Ga0157374_10000044 Ga0157374_1000004413 280
188 3300025256 Ga0209759_1007285 Ga0209759_10072852 280
189 3300025263 Ga0209565_1000003 Ga0209565_1000003151 280
190 3300025273 Ga0209673_1000003 Ga0209673_100000337 280
191 3300025291 Ga0209675_1000003 Ga0209675_1000003887 280
192 3300025295 Ga0209564_1000012 Ga0209564_1000012696 280
193 3300025299 Ga0209256_1000235 Ga0209256_100023551 280
194 3300025904 Ga0207647_10059091 Ga0207647_100590913 280
195 3300038443 Ga0395901_0168031 Ga0395901_0168031_992_1843 280
196 3300042005 Ga0439448_0000202 Ga0439448_0000202_3652_4503 280
197 3300046460 Ga0495638_0023309 Ga0495638_0023309_2107_2949 280
198 3300046491 Ga0495584_0019591 Ga0495584_0019591_1672_2514 280
199 3300046501 Ga0495607_0001363 Ga0495607_0001363_4054_4896 280
200 3300046513 Ga0495616_0007504 Ga0495616_0007504_3659_4501 280
201 3300046528 Ga0495642_0013441 Ga0495642_0013441_1103_1945 280
202 3300046538 Ga0495609_0000481 Ga0495609_0000481_25100_25942 280
203 3300046616 Ga0495668_0014989 Ga0495668_0014989_1311_2153 280
204 3300046660 Ga0495625_0003122 Ga0495625_0003122_12857_13699 280
205 3300046664 Ga0495659_0000903 Ga0495659_0000903_7010_7852 280
206 3300046665 Ga0495661_0029148 Ga0495661_0029148_1367_2209 280
207 3300046684 Ga0495669_0029487 Ga0495669_0029487_1241_2083 280
208 3300047318 Ga0495636_0021392 Ga0495636_0021392_452_1294 280
209 3300047320 Ga0495672_0000329 Ga0495672_0000329_39493_40350 280
210 3300047445 Ga0495677_0002168 Ga0495677_0002168_5875_6717 280
211 3300047447 Ga0495685_028110 Ga0495685_028110_170_1012 280
212 3300037312 Ga0395899_0083063 Ga0395899_0083063_1247_2107 281
213 3300037418 Ga0395900_0021122 Ga0395900_0021122_2685_3545 281
214 3300037466 Ga0395898_0189795 Ga0395898_0189795_612_1472 281
215 3300038443 Ga0395901_0017496 Ga0395901_0017496_1162_2022 281
216 3300046500 Ga0495596_0000139 Ga0495596_0000139_28466_29311 281
217 3300046501 Ga0495607_0000057 Ga0495607_0000057_32269_33129 281
218 3300046513 Ga0495616_0028654 Ga0495616_0028654_1275_2135 281
219 3300046518 Ga0495631_0023509 Ga0495631_0023509_291_1136 281
220 3300046518 Ga0495631_0058922 Ga0495631_0058922_138_998 281
221 3300046522 Ga0495643_0000383 Ga0495643_0000383_45072_45932 281
222 3300046525 Ga0495663_0005115 Ga0495663_0005115_2551_3396 281
223 3300046539 Ga0495621_0150620 Ga0495621_0150620_29_874 281
224 3300046558 Ga0495633_0004087 Ga0495633_0004087_4520_5365 281
225 3300046615 Ga0495656_0007237 Ga0495656_0007237_527_1372 281
226 3300046615 Ga0495656_0010347 Ga0495656_0010347_1433_2278 281
227 3300046665 Ga0495661_0000296 Ga0495661_0000296_44204_45064 281
228 3300046665 Ga0495661_0039714 Ga0495661_0039714_1785_2630 281
229 3300046684 Ga0495669_0001355 Ga0495669_0001355_7591_8436 281
230 3300046794 Ga0495589_0000022 Ga0495589_0000022_100896_101756 281
231 3300046810 Ga0495660_0000044 Ga0495660_0000044_69271_70131 281
232 3300047320 Ga0495672_0002598 Ga0495672_0002598_5880_6740 281
233 3300047323 Ga0495683_0015304 Ga0495683_0015304_871_1731 281
234 3300047443 Ga0495687_000099 Ga0495687_000099_59497_60357 281
235 3300048091 Ga0495626_0000021 Ga0495626_0000021_111900_112760 281
236 3300048910 Ga0496107_0059141 Ga0496107_0059141_252_1097 281
237 3300044658 Ga0466972_0000441 Ga0466972_0000441_6133_6987 282
238 3300044735 Ga0466968_0008533 Ga0466968_0008533_2478_3332 282
239 3300050492 nmdc:mga0yw44_87739_c1 nmdc:mga0yw44_87739_c1_351_1217 282
240 3300003771 Ga0055526_1001966 Ga0055526_100196612 283
241 3300003775 Ga0055524_1000042 Ga0055524_100004250 283
242 3300025294 Ga0209025_1000014 Ga0209025_1000014495 283
243 3300025295 Ga0209564_1000077 Ga0209564_1000077217 283
244 3300025299 Ga0209256_1000057 Ga0209256_1000057217 283
245 3300037418 Ga0395900_0221336 Ga0395900_0221336_604_1470 283
246 3300037418 Ga0395900_0606692 Ga0395900_0606692_111_977 283
