F473659

General Info

Members Datasets Scaffolds Average Seq Length
664 389 1328 246

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0181961|Ga0501038_0181961_154_1020
Length 288
Sequence VPVDPYGASGGVPGAAPVSGFGAGAGAWLAGLGGLRNAVRQELVARQLDEQIAARFPLGRRLRVLDVGPGQGTQALRLARAGHLVTGLEPDPVMLEALRGALAAEPEGIRERVLLVAGDGRQAGRHFGPGSFDVVLCHGVLMYLPEPEAEALLAALARVLAPGGLLSLLVRNGDALAMRPGLLGDWAAALDALPPHGPHAGSPSYTNRLGLPVRADTRADLERTLAGIAAPAAAWYGVRVFTDAAPDGEAPPADPESWARLLAAEEAAGRTDPYRSVAALLHLCGVRA

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
66 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
126 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
127 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
284 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
312 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
313 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
316 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
317 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
318 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
323 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
324 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
325 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
326 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
327 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
328 2643221578 Streptomyces sp. Root63 Isolate Unclassified
329 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
330 2643221647 Streptomyces sp. Root369 Isolate Unclassified
331 2643221670 Streptomyces sp. Root431 Isolate Unclassified
332 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
333 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
334 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
335 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
336 2643221714 Streptomyces sp. Root264 Isolate Unclassified
337 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
338 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
339 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
340 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
341 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
342 2808606448 Streptomyces sp. 193411 Isolate Unclassified
343 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
344 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
345 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
346 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
347 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
348 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
349 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
350 2862574272 Streptomyces sp. AcE210 Isolate Nodule
351 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
352 2867428634 Streptomyces sp. RP5T Isolate Unclassified
353 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
354 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
355 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
356 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
357 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
358 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
359 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
360 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
361 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
362 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
363 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
364 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
365 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
366 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
367 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
368 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
369 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
370 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
371 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
372 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