247 3300046522 Ga0495643_0083783 Ga0495643_0083783_476_1330 283
248 3300046523 Ga0495644_0032616 Ga0495644_0032616_1051_1905 283
249 3300046538 Ga0495609_0000989 Ga0495609_0000989_9903_10757 283
250 3300046810 Ga0495660_0000199 Ga0495660_0000199_39653_40507 283
251 3300046810 Ga0495660_0003903 Ga0495660_0003903_4326_5180 283
252 3300047470 Ga0495681_0011961 Ga0495681_0011961_2599_3453 283
253 3300048919 Ga0496116_0030614 Ga0496116_0030614_2638_3492 283
254 3300048926 Ga0496123_0055242 Ga0496123_0055242_824_1681 283
255 3300049459 Ga0495678_000032 Ga0495678_000032_111843_112697 283
256 3300049573 Ga0501037_0215418 Ga0501037_0215418_432_1298 283
257 iso_pu_bacteria 2879083081 2879088629 283
258 iso_pu_bacteria 2881665667 2881670506 283
259 iso_pu_bacteria 2904615490 2904620942 283
260 iso_pu_bacteria 8056673599 8056677961 283
261 3300006942 Ga0099824_1021235 Ga0099824_10212352 284
262 3300006944 Ga0099823_1010346 Ga0099823_101034610 284
263 3300025919 Ga0207657_10013430 Ga0207657_100134308 284
264 3300027296 Ga0209389_1007805 Ga0209389_10078056 284
265 3300027361 Ga0209489_111119 Ga0209489_1111196 284
266 3300027363 Ga0209700_110564 Ga0209700_1105646 284
267 3300042185 Ga0450909_011586 Ga0450909_011586_229_1086 284
268 3300046512 Ga0495610_0021749 Ga0495610_0021749_198_1055 284
269 3300046660 Ga0495625_0027744 Ga0495625_0027744_2264_3121 284
270 iso_pu_bacteria 2738541280 2738737658 284
271 iso_pu_bacteria 2738541300 2738841862 284
272 iso_pu_bacteria 2738543018 2739272721 284
273 iso_pu_bacteria 2738543030 2739341765 284
274 iso_pu_bacteria 2904424332 2904425855 284
275 3300021320 Ga0214544_1016050 Ga0214544_10160504 286
276 3300021321 Ga0214542_1001265 Ga0214542_10012656 286
277 3300021327 Ga0214543_1001031 Ga0214543_100103149 286
278 3300046506 Ga0495583_0000051 Ga0495583_0000051_124147_125007 286
279 3300047443 Ga0495687_027300 Ga0495687_027300_671_1531 286
280 3300048091 Ga0495626_0039305 Ga0495626_0039305_1082_1942 286
281 3300013105 Ga0157369_10000228 Ga0157369_1000022852 287
282 3300037418 Ga0395900_0027647 Ga0395900_0027647_4658_5572 287
283 3300037466 Ga0395898_0000195 Ga0395898_0000195_8082_8996 287
284 3300044658 Ga0466972_0003781 Ga0466972_0003781_3276_4190 287
285 3300044684 Ga0466966_0000278 Ga0466966_0000278_25279_26193 287
286 3300044694 Ga0466963_0015018 Ga0466963_0015018_1018_1932 287
287 3300061719 Ga0466962_0004168 Ga0466962_0004168_1540_2454 287
288 3300046452 Ga0495617_074927 Ga0495617_074927_175_1047 288
289 3300046452 Ga0495617_075434 Ga0495617_075434_155_1027 288
290 3300046457 Ga0495590_0073148 Ga0495590_0073148_109_981 288
291 3300046460 Ga0495638_0007760 Ga0495638_0007760_4942_5814 288
292 3300046472 Ga0495580_0026887 Ga0495580_0026887_2508_3464 288
293 3300046474 Ga0495605_0000618 Ga0495605_0000618_3725_4597 288
294 3300046491 Ga0495584_0000124 Ga0495584_0000124_13560_14432 288
295 3300046501 Ga0495607_0029522 Ga0495607_0029522_25_897 288
296 3300046506 Ga0495583_0000045 Ga0495583_0000045_111538_112410 288
297 3300046512 Ga0495610_0028534 Ga0495610_0028534_21_893 288
298 3300046513 Ga0495616_0025799 Ga0495616_0025799_1650_2522 288
299 3300046523 Ga0495644_0000939 Ga0495644_0000939_2164_3036 288
300 3300046523 Ga0495644_0001018 Ga0495644_0001018_4296_5168 288
301 3300046524 Ga0495648_0000245 Ga0495648_0000245_43913_44785 288
302 3300046538 Ga0495609_0000157 Ga0495609_0000157_7227_8099 288
303 3300046542 Ga0495597_0024114 Ga0495597_0024114_1160_2032 288
304 3300046558 Ga0495633_0005541 Ga0495633_0005541_6563_7435 288
305 3300046615 Ga0495656_0101840 Ga0495656_0101840_130_1002 288
306 3300046648 Ga0495611_0000610 Ga0495611_0000610_19543_20415 288
307 3300046660 Ga0495625_0002235 Ga0495625_0002235_47_919 288
308 3300046664 Ga0495659_0000003 Ga0495659_0000003_133901_134773 288
309 3300046664 Ga0495659_0009486 Ga0495659_0009486_1755_2627 288
310 3300046691 Ga0495670_0061666 Ga0495670_0061666_120_992 288
311 3300046692 Ga0495671_0000077 Ga0495671_0000077_34764_35636 288
312 3300046794 Ga0495589_0059318 Ga0495589_0059318_538_1410 288
313 3300047318 Ga0495636_0000325 Ga0495636_0000325_16461_17333 288
314 3300047320 Ga0495672_0000023 Ga0495672_0000023_146289_147161 288
315 3300047320 Ga0495672_0044128 Ga0495672_0044128_592_1464 288
316 3300047320 Ga0495672_0071465 Ga0495672_0071465_1045_1917 288
317 3300047323 Ga0495683_0132810 Ga0495683_0132810_47_919 288
318 3300047443 Ga0495687_000156 Ga0495687_000156_19698_20570 288
319 3300047445 Ga0495677_0009204 Ga0495677_0009204_547_1419 288
320 3300047447 Ga0495685_000022 Ga0495685_000022_17286_18158 288
321 3300047469 Ga0495673_0063343 Ga0495673_0063343_23_895 288
322 3300049459 Ga0495678_001681 Ga0495678_001681_2023_2895 288
323 3300049460 Ga0495682_0000679 Ga0495682_0000679_15039_15911 288
324 3300049460 Ga0495682_0002613 Ga0495682_0002613_7278_8150 288
325 3300044656 Ga0466969_0014066 Ga0466969_0014066_443_1363 289
326 3300044693 Ga0466961_0029752 Ga0466961_0029752_188_1108 289
327 3300044706 Ga0466964_0004164 Ga0466964_0004164_1212_2132 289
328 3300044842 Ga0466957_0003348 Ga0466957_0003348_7836_8756 289
329 3300045049 Ga0466959_0094285 Ga0466959_0094285_194_1114 289
330 3300045836 Ga0466958_0006155 Ga0466958_0006155_153_1073 289
331 3300046460 Ga0495638_0000126 Ga0495638_0000126_33206_34084 289
332 3300046471 Ga0495650_0003508 Ga0495650_0003508_9487_10365 289
333 3300046472 Ga0495580_0005017 Ga0495580_0005017_391_1275 289
334 3300046475 Ga0495639_0012562 Ga0495639_0012562_1460_2338 289
335 3300046506 Ga0495583_0000048 Ga0495583_0000048_91033_91911 289
336 3300046516 Ga0495628_0087564 Ga0495628_0087564_1471_2343 289
337 3300046524 Ga0495648_0000081 Ga0495648_0000081_33266_34144 289
338 3300046526 Ga0495666_0000782 Ga0495666_0000782_391_1275 289
339 3300046528 Ga0495642_0003294 Ga0495642_0003294_2340_3218 289
340 3300046538 Ga0495609_0004887 Ga0495609_0004887_5112_5990 289
341 3300046557 Ga0495622_0000250 Ga0495622_0000250_8331_9209 289
342 3300046558 Ga0495633_0000182 Ga0495633_0000182_33161_34039 289
343 3300046616 Ga0495668_0000081 Ga0495668_0000081_75500_76378 289
344 3300046660 Ga0495625_0000075 Ga0495625_0000075_71805_72683 289
345 3300047317 Ga0495604_0037994 Ga0495604_0037994_1964_2848 289
346 3300049459 Ga0495678_000615 Ga0495678_000615_5888_6766 289
347 iso_pu_bacteria 2808606361 2808854767 289
348 iso_pu_bacteria 2808606376 2808925123 289
349 iso_pu_bacteria 2808606378 2808935038 289
350 iso_pu_bacteria 2808606380 2808947271 289
351 iso_pu_bacteria 2808606383 2808963435 289
352 iso_pu_bacteria 2808606389 2808998160 289
353 3300047319 Ga0495674_0049314 Ga0495674_0049314_2822_3706 291
354 3300037418 Ga0395900_0000089 Ga0395900_0000089_89193_90107 292
355 3300037418 Ga0395900_0144665 Ga0395900_0144665_60_974 293
356 3300037466 Ga0395898_0023271 Ga0395898_0023271_3100_4014 293
357 3300038443 Ga0395901_0000012 Ga0395901_0000012_93995_94909 293
358 3300044735 Ga0466968_0006080 Ga0466968_0006080_2388_3293 293
359 3300005366 Ga0070659_100017302 Ga0070659_1000173027 295
360 3300005563 Ga0068855_100006465 Ga0068855_1000064654 295
361 3300025909 Ga0207705_10000980 Ga0207705_1000098013 295
362 3300025913 Ga0207695_10044552 Ga0207695_100445523 295
363 3300025932 Ga0207690_10013878 Ga0207690_100138787 295
364 3300044658 Ga0466972_0110074 Ga0466972_0110074_351_1271 295
365 3300044683 Ga0466965_0023567 Ga0466965_0023567_985_1905 295
366 3300044765 Ga0466970_0001635 Ga0466970_0001635_3560_4480 295
367 3300013105 Ga0157369_10494188 Ga0157369_104941881 296
368 3300041405 Ga0439438_003271 Ga0439438_003271_4291_5217 296
369 3300041407 Ga0439447_000113 Ga0439447_000113_22124_23050 296
370 3300041411 Ga0439466_0000330 Ga0439466_0000330_9154_10080 296