373 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
374 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
375 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
376 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
377 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
378 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
379 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
380 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
381 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
382 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
383 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
384 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
385 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
386 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
387 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
388 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
389 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.86
Metatranscriptomes 0.9
Isolates 10.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0.15
Rhizoplane 2.11
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0181961 3300049574 Bacteria 1696
2 JGI24737J22298_10054646 3300001990 Bacteria 1208
3 JGI24738J21930_10005305 3300002075 Bacteria 3100
4 rootH1_10002866 3300003316 Bacteria 3877
5 rootH2_10041012 3300003320 Bacteria 2222
6 rootH2_10089834 3300003320 Bacteria 2400
7 Ga0006562J51391_1184680 3300003578 Bacteria 1580
8 Ga0006562J51391_1212009 3300003578 Bacteria 1319
9 Ga0070683_100104696 3300005329 Bacteria 2667
10 Ga0070690_100043401 3300005330 Bacteria 2852
11 Ga0068869_100285810 3300005334 Bacteria 1327
12 Ga0070680_100048824 3300005336 Bacteria 3449
13 Ga0068868_100135477 3300005338 Bacteria 2018
14 Ga0070691_10050277 3300005341 Bacteria 1988
15 Ga0070687_100148350 3300005343 Bacteria 1374
16 Ga0070669_100391162 3300005353 Bacteria 1136
17 Ga0070675_100114559 3300005354 Bacteria 2284
18 Ga0070671_100086396 3300005355 Bacteria 2624
19 Ga0070673_100079811 3300005364 Bacteria 2650
20 Ga0070659_100144273 3300005366 Bacteria 1939
21 Ga0070709_10068795 3300005434 Bacteria 2278
22 Ga0070714_100209898 3300005435 Bacteria 1784
23 Ga0070710_10000129 3300005437 Bacteria 34996
24 Ga0070710_10030553 3300005437 Bacteria 2899
25 Ga0070710_10175401 3300005437 Bacteria 1338
26 Ga0070711_100033172 3300005439 Bacteria 3437
27 Ga0070694_100073024 3300005444 Bacteria 2368
28 Ga0070708_100124988 3300005445 Bacteria 2376
29 Ga0070663_100008324 3300005455 Bacteria 6372
30 Ga0070663_100186012 3300005455 Bacteria 1614
31 Ga0070678_100107235 3300005456 Bacteria 2178
32 Ga0070662_100090592 3300005457 Bacteria 2296
33 Ga0070681_10417476 3300005458 Bacteria 1253
34 Ga0070706_100017393 3300005467 Bacteria 6634
35 Ga0070698_100019448 3300005471 Bacteria 7128
36 Ga0070698_100025324 3300005471 Bacteria 6184
37 Ga0070698_100241812 3300005471 Bacteria 1738
38 Ga0070679_100236226 3300005530 Bacteria 1787
39 Ga0070684_100040780 3300005535 Bacteria 3999
40 Ga0068853_100094477 3300005539 Bacteria 2634
41 Ga0070672_100076289 3300005543 Bacteria 2677
42 Ga0070686_100250358 3300005544 Bacteria 1294
43 Ga0070695_100091746 3300005545 Bacteria 2029
44 Ga0068855_100368307 3300005563 Bacteria 1580
45 Ga0068857_100438124 3300005577 Bacteria 1220
46 Ga0068859_100319884 3300005617 Bacteria 1645
47 Ga0068864_100290479 3300005618 Bacteria 1528
48 Ga0068866_10140784 3300005718 Bacteria 1384
49 Ga0068861_100079100 3300005719 Bacteria 2570
50 Ga0068851_10088689 3300005834 Bacteria 1626
51 Ga0068863_100490767 3300005841 Bacteria 1209
52 Ga0081540_1000999 3300005983 Bacteria 25418
53 Ga0070717_10002996 3300006028 Bacteria 12032
54 Ga0070717_10070022 3300006028 Bacteria 2922
55 Ga0075363_100035290 3300006048 Bacteria 2616
56 Ga0070715_10008678 3300006163 Bacteria 3551
57 Ga0070715_10114133 3300006163 Bacteria 1279
58 Ga0070716_100100301 3300006173 Bacteria 1773
59 Ga0070716_100223180 3300006173 Bacteria 1267
60 Ga0070712_100004540 3300006175 Bacteria 8569