371 3300042006 Ga0439432_003203 Ga0439432_003203_4706_5632 296
372 3300042006 Ga0439432_003364 Ga0439432_003364_2599_3525 296
373 3300042010 Ga0439452_000669 Ga0439452_000669_5904_6830 296
374 3300042013 Ga0439456_003706 Ga0439456_003706_2162_3088 296
375 3300042125 Ga0450923_000576 Ga0450923_000576_815_1741 296
376 3300042156 Ga0439446_0000397 Ga0439446_0000397_214_1140 296
377 3300042435 Ga0439434_0000322 Ga0439434_0000322_11426_12352 296
378 3300046459 Ga0495629_0019695 Ga0495629_0019695_1592_2491 296
379 3300046463 Ga0495653_0003362 Ga0495653_0003362_9610_10509 296
380 3300046471 Ga0495650_0004174 Ga0495650_0004174_7242_8150 296
381 3300046507 Ga0495606_0041605 Ga0495606_0041605_1710_2609 296
382 3300046516 Ga0495628_0015339 Ga0495628_0015339_3331_4230 296
383 3300046531 Ga0495665_0003388 Ga0495665_0003388_3723_4622 296
384 3300046535 Ga0495586_0112773 Ga0495586_0112773_568_1467 296
385 3300046543 Ga0495645_0037197 Ga0495645_0037197_1657_2556 296
386 3300046680 Ga0495646_0007639 Ga0495646_0007639_1352_2251 296
387 3300046690 Ga0495624_0004071 Ga0495624_0004071_4134_5033 296
388 3300047317 Ga0495604_0004362 Ga0495604_0004362_2189_3088 296
389 3300047319 Ga0495674_0082939 Ga0495674_0082939_1758_2657 296
390 3300047322 Ga0495680_0002474 Ga0495680_0002474_13679_14578 296
391 3300047444 Ga0495675_0088000 Ga0495675_0088000_531_1430 296
392 3300047673 Ga0495593_0008087 Ga0495593_0008087_3021_3920 296
393 3300048088 Ga0495602_0000401 Ga0495602_0000401_23730_24629 296
394 3300048089 Ga0495614_0047352 Ga0495614_0047352_747_1646 296
395 3300048903 Ga0496100_0296876 Ga0496100_0296876_279_1178 296
396 3300048904 Ga0496101_0040754 Ga0496101_0040754_535_1434 296
397 3300048908 Ga0496105_0019613 Ga0496105_0019613_3672_4571 296
398 3300048917 Ga0496114_0234726 Ga0496114_0234726_318_1217 296
399 3300048921 Ga0496118_0086256 Ga0496118_0086256_1188_2087 296
400 iso_pu_bacteria 2883087390 2883093377 296
401 3300013105 Ga0157369_10000602 Ga0157369_1000060221 300
402 3300037312 Ga0395899_0000005 Ga0395899_0000005_498259_499173 300
403 3300037312 Ga0395899_0021416 Ga0395899_0021416_372_1286 300
404 3300037418 Ga0395900_0000003 Ga0395900_0000003_273794_274708 300
405 3300037418 Ga0395900_0223167 Ga0395900_0223167_372_1286 300
406 3300037466 Ga0395898_0000003 Ga0395898_0000003_498279_499193 300
407 3300037466 Ga0395898_0027732 Ga0395898_0027732_4521_5435 300
408 3300038443 Ga0395901_0000038 Ga0395901_0000038_143642_144556 300
409 3300038443 Ga0395901_0000879 Ga0395901_0000879_27260_28174 300
410 3300048903 Ga0496100_0083149 Ga0496100_0083149_506_1417 300
411 3300003320 rootH2_10223114 rootH2_102231142 301
412 3300003322 rootL2_10047863 rootL2_1004786314 301
413 3300016635 Ga0183361_10008 Ga0183361_10008107 301
414 3300048921 Ga0496118_0006980 Ga0496118_0006980_8349_9299 301
415 3300009011 Ga0105251_10000589 Ga0105251_100005896 302
416 3300015262 Ga0182007_10002899 Ga0182007_100028994 302
417 3300025735 Ga0207713_1000948 Ga0207713_10009484 302
418 3300025904 Ga0207647_10003763 Ga0207647_100037634 302
419 3300003760 Ga0055527_1007591 Ga0055527_10075912 303
420 3300025228 Ga0209672_101439 Ga0209672_1014396 303
421 3300002067 JGI24735J21928_10000337 JGI24735J21928_100003379 306
422 3300009011 Ga0105251_10002303 Ga0105251_100023038 306
423 3300009551 Ga0105238_10164876 Ga0105238_101648762 306
424 3300025302 Ga0207426_1005502 Ga0207426_10055024 306
425 3300025735 Ga0207713_1017465 Ga0207713_10174654 306
426 3300046457 Ga0495590_0000661 Ga0495590_0000661_1280_2209 306
427 3300046515 Ga0495620_0004311 Ga0495620_0004311_2974_3903 306
428 3300046542 Ga0495597_0002312 Ga0495597_0002312_6337_7266 306
429 3300047323 Ga0495683_0001365 Ga0495683_0001365_3060_3989 306
430 3300048904 Ga0496101_0003949 Ga0496101_0003949_2813_3742 306
431 3300048906 Ga0496103_0018234 Ga0496103_0018234_94_1023 306
432 3300048909 Ga0496106_0004785 Ga0496106_0004785_5561_6490 306
433 3300048914 Ga0496111_0003065 Ga0496111_0003065_3649_4578 306
434 3300048915 Ga0496112_0042543 Ga0496112_0042543_2562_3491 306
435 3300048919 Ga0496116_0003487 Ga0496116_0003487_5193_6122 306
436 3300048920 Ga0496117_0004925 Ga0496117_0004925_5357_6286 306
437 3300048924 Ga0496121_0008748 Ga0496121_0008748_10485_11441 306
438 3300048925 Ga0496122_0013824 Ga0496122_0013824_1233_2162 306
439 3300048927 Ga0496124_0042678 Ga0496124_0042678_2494_3423 306
440 3300048928 Ga0496125_0010970 Ga0496125_0010970_2689_3618 306
441 3300009545 Ga0105237_10059385 Ga0105237_100593852 307
442 3300037471 Ga0395905_0021937 Ga0395905_0021937_363_1295 307
443 3300045976 Ga0466967_0124237 Ga0466967_0124237_1418_2350 307
444 3300046463 Ga0495653_0181480 Ga0495653_0181480_42_974 307
445 3300047443 Ga0495687_000005 Ga0495687_000005_58337_59269 307
446 3300047673 Ga0495593_0033754 Ga0495593_0033754_203_1135 307
447 3300031548 Ga0307408_100046811 Ga0307408_1000468112 308
448 iso_pu_bacteria 2919527303 2919529805 309
449 iso_pu_bacteria 2508501125 2509131853 310
450 iso_pu_bacteria 2513237151 2513963579 310
451 iso_pu_bacteria 2526164713 2527080258 310
452 iso_pu_bacteria 2744054900 2746085260 310
453 iso_pu_bacteria 2744054900 2746089719 310
454 iso_pu_bacteria 2744054901 2746095339 310
455 iso_pu_bacteria 2744054901 2746099110 310
456 iso_pu_bacteria 2842324504 2842325435 310
457 iso_pu_bacteria 2842348783 2842349714 310
458 iso_pu_bacteria 2842454564 2842455050 310
459 iso_pu_bacteria 2900634093 2900640156 310
460 iso_pu_bacteria 2904483920 2904489192 310
461 iso_pu_bacteria 642555112 642598261 310
462 iso_pu_bacteria 642555113 642617148 310
463 iso_pu_bacteria 8055266321 8055272637 310
464 iso_pu_bacteria 8055301274 8055303830 310
465 3300048920 Ga0496117_0091491 Ga0496117_0091491_13_948 311
466 iso_pu_bacteria 2501025501 2501070665 311
467 iso_pu_bacteria 2501025502 2501083990 311
468 iso_pu_bacteria 2501025504 2501407397 311
469 iso_pu_bacteria 2510917013 2511091590 311
470 iso_pu_bacteria 2510917014 2511098285 311
471 iso_pu_bacteria 2510917015 2511108502 311
472 iso_pu_bacteria 2515154189 2516022145 311
473 iso_pu_bacteria 2515154189 2516023939 311
474 iso_pu_bacteria 2562617112 2563057232 311
475 iso_pu_bacteria 2711768613 2713480896 311
476 iso_pu_bacteria 2751185846 2753570690 311
477 iso_pu_bacteria 2791355137 2792835455 311
478 iso_pu_bacteria 2818991450 2819621420 311
479 iso_pu_bacteria 2883087390 2883092577 311
480 iso_pu_bacteria 2904615490 2904625447 311
481 iso_pu_bacteria 2921643360 2921653417 311
482 iso_pu_bacteria 2928108538 2928109067 311
483 iso_pu_bacteria 2928135762 2928136290 311
484 iso_pu_bacteria 2928503688 2928503928 311
485 3300003316 rootH1_10113418 rootH1_101134182 312
486 3300013308 Ga0157375_10097142 Ga0157375_100971422 312
487 3300045836 Ga0466958_0013059 Ga0466958_0013059_337_1290 312
488 3300046501 Ga0495607_0061853 Ga0495607_0061853_67_1011 312
489 iso_pu_bacteria 2512047030 2512352808 312
490 iso_pu_bacteria 2513237166 2514049760 312
491 iso_pu_bacteria 2883087390 2883093412 312
492 iso_pu_bacteria 2921643360 2921654696 312
493 3300044656 Ga0466969_0001893 Ga0466969_0001893_7629_8594 313
494 3300044659 Ga0466973_0115060 Ga0466973_0115060_536_1501 313
495 3300044683 Ga0466965_0000248 Ga0466965_0000248_9398_10363 313
496 3300044693 Ga0466961_0000027 Ga0466961_0000027_33613_34578 313
497 3300044694 Ga0466963_0000853 Ga0466963_0000853_6294_7259 313
498 3300044765 Ga0466970_0010556 Ga0466970_0010556_609_1574 313
499 3300044842 Ga0466957_0001156 Ga0466957_0001156_10885_11850 313
500 3300045049 Ga0466959_0016681 Ga0466959_0016681_3209_4174 313
501 3300045836 Ga0466958_0003615 Ga0466958_0003615_227_1192 313
502 3300013105 Ga0157369_10053954 Ga0157369_100539542 314