61 Ga0070712_100145517 3300006175 Bacteria 1813
62 Ga0075370_10062279 3300006353 Bacteria 2126
63 Ga0068871_100013305 3300006358 Bacteria 6104
64 Ga0068865_100319392 3300006881 Bacteria 1248
65 Ga0097620_100319888 3300006931 Bacteria 1645
66 Ga0075435_100230500 3300007076 Bacteria 1573
67 Ga0105251_10058223 3300009011 Bacteria 1825
68 Ga0105244_10079792 3300009036 Bacteria 1621
69 Ga0105240_10326114 3300009093 Bacteria 1749
70 Ga0105245_10981563 3300009098 Bacteria 888
71 Ga0105247_10038484 3300009101 Bacteria 2920
72 Ga0105241_10122449 3300009174 Bacteria 2096
73 Ga0105242_10333684 3300009176 Bacteria 1395
74 Ga0105248_10517541 3300009177 Bacteria 1345
75 Ga0105249_10124848 3300009553 Bacteria 2450
76 Ga0157340_1001955 3300012473 Bacteria 1010
77 Ga0157335_1002338 3300012492 Bacteria 1135
78 Ga0157373_10009543 3300013100 Bacteria 7164
79 Ga0157371_10133197 3300013102 Bacteria 1769
80 Ga0157369_10796155 3300013105 Bacteria 971
81 Ga0157374_10107345 3300013296 Bacteria 2683
82 Ga0157378_10145454 3300013297 Bacteria 2204
83 Ga0163162_10349018 3300013306 Bacteria 1612
84 Ga0157372_10209234 3300013307 Bacteria 2260
85 Ga0157380_10206456 3300014326 Bacteria 1747
86 Ga0182008_10002024 3300014497 Bacteria 12997
87 Ga0182006_1030454 3300015261 Bacteria 2181
88 Ga0182007_10002089 3300015262 Bacteria 10257
89 Ga0183367_1009 3300015688 Bacteria 484598
90 Ga0206356_10674126 3300020070 Bacteria 1415
91 Ga0206354_10641540 3300020081 Bacteria 2201
92 Ga0213876_10209332 3300021384 Bacteria 1037
93 Ga0213875_10009391 3300021388 Bacteria 4959
94 Ga0213875_10215485 3300021388 Bacteria 904
95 Ga0224572_1015381 3300024225 Bacteria 1465
96 Ga0209758_1017113 3300025297 Bacteria 3634
97 Ga0207713_1050990 3300025735 Bacteria 1648
98 Ga0207692_10002281 3300025898 Bacteria 7356
99 Ga0207692_10008438 3300025898 Bacteria 4260
100 Ga0207692_10271873 3300025898 Bacteria 1022
101 Ga0207642_10060430 3300025899 Bacteria 1758
102 Ga0207688_10052604 3300025901 Bacteria 2282
103 Ga0207680_10047405 3300025903 Bacteria 2546
104 Ga0207647_10009867 3300025904 Bacteria 6762
105 Ga0207647_10144459 3300025904 Bacteria 1393
106 Ga0207685_10169037 3300025905 Bacteria 1005
107 Ga0207699_10004233 3300025906 Bacteria 6866
108 Ga0207699_10300749 3300025906 Bacteria 1120
109 Ga0207645_10072226 3300025907 Bacteria 2208
110 Ga0207643_10230691 3300025908 Bacteria 1135
111 Ga0207705_10107160 3300025909 Bacteria 2061
112 Ga0207693_10039601 3300025915 Bacteria 3712
113 Ga0207693_10198980 3300025915 Bacteria 1576
114 Ga0207663_10019410 3300025916 Bacteria 3829
115 Ga0207657_10038694 3300025919 Bacteria 4243
116 Ga0207646_10018392 3300025922 Bacteria 6518
117 Ga0207646_10027258 3300025922 Bacteria 5210
118 Ga0207700_10121008 3300025928 Bacteria 2122
119 Ga0207700_10157307 3300025928 Bacteria 1884
120 Ga0207700_10180032 3300025928 Bacteria 1769
121 Ga0207664_10015623 3300025929 Bacteria 5516
122 Ga0207664_10085512 3300025929 Bacteria 2574
123 Ga0207664_10136352 3300025929 Bacteria 2071
124 Ga0207644_10317913 3300025931 Bacteria 1258
125 Ga0207706_10033248 3300025933 Bacteria 4591
126 Ga0207665_10007940 3300025939 Bacteria 7007
127 Ga0207665_10019313 3300025939 Bacteria 4479
128 Ga0207665_10115324 3300025939 Bacteria 1892
129 Ga0207691_10078448 3300025940 Bacteria 2973
130 Ga0207689_10008810 3300025942 Bacteria 8770
131 Ga0207661_10080717 3300025944 Bacteria 2685
132 Ga0207679_10275907 3300025945 Bacteria 1440
133 Ga0207667_10619486 3300025949 Bacteria 1090
134 Ga0207668_10203430 3300025972 Bacteria 1579
135 Ga0207658_10187248 3300025986 Bacteria 1718
136 Ga0207639_10085382 3300026041 Bacteria 2510
137 Ga0207678_10014590 3300026067 Bacteria 6914
138 Ga0207708_10104834 3300026075 Bacteria 2191
139 Ga0207702_10108603 3300026078 Bacteria 2462
140 Ga0207702_10286084 3300026078 Bacteria 1560
141 Ga0207648_10267334 3300026089 Bacteria 1527
142 Ga0207674_10299850 3300026116 Bacteria 1556
143 Ga0207675_100170734 3300026118 Bacteria 2078
144 Ga0207683_10015392 3300026121 Bacteria 6513
145 Ga0209371_1009483 3300027312 Bacteria 3090