503 3300025256 Ga0209759_1000315 Ga0209759_100031557 314
504 3300046457 Ga0495590_0026334 Ga0495590_0026334_934_1884 314
505 3300046459 Ga0495629_0000262 Ga0495629_0000262_5612_6562 314
506 3300046460 Ga0495638_0055671 Ga0495638_0055671_328_1278 314
507 3300046462 Ga0495651_0016750 Ga0495651_0016750_2015_2965 314
508 3300046463 Ga0495653_0000323 Ga0495653_0000323_28712_29662 314
509 3300046471 Ga0495650_0005548 Ga0495650_0005548_2805_3755 314
510 3300046472 Ga0495580_0001493 Ga0495580_0001493_3803_4753 314
511 3300046472 Ga0495580_0006388 Ga0495580_0006388_1020_1970 314
512 3300046473 Ga0495582_0034963 Ga0495582_0034963_719_1669 314
513 3300046474 Ga0495605_0023809 Ga0495605_0023809_1600_2550 314
514 3300046500 Ga0495596_0023354 Ga0495596_0023354_501_1451 314
515 3300046506 Ga0495583_0021698 Ga0495583_0021698_284_1234 314
516 3300046507 Ga0495606_0026644 Ga0495606_0026644_56_1006 314
517 3300046516 Ga0495628_0003789 Ga0495628_0003789_8215_9165 314
518 3300046516 Ga0495628_0031002 Ga0495628_0031002_2216_3166 314
519 3300046524 Ga0495648_0051808 Ga0495648_0051808_1012_1962 314
520 3300046526 Ga0495666_0008312 Ga0495666_0008312_4033_4983 314
521 3300046542 Ga0495597_0021306 Ga0495597_0021306_1035_1985 314
522 3300046557 Ga0495622_0000017 Ga0495622_0000017_28851_29801 314
523 3300046648 Ga0495611_0034846 Ga0495611_0034846_1169_2119 314
524 3300046660 Ga0495625_0070370 Ga0495625_0070370_1250_2200 314
525 3300046665 Ga0495661_0010739 Ga0495661_0010739_2901_3851 314
526 3300046678 Ga0495599_0003773 Ga0495599_0003773_5519_6469 314
527 3300046678 Ga0495599_0010288 Ga0495599_0010288_2760_3710 314
528 3300046679 Ga0495623_0003778 Ga0495623_0003778_7715_8665 314
529 3300046680 Ga0495646_0005651 Ga0495646_0005651_6869_7819 314
530 3300046684 Ga0495669_0020319 Ga0495669_0020319_701_1651 314
531 3300046689 Ga0495613_0135745 Ga0495613_0135745_304_1254 314
532 3300046690 Ga0495624_0004857 Ga0495624_0004857_7596_8546 314
533 3300046690 Ga0495624_0007011 Ga0495624_0007011_1242_2192 314
534 3300046692 Ga0495671_0036750 Ga0495671_0036750_588_1538 314
535 3300046694 Ga0495649_0065671 Ga0495649_0065671_183_1133 314
536 3300046794 Ga0495589_0010783 Ga0495589_0010783_3384_4334 314
537 3300047317 Ga0495604_0000860 Ga0495604_0000860_7821_8771 314
538 3300047317 Ga0495604_0001940 Ga0495604_0001940_2659_3609 314
539 3300047319 Ga0495674_0010082 Ga0495674_0010082_3783_4733 314
540 3300047320 Ga0495672_0010552 Ga0495672_0010552_588_1538 314
541 3300047320 Ga0495672_0010884 Ga0495672_0010884_3135_4091 314
542 3300047322 Ga0495680_0010022 Ga0495680_0010022_190_1140 314
543 3300047323 Ga0495683_0084105 Ga0495683_0084105_11_961 314
544 3300047443 Ga0495687_027825 Ga0495687_027825_303_1253 314
545 3300047444 Ga0495675_0006315 Ga0495675_0006315_846_1796 314
546 3300047444 Ga0495675_0050659 Ga0495675_0050659_217_1167 314
547 3300047446 Ga0495679_000006 Ga0495679_000006_406579_407529 314
548 3300047469 Ga0495673_0034718 Ga0495673_0034718_1291_2247 314
549 3300047469 Ga0495673_0041425 Ga0495673_0041425_588_1538 314
550 3300047472 Ga0495686_0007017 Ga0495686_0007017_4909_5859 314
551 3300048088 Ga0495602_0018775 Ga0495602_0018775_3341_4291 314
552 3300048920 Ga0496117_0050453 Ga0496117_0050453_1067_2017 314
553 3300048921 Ga0496118_0008437 Ga0496118_0008437_5675_6625 314
554 3300048924 Ga0496121_0021824 Ga0496121_0021824_1205_2155 314
555 3300048929 Ga0496126_0003191 Ga0496126_0003191_7919_8869 314
556 3300049459 Ga0495678_030648 Ga0495678_030648_1029_1979 314
557 3300049460 Ga0495682_0063338 Ga0495682_0063338_328_1278 314
558 3300002067 JGI24735J21928_10004539 JGI24735J21928_100045393 315
559 3300003320 rootH2_10043500 rootH2_100435002 315
560 3300003322 rootL2_10012384 rootL2_100123843 315
561 3300003354 JGI25160J50197_1000083 JGI25160J50197_100008363 315
562 3300005262 Ga0065165_1000445 Ga0065165_100044546 315