146 Ga0268266_10432053 3300028379 Bacteria 1249
147 Ga0307517_10012336 3300028786 Bacteria 11741
148 Ga0307517_10115683 3300028786 Bacteria 2011
149 Ga0307515_10005600 3300028794 Bacteria 25385
150 Ga0307515_10038856 3300028794 Bacteria 7594
151 Ga0307515_10089739 3300028794 Bacteria 3865
152 Ga0307511_10000088 3300030521 Bacteria 77229
153 Ga0307511_10008073 3300030521 Bacteria 10543
154 Ga0307511_10051776 3300030521 Bacteria 3285
155 Ga0307511_10096866 3300030521 Bacteria 1962
156 Ga0307512_10005133 3300030522 Bacteria 13849
157 Ga0307512_10084593 3300030522 Bacteria 2253
158 Ga0316177_1139923 3300030731 Bacteria 5608
159 Ga0316176_1094698 3300030732 Bacteria 4328
160 Ga0307513_10005529 3300031456 Bacteria 16664
161 Ga0307513_10161477 3300031456 Bacteria 2133
162 Ga0307513_10184713 3300031456 Bacteria 1943
163 Ga0307509_10026722 3300031507 Bacteria 6432
164 Ga0307509_10111674 3300031507 Bacteria 2735
165 Ga0307508_10005331 3300031616 Bacteria 12252
166 Ga0307508_10099500 3300031616 Bacteria 2501
167 Ga0307508_10265502 3300031616 Bacteria 1310
168 Ga0307514_10014144 3300031649 Bacteria 6610
169 Ga0307514_10054240 3300031649 Bacteria 3089
170 Ga0307514_10194396 3300031649 Bacteria 1286
171 Ga0307516_10043952 3300031730 Bacteria 4424
172 Ga0307518_10032258 3300031838 Bacteria 3797
173 Ga0307518_10045056 3300031838 Bacteria 3208
174 Ga0307507_10035594 3300033179 Bacteria 5111
175 Ga0307507_10058826 3300033179 Bacteria 3603
176 Ga0307507_10299031 3300033179 Bacteria 989
177 Ga0307510_10007657 3300033180 Bacteria 12876
178 Ga0307510_10108702 3300033180 Bacteria 2525
179 Ga0373926_0002613 3300035083 Bacteria 5725
180 Ga0373934_0023380 3300035086 Bacteria 2387
181 Ga0373944_0000325 3300035089 Bacteria 10690
182 Ga0373923_0003575 3300035111 Bacteria 5006
183 Ga0373936_0000807 3300035113 Bacteria 11103
184 Ga0373945_0000971 3300035116 Bacteria 8548
185 Ga0373945_0108850 3300035116 Bacteria 1092
186 Ga0373953_0012297 3300035117 Bacteria 3027
187 Ga0373954_0021897 3300035118 Bacteria 2896
188 Ga0373956_0012533 3300035119 Bacteria 3516
189 Ga0373957_0057006 3300035120 Bacteria 1505
190 Ga0373943_0075875 3300035170 Bacteria 1713
191 Ga0373943_0250774 3300035170 Bacteria 994
192 Ga0373946_0002855 3300035171 Bacteria 6121
193 Ga0373946_0226515 3300035171 Bacteria 904
194 Ga0373955_0025127 3300035172 Bacteria 3055
195 Ga0373955_0069226 3300035172 Bacteria 1968
196 Ga0373942_0062670 3300035207 Bacteria 1069
197 Ga0373962_0010548 3300035242 Bacteria 2306
198 Ga0373935_0005296 3300035692 Bacteria 7591
199 Ga0373935_0123742 3300035692 Bacteria 1730
200 Ga0373927_0004348 3300035695 Bacteria 9937
201 Ga0373927_0018663 3300035695 Bacteria 4553
202 Ga0373927_0233666 3300035695 Bacteria 1208
203 Ga0373933_0010209 3300035724 Bacteria 5144
204 Ga0373947_0477779 3300035725 Bacteria 845
205 Ga0373937_0053548 3300036401 Bacteria 3701
206 Ga0373937_0070115 3300036401 Bacteria 3233
207 Ga0372808_006361 3300036459 Bacteria 1589
208 Ga0373925_0003682 3300037068 Bacteria 11789
209 Ga0373925_0028743 3300037068 Bacteria 4074
210 Ga0395900_0174889 3300037418 Bacteria 2184
211 Ga0395898_0003321 3300037466 Bacteria 18066
212 Ga0395898_0008976 3300037466 Bacteria 10529
213 Ga0395905_0327216 3300037471 Bacteria 1423
214 Ga0436364_0531259 3300037853 Bacteria 7184
215 Ga0436364_0718441 3300037853 Bacteria 3915
216 Ga0436364_1213055 3300037853 Bacteria 1307
217 Ga0395901_0111620 3300038443 Bacteria 2871
218 Ga0436365_1844393 3300039437 Bacteria 5238
219 Ga0436363_0263622 3300039450 Bacteria 2447
220 Ga0436362_1210270 3300039453 Bacteria 1579
221 Ga0439436_0002265 3300041404 Bacteria 5762
222 Ga0439439_0001295 3300041406 Bacteria 4898
223 Ga0451843_0031383 3300041509 Bacteria 1238
224 Ga0451853_2753409 3300041512 Bacteria 2786
225 Ga0451853_3551741 3300041512 Bacteria 2222
226 Ga0439433_0009736 3300041999 Bacteria 2097
227 Ga0439448_0002077 3300042005 Bacteria 5373
228 Ga0439448_0025520 3300042005 Bacteria 1854
229 Ga0439449_0000279 3300042007 Bacteria 18454