563 3300005327 Ga0070658_10007580 Ga0070658_100075802 315
564 3300005339 Ga0070660_100011491 Ga0070660_1000114915 315
565 3300005614 Ga0068856_100302128 Ga0068856_1003021282 315
566 3300009093 Ga0105240_10016580 Ga0105240_100165805 315
567 3300009093 Ga0105240_10216198 Ga0105240_102161982 315
568 3300009545 Ga0105237_10027720 Ga0105237_100277203 315
569 3300010375 Ga0105239_10060853 Ga0105239_100608534 315
570 3300013100 Ga0157373_10006261 Ga0157373_100062614 315
571 3300013104 Ga0157370_10011214 Ga0157370_100112146 315
572 3300013105 Ga0157369_10188048 Ga0157369_101880482 315
573 3300013296 Ga0157374_10000370 Ga0157374_1000037031 315
574 3300013307 Ga0157372_10116521 Ga0157372_101165212 315
575 3300014497 Ga0182008_10077582 Ga0182008_100775822 315
576 3300015262 Ga0182007_10062862 Ga0182007_100628621 315
577 3300025284 Ga0209130_1006282 Ga0209130_10062822 315
578 3300025295 Ga0209564_1004776 Ga0209564_10047764 315
579 3300025302 Ga0207426_1000004 Ga0207426_1000004209 315
580 3300025904 Ga0207647_10000608 Ga0207647_1000060811 315
581 3300025909 Ga0207705_10292981 Ga0207705_102929812 315
582 3300025913 Ga0207695_10020394 Ga0207695_100203946 315
583 3300025914 Ga0207671_10130825 Ga0207671_101308252 315
584 3300025919 Ga0207657_10000131 Ga0207657_1000013112 315
585 3300025949 Ga0207667_10039402 Ga0207667_100394023 315
586 3300042005 Ga0439448_0000471 Ga0439448_0000471_4862_5818 315
587 3300046455 Ga0495603_0000578 Ga0495603_0000578_275_1231 315
588 3300046455 Ga0495603_0001261 Ga0495603_0001261_5160_6113 315
589 3300046459 Ga0495629_0003589 Ga0495629_0003589_1888_2841 315
590 3300046460 Ga0495638_0159445 Ga0495638_0159445_130_1086 315
591 3300046471 Ga0495650_0002481 Ga0495650_0002481_8740_9693 315
592 3300046472 Ga0495580_0000147 Ga0495580_0000147_17232_18188 315
593 3300046472 Ga0495580_0046394 Ga0495580_0046394_1193_2146 315
594 3300046473 Ga0495582_0019221 Ga0495582_0019221_2377_3330 315
595 3300046476 Ga0495662_0007341 Ga0495662_0007341_1191_2144 315
596 3300046506 Ga0495583_0007823 Ga0495583_0007823_458_1414 315
597 3300046506 Ga0495583_0088876 Ga0495583_0088876_230_1183 315
598 3300046507 Ga0495606_0022633 Ga0495606_0022633_1504_2457 315
599 3300046513 Ga0495616_0013942 Ga0495616_0013942_190_1146 315
600 3300046528 Ga0495642_0002948 Ga0495642_0002948_692_1645 315
601 3300046543 Ga0495645_0052537 Ga0495645_0052537_1738_2691 315
602 3300046557 Ga0495622_0060908 Ga0495622_0060908_597_1553 315
603 3300046674 Ga0495588_0003798 Ga0495588_0003798_3635_4588 315
604 3300046684 Ga0495669_0013609 Ga0495669_0013609_1977_2930 315
605 3300046689 Ga0495613_0188066 Ga0495613_0188066_262_1215 315
606 3300046691 Ga0495670_0166231 Ga0495670_0166231_197_1150 315
607 3300046694 Ga0495649_0019697 Ga0495649_0019697_1482_2435 315
608 3300047315 Ga0495581_0026732 Ga0495581_0026732_284_1237 315
609 3300047320 Ga0495672_0065376 Ga0495672_0065376_363_1319 315
610 3300047443 Ga0495687_002286 Ga0495687_002286_9388_10341 315
611 3300047469 Ga0495673_0111771 Ga0495673_0111771_50_1006 315
612 3300047673 Ga0495593_0030295 Ga0495593_0030295_236_1189 315
613 3300048903 Ga0496100_0001004 Ga0496100_0001004_11629_12585 315
614 3300048903 Ga0496100_0019043 Ga0496100_0019043_154_1107 315
615 3300048904 Ga0496101_0000509 Ga0496101_0000509_15432_16388 315
616 3300048904 Ga0496101_0214979 Ga0496101_0214979_91_1047 315
617 3300048905 Ga0496102_0000252 Ga0496102_0000252_40658_41614 315
618 3300048906 Ga0496103_0000252 Ga0496103_0000252_26629_27585 315
619 3300048907 Ga0496104_0092890 Ga0496104_0092890_555_1511 315
620 3300048907 Ga0496104_0150849 Ga0496104_0150849_1006_1959 315
621 3300048907 Ga0496104_0493646 Ga0496104_0493646_98_1054 315
622 3300048908 Ga0496105_0262251 Ga0496105_0262251_310_1263 315
623 3300048913 Ga0496110_0277856 Ga0496110_0277856_328_1281 315