230 Ga0439449_0042539 3300042007 Bacteria 1687
231 Ga0439457_035394 3300042014 Bacteria 1110
232 Ga0439462_0001689 3300042015 Bacteria 4978
233 Ga0450903_000093 3300042138 Bacteria 18629
234 Ga0439458_0002412 3300042157 Bacteria 4563
235 Ga0439458_0002669 3300042157 Bacteria 4304
236 Ga0466969_0003788 3300044656 Bacteria 8034
237 Ga0466972_0006064 3300044658 Bacteria 6071
238 Ga0466972_0020352 3300044658 Bacteria 3317
239 Ga0466972_0022452 3300044658 Bacteria 3143
240 Ga0466972_0029282 3300044658 Bacteria 2711
241 Ga0466972_0053177 3300044658 Bacteria 1950
242 Ga0466965_0034561 3300044683 Bacteria 2473
243 Ga0466965_0037051 3300044683 Bacteria 2394
244 Ga0466965_0045027 3300044683 Bacteria 2182
245 Ga0466965_0093142 3300044683 Bacteria 1534
246 Ga0466966_0007694 3300044684 Bacteria 7138
247 Ga0466961_0001695 3300044693 Bacteria 13723
248 Ga0466963_0004356 3300044694 Bacteria 8219
249 Ga0466963_0093180 3300044694 Bacteria 2053
250 Ga0466963_0252740 3300044694 Bacteria 1237
251 Ga0466964_0005134 3300044706 Bacteria 4849
252 Ga0466971_0000510 3300044719 Bacteria 15306
253 Ga0466970_0001024 3300044765 Bacteria 13489
254 Ga0466970_0001875 3300044765 Bacteria 10167
255 Ga0466970_0033602 3300044765 Bacteria 2711
256 Ga0466957_0001191 3300044842 Bacteria 13529
257 Ga0466960_0013633 3300044901 Bacteria 3458
258 Ga0466960_0019256 3300044901 Bacteria 3004
259 Ga0466960_0028829 3300044901 Bacteria 2543
260 Ga0466960_0116491 3300044901 Bacteria 1394
261 Ga0466960_0331743 3300044901 Bacteria 864
262 Ga0466959_0005245 3300045049 Bacteria 8846
263 Ga0466959_0067430 3300045049 Bacteria 2594
264 Ga0466958_0002354 3300045836 Bacteria 9456
265 Ga0466958_0115059 3300045836 Bacteria 1681
266 Ga0466967_0004151 3300045976 Bacteria 9690
267 Ga0466967_0004188 3300045976 Bacteria 9661
268 Ga0466967_0021917 3300045976 Bacteria 5200
269 Ga0466967_0050462 3300045976 Bacteria 3643
270 Ga0466967_0269011 3300045976 Bacteria 1633
271 Ga0495617_001952 3300046452 Bacteria 8642
272 Ga0495627_030400 3300046453 Bacteria 1712
273 Ga0495627_052694 3300046453 Bacteria 1220
274 Ga0495592_0007274 3300046454 Bacteria 8280
275 Ga0495592_0010705 3300046454 Bacteria 6915
276 Ga0495592_0014555 3300046454 Bacteria 5969
277 Ga0495592_0079426 3300046454 Bacteria 2375
278 Ga0495603_0001075 3300046455 Bacteria 15819
279 Ga0495603_0003649 3300046455 Bacteria 9159
280 Ga0495603_0005411 3300046455 Bacteria 7622
281 Ga0495603_0011115 3300046455 Bacteria 5457
282 Ga0495603_0029569 3300046455 Bacteria 3303
283 Ga0495629_0004479 3300046459 Bacteria 10464
284 Ga0495629_0019408 3300046459 Bacteria 4855
285 Ga0495629_0021984 3300046459 Bacteria 4550
286 Ga0495629_0043314 3300046459 Bacteria 3160
287 Ga0495638_0045738 3300046460 Bacteria 2752
288 Ga0495638_0046683 3300046460 Bacteria 2720
289 Ga0495638_0060322 3300046460 Bacteria 2347
290 Ga0495641_0054888 3300046461 Bacteria 1809
291 Ga0495651_0003010 3300046462 Bacteria 13011
292 Ga0495651_0004222 3300046462 Bacteria 11007
293 Ga0495651_0029100 3300046462 Bacteria 4308
294 Ga0495651_0078483 3300046462 Bacteria 2497
295 Ga0495653_0005197 3300046463 Bacteria 10584
296 Ga0495653_0048178 3300046463 Bacteria 3291
297 Ga0495653_0051277 3300046463 Bacteria 3168
298 Ga0495580_0019236 3300046472 Bacteria 5074
299 Ga0495580_0060579 3300046472 Bacteria 2659
300 Ga0495580_0297059 3300046472 Bacteria 1100
301 Ga0495582_0014773 3300046473 Bacteria 4290
302 Ga0495582_0191836 3300046473 Bacteria 1166
303 Ga0495582_0359600 3300046473 Bacteria 838
304 Ga0495605_0020981 3300046474 Bacteria 3465
305 Ga0495605_0066772 3300046474 Bacteria 1708
306 Ga0495639_0003571 3300046475 Bacteria 6709
307 Ga0495639_0021959 3300046475 Bacteria 2797
308 Ga0495639_0036931 3300046475 Bacteria 2189
309 Ga0495662_0001207 3300046476 Bacteria 12754
310 Ga0495662_0006770 3300046476 Bacteria 5704
311 Ga0495662_0021352 3300046476 Bacteria 3130
312 Ga0495662_0025775 3300046476 Bacteria 2839
313 Ga0495662_0027649 3300046476 Bacteria 2739
314 Ga0495664_0000649 3300046477 Bacteria 17706
315 Ga0495664_0002616 3300046477 Bacteria 9684
316 Ga0495664_0011744 3300046477 Bacteria 4944
317 Ga0495664_0197735 3300046477 Bacteria 1218
318 Ga0495664_0201591 3300046477 Bacteria 1205
319 Ga0495585_0043049 3300046492 Bacteria 2527
320 Ga0495594_0000363 3300046499 Bacteria 22776
321 Ga0495594_0010966 3300046499 Bacteria 4704
322 Ga0495594_0037395 3300046499 Bacteria 2648
323 Ga0495594_0060582 3300046499 Bacteria 2093
324 Ga0495594_0073674 3300046499 Bacteria 1901
325 Ga0495594_0121378 3300046499 Bacteria 1477
326 Ga0495607_0092830 3300046501 Bacteria 1632
327 Ga0495583_0049937 3300046506 Bacteria 1913
328 Ga0495606_0013408 3300046507 Bacteria 6474
329 Ga0495606_0022889 3300046507 Bacteria 4540
330 Ga0495608_0008707 3300046511 Bacteria 7099
331 Ga0495608_0224125 3300046511 Bacteria 1178
332 Ga0495610_0112904 3300046512 Bacteria 1201
333 Ga0495616_0019023 3300046513 Bacteria 3754
334 Ga0495618_0030938 3300046514 Bacteria 3345
335 Ga0495618_0144270 3300046514 Bacteria 1522
336 Ga0495618_0150785 3300046514 Bacteria 1485
337 Ga0495618_0182347 3300046514 Bacteria 1333
338 Ga0495618_0289593 3300046514 Bacteria 1019
339 Ga0495620_0003127 3300046515 Bacteria 9512
340 Ga0495628_0020969 3300046516 Bacteria 5382
341 Ga0495628_0217906 3300046516 Bacteria 1434
342 Ga0495630_0014734 3300046517 Bacteria 5701
343 Ga0495630_0040215 3300046517 Bacteria 3494
344 Ga0495630_0104629 3300046517 Bacteria 2142
345 Ga0495632_0019329 3300046519 Bacteria 3715
346 Ga0495632_0168450 3300046519 Bacteria 1007
347 Ga0495643_0030333 3300046522 Bacteria 3020
348 Ga0495648_0105579 3300046524 Bacteria 1544
349 Ga0495666_0004465 3300046526 Bacteria 7068
350 Ga0495666_0022819 3300046526 Bacteria 3098
351 Ga0495666_0039923 3300046526 Bacteria 2278
352 Ga0495666_0119273 3300046526 Bacteria 1236
353 Ga0495642_0039141 3300046528 Bacteria 1923
354 Ga0495652_0014431 3300046529 Bacteria 7091
355 Ga0495652_0016205 3300046529 Bacteria 6666
356 Ga0495652_0055349 3300046529 Bacteria 3374
357 Ga0495652_0190669 3300046529 Bacteria 1564
358 Ga0495665_0008218 3300046531 Bacteria 5659
359 Ga0495640_0009893 3300046533 Bacteria 7397
360 Ga0495640_0019065 3300046533 Bacteria 5071
361 Ga0495640_0031941 3300046533 Bacteria 3754
362 Ga0495586_0005841 3300046535 Bacteria 6576
363 Ga0495587_0041245 3300046536 Bacteria 2754
364 Ga0495587_0093290 3300046536 Bacteria 1738
365 Ga0495587_0106139 3300046536 Bacteria 1615
366 Ga0495587_0360305 3300046536 Bacteria 810
367 Ga0495597_0018697 3300046542 Bacteria 3249
368 Ga0495597_0046360 3300046542 Bacteria 1926
369 Ga0495645_0007619 3300046543 Bacteria 7533
370 Ga0495645_0075188 3300046543 Bacteria 2431
371 Ga0495645_0130878 3300046543 Bacteria 1758
372 Ga0495645_0280392 3300046543 Bacteria 1096
373 Ga0495622_0026396 3300046557 Bacteria 2712
374 Ga0495622_0080772 3300046557 Bacteria 1496
375 Ga0495633_0013716 3300046558 Bacteria 4260
376 Ga0495667_0004309 3300046559 Bacteria 9595
377 Ga0495667_0399900 3300046559 Bacteria 865
378 Ga0495668_0009645 3300046616 Bacteria 5907
379 Ga0495634_0005500 3300046642 Bacteria 9737
380 Ga0495634_0061041 3300046642 Bacteria 2507
381 Ga0495634_0134674 3300046642 Bacteria 1572
382 Ga0495634_0242861 3300046642 Bacteria 1104
383 Ga0495634_0419727 3300046642 Bacteria 792
384 Ga0495611_0008601 3300046648 Bacteria 4317
385 Ga0495611_0069581 3300046648 Bacteria 1608
386 Ga0495625_0068053 3300046660 Bacteria 2504
387 Ga0495625_0104754 3300046660 Bacteria 1938
388 Ga0495635_0001411 3300046663 Bacteria 16016
389 Ga0495635_0002399 3300046663 Bacteria 12766
390 Ga0495635_0009300 3300046663 Bacteria 6864
391 Ga0495635_0090039 3300046663 Bacteria 2099
392 Ga0495635_0114477 3300046663 Bacteria 1841
393 Ga0495635_0131841 3300046663 Bacteria 1704
394 Ga0495661_0080872 3300046665 Bacteria 1874
395 Ga0495588_0001782 3300046674 Bacteria 9174
396 Ga0495588_0012138 3300046674 Bacteria 4061
397 Ga0495588_0043673 3300046674 Bacteria 2294
398 Ga0495588_0064825 3300046674 Bacteria 1895
399 Ga0495657_0003277 3300046675 Bacteria 13288