624 3300048916 Ga0496113_0021213 Ga0496113_0021213_301_1257 315
625 3300048917 Ga0496114_0224172 Ga0496114_0224172_304_1257 315
626 3300048920 Ga0496117_0000716 Ga0496117_0000716_16068_17024 315
627 3300048921 Ga0496118_0000218 Ga0496118_0000218_70905_71861 315
628 3300048922 Ga0496119_0096449 Ga0496119_0096449_92_1048 315
629 3300048924 Ga0496121_0003199 Ga0496121_0003199_11837_12793 315
630 3300037471 Ga0395905_0000035 Ga0395905_0000035_234789_235748 316
631 3300037471 Ga0395905_0000039 Ga0395905_0000039_55020_55979 316
632 3300046457 Ga0495590_0046967 Ga0495590_0046967_84_1043 316
633 3300046459 Ga0495629_0007991 Ga0495629_0007991_1072_2028 316
634 3300046472 Ga0495580_0035644 Ga0495580_0035644_1499_2455 316
635 3300046477 Ga0495664_0013991 Ga0495664_0013991_1332_2288 316
636 3300047319 Ga0495674_0011983 Ga0495674_0011983_4572_5528 316
637 3300048915 Ga0496112_0486903 Ga0496112_0486903_185_1141 316
638 3300046477 Ga0495664_0246129 Ga0495664_0246129_39_1010 318
639 3300046531 Ga0495665_0123159 Ga0495665_0123159_129_1100 318
640 iso_pu_bacteria 2738541296 2738824225 322
641 iso_pu_bacteria 2738541298 2738836634 322
642 iso_pu_bacteria 2738541306 2738878165 322
643 iso_pu_bacteria 2738543002 2739189857 322
644 iso_pu_bacteria 2738543008 2739224759 322
645 iso_pu_bacteria 2945934425 2945938303 322
646 iso_pu_bacteria 2990703756 2990708304 322
647 iso_pu_bacteria 641736151 642423435 322
648 3300001979 JGI24740J21852_10007347 JGI24740J21852_100073472 326
649 3300001989 JGI24739J22299_10002344 JGI24739J22299_100023444 326
650 3300002067 JGI24735J21928_10002387 JGI24735J21928_100023876 326
651 3300005455 Ga0070663_100057523 Ga0070663_1000575232 326
652 3300005563 Ga0068855_100238474 Ga0068855_1002384742 326
653 3300009551 Ga0105238_10278131 Ga0105238_102781312 326
654 3300025256 Ga0209759_1015299 Ga0209759_10152992 326
655 3300025924 Ga0207694_10203157 Ga0207694_102031572 326
656 3300026067 Ga0207678_10321698 Ga0207678_103216982 326
657 3300031911 Ga0307412_10000002 Ga0307412_10000002623 326
658 3300046507 Ga0495606_0046436 Ga0495606_0046436_1435_2415 326
659 3300046512 Ga0495610_0003200 Ga0495610_0003200_4295_5275 326
660 3300046694 Ga0495649_0023831 Ga0495649_0023831_855_1835 326
661 3300046794 Ga0495589_0042144 Ga0495589_0042144_1059_2039 326
662 3300047323 Ga0495683_0060526 Ga0495683_0060526_193_1173 326
663 3300047443 Ga0495687_005206 Ga0495687_005206_6482_7462 326
664 3300048091 Ga0495626_0050167 Ga0495626_0050167_658_1638 326
665 3300048921 Ga0496118_0007142 Ga0496118_0007142_8498_9478 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

142

322

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7842 126 319
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.733 126 319
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7092 126 319
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7082 126 319
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.6969 127 312
ID Description Score Start End Superfamily
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.902 114 319 1.10.3720.10
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9003 118 318 1.10.3720.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8995 114 317 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8958 118 319 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8938 114 319 1.10.3720.10
ID Description Score Start End GO Terms
AF-R4WPX8-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9384 60 326 GO:0005886
GO:0055085
AF-W1WJM0-F1-model_v4 Putative D,D-dipeptide transport system permease protein ddpC 0.9336 123 253 GO:0005886
GO:0071916
AF-I5CZM6-F1-model_v4 deleted 0.9293 53 326
AF-A0A2A3B9R9-F1-model_v4 deleted 0.9255 60 316
AF-I5CZM6-F1-model_v4 deleted 0.9196 53 326

Feature Viewer

pLDDT pTM Quality
74.77 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map