400 Ga0495657_0003998 3300046675 Bacteria 11831
401 Ga0495657_0012266 3300046675 Bacteria 6367
402 Ga0495657_0040134 3300046675 Bacteria 3212
403 Ga0495657_0122884 3300046675 Bacteria 1633
404 Ga0495599_0022646 3300046678 Bacteria 3923
405 Ga0495599_0031817 3300046678 Bacteria 3311
406 Ga0495599_0088307 3300046678 Bacteria 1935
407 Ga0495599_0105541 3300046678 Bacteria 1755
408 Ga0495623_0136772 3300046679 Bacteria 1461
409 Ga0495646_0003405 3300046680 Bacteria 9880
410 Ga0495646_0012447 3300046680 Bacteria 5409
411 Ga0495646_0097255 3300046680 Bacteria 1692
412 Ga0495647_0026925 3300046681 Bacteria 2110
413 Ga0495658_0027652 3300046683 Bacteria 3054
414 Ga0495658_0032377 3300046683 Bacteria 2854
415 Ga0495658_0078823 3300046683 Bacteria 1929
416 Ga0495613_0000795 3300046689 Bacteria 24569
417 Ga0495613_0002803 3300046689 Bacteria 13081
418 Ga0495613_0006620 3300046689 Bacteria 8656
419 Ga0495613_0015118 3300046689 Bacteria 5732
420 Ga0495613_0030354 3300046689 Bacteria 4015
421 Ga0495613_0083073 3300046689 Bacteria 2326
422 Ga0495613_0083107 3300046689 Bacteria 2325
423 Ga0495613_0137332 3300046689 Bacteria 1748
424 Ga0495613_0155473 3300046689 Bacteria 1629
425 Ga0495613_0164847 3300046689 Bacteria 1575
426 Ga0495624_0007339 3300046690 Bacteria 7740
427 Ga0495624_0069729 3300046690 Bacteria 2189
428 Ga0495624_0329864 3300046690 Bacteria 918
429 Ga0495670_0025052 3300046691 Bacteria 2951
430 Ga0495671_0001819 3300046692 Bacteria 13738
431 Ga0495589_0009738 3300046794 Bacteria 4992
432 Ga0495589_0040050 3300046794 Bacteria 2341
433 Ga0495589_0043724 3300046794 Bacteria 2228
434 Ga0495600_0004517 3300046809 Bacteria 8336
435 Ga0495600_0009062 3300046809 Bacteria 6136
436 Ga0495600_0012333 3300046809 Bacteria 5341
437 Ga0495581_0003472 3300047315 Bacteria 9047
438 Ga0495581_0007540 3300047315 Bacteria 6292
439 Ga0495581_0014643 3300047315 Bacteria 4547
440 Ga0495581_0019261 3300047315 Bacteria 3961
441 Ga0495581_0087886 3300047315 Bacteria 1802
442 Ga0495604_0000793 3300047317 Bacteria 26564
443 Ga0495604_0000970 3300047317 Bacteria 23925
444 Ga0495604_0189185 3300047317 Bacteria 1435
445 Ga0495636_0019695 3300047318 Bacteria 2714
446 Ga0495674_0006117 3300047319 Bacteria 11561
447 Ga0495674_0011271 3300047319 Bacteria 8439
448 Ga0495674_0101266 3300047319 Bacteria 2450
449 Ga0495674_0124395 3300047319 Bacteria 2177
450 Ga0495672_0062257 3300047320 Bacteria 2147
451 Ga0495676_0004478 3300047321 Bacteria 12771
452 Ga0495676_0005323 3300047321 Bacteria 11783
453 Ga0495676_0006527 3300047321 Bacteria 10747
454 Ga0495676_0013750 3300047321 Bacteria 7258
455 Ga0495676_0039066 3300047321 Bacteria 3935
456 Ga0495676_0139535 3300047321 Bacteria 1738
457 Ga0495676_0295529 3300047321 Bacteria 1093
458 Ga0495680_0002084 3300047322 Bacteria 20809
459 Ga0495680_0006315 3300047322 Bacteria 11031
460 Ga0495680_0011629 3300047322 Bacteria 7778
461 Ga0495683_0037452 3300047323 Bacteria 2458
462 Ga0495683_0167337 3300047323 Bacteria 1013
463 Ga0495687_001165 3300047443 Bacteria 25402
464 Ga0495687_002539 3300047443 Bacteria 14465
465 Ga0495687_010691 3300047443 Bacteria 5010
466 Ga0495687_047674 3300047443 Bacteria 1842
467 Ga0495687_081172 3300047443 Bacteria 1269
468 Ga0495687_082262 3300047443 Bacteria 1257
469 Ga0495675_0013564 3300047444 Bacteria 5146
470 Ga0495675_0042601 3300047444 Bacteria 2891
471 Ga0495675_0054077 3300047444 Bacteria 2548
472 Ga0495675_0086270 3300047444 Bacteria 1973
473 Ga0495675_0209943 3300047444 Bacteria 1182
474 Ga0495675_0226470 3300047444 Bacteria 1129
475 Ga0495677_0038968 3300047445 Bacteria 1737
476 Ga0495685_003289 3300047447 Bacteria 5146
477 Ga0495685_004683 3300047447 Bacteria 4436
478 Ga0495685_010836 3300047447 Bacteria 3063
479 Ga0495685_021831 3300047447 Bacteria 2203
480 Ga0495685_032252 3300047447 Bacteria 1800
481 Ga0495685_104288 3300047447 Bacteria 935
482 Ga0495681_0002877 3300047470 Bacteria 12167
483 Ga0495681_0010940 3300047470 Bacteria 5449
484 Ga0495681_0058174 3300047470 Bacteria 1792
485 Ga0495684_0004574 3300047471 Bacteria 10809
486 Ga0495684_0008033 3300047471 Bacteria 8158
487 Ga0495684_0071391 3300047471 Bacteria 2638
488 Ga0495686_0070410 3300047472 Bacteria 2155
489 Ga0495593_0001968 3300047673 Bacteria 12235
490 Ga0495593_0021034 3300047673 Bacteria 3648
491 Ga0495593_0037604 3300047673 Bacteria 2617
492 Ga0495593_0077099 3300047673 Bacteria 1726
493 Ga0495593_0092099 3300047673 Bacteria 1560
494 Ga0495602_0021244 3300048088 Bacteria 6396
495 Ga0495602_0022183 3300048088 Bacteria 6222
496 Ga0495602_0195355 3300048088 Bacteria 1548
497 Ga0495614_0002599 3300048089 Bacteria 8028
498 Ga0495614_0003383 3300048089 Bacteria 7136
499 Ga0495614_0023478 3300048089 Bacteria 2661
500 Ga0495614_0035027 3300048089 Bacteria 2157
501 Ga0495626_0011826 3300048091 Bacteria 4597
502 Ga0496101_0084149 3300048904 Bacteria 2355
503 Ga0496102_0114040 3300048905 Bacteria 2521
504 Ga0496104_0110243 3300048907 Bacteria 2638
505 Ga0496104_0633323 3300048907 Bacteria 979
506 Ga0496105_0097924 3300048908 Bacteria 2422
507 Ga0496105_0446068 3300048908 Bacteria 1022
508 Ga0496107_0053494 3300048910 Bacteria 2912
509 Ga0496109_0026797 3300048912 Bacteria 5141
510 Ga0496110_0187601 3300048913 Bacteria 1878
511 Ga0496111_0186408 3300048914 Bacteria 1542
512 Ga0496112_0248983 3300048915 Bacteria 1728
513 Ga0496113_0048860 3300048916 Bacteria 3148
514 Ga0496115_0039568 3300048918 Bacteria 3745
515 Ga0496126_0218996 3300048929 Bacteria 1600
516 Ga0495678_017775 3300049459 Bacteria 3213
517 Ga0501318_003128 3300049534 Bacteria 1494
518 Ga0501031_0034760 3300049568 Bacteria 3289
519 Ga0501031_0126271 3300049568 Bacteria 1671
520 Ga0501032_0005173 3300049569 Bacteria 9722
521 Ga0501032_0038362 3300049569 Bacteria 3263
522 Ga0501032_0102301 3300049569 Bacteria 1898
523 Ga0501032_0293093 3300049569 Bacteria 1052
524 Ga0501033_0002327 3300049570 Bacteria 16186
525 Ga0501033_0028176 3300049570 Bacteria 4222
526 Ga0501033_0055732 3300049570 Bacteria 2922
527 Ga0501033_0084742 3300049570 Bacteria 2322
528 Ga0501034_0021407 3300049571 Bacteria 6591
529 Ga0501034_0035577 3300049571 Bacteria 5048
530 Ga0501034_0055145 3300049571 Bacteria 4000
531 Ga0501034_0108919 3300049571 Bacteria 2761
532 Ga0501034_0331811 3300049571 Bacteria 1452
533 Ga0501034_0368762 3300049571 Bacteria 1362
534 Ga0501036_0011373 3300049572 Bacteria 7365
535 Ga0501036_0061317 3300049572 Bacteria 3186
536 Ga0501036_0286497 3300049572 Bacteria 1378
537 Ga0501037_0020977 3300049573 Bacteria 4827
538 Ga0501037_0027502 3300049573 Bacteria 4202
539 Ga0501037_0058689 3300049573 Bacteria 2807
540 Ga0501037_0117115 3300049573 Bacteria 1917
541 Ga0501038_0002224 3300049574 Bacteria 18056
542 Ga0501038_0023644 3300049574 Bacteria 5490
543 Ga0501038_0031437 3300049574 Bacteria 4691
544 Ga0501038_0259695 3300049574 Bacteria 1373
545 Ga0501038_0342796 3300049574 Bacteria 1165
546 Ga0501042_0232305 3300049578 Bacteria 1330
547 Ga0501043_0020667 3300049579 Bacteria 5165
548 Ga0501043_0025466 3300049579 Bacteria 4642
549 Ga0501043_0028456 3300049579 Bacteria 4387
550 Ga0501043_0031220 3300049579 Bacteria 4188
551 Ga0501043_0045748 3300049579 Bacteria 3441
552 Ga0501043_0046949 3300049579 Bacteria 3395
553 Ga0501046_0014560 3300049580 Bacteria 6629
554 Ga0501047_0000189 3300049581 Bacteria 74827
555 Ga0501047_0012368 3300049581 Bacteria 8079
556 Ga0501047_0024495 3300049581 Bacteria 5791
557 Ga0501047_0093869 3300049581 Bacteria 2879
558 Ga0501047_0138058 3300049581 Bacteria 2317
559 Ga0501048_0090189 3300049582 Bacteria 2162
560 Ga0501069_0086437 3300049585 Bacteria 1770
561 Ga0501070_0009831 3300049586 Bacteria 8087
562 Ga0501080_0034843 3300049742 Bacteria 4701
563 Ga0501083_0229617 3300049744 Bacteria 1209
564 Ga0501035_0014702 3300049822 Bacteria 7225
565 Ga0501035_0016857 3300049822 Bacteria 6735
566 Ga0501035_0034865 3300049822 Bacteria 4571
567 Ga0501035_0056837 3300049822 Bacteria 3489
568 Ga0501035_0069750 3300049822 Bacteria 3114
569 Ga0501035_0118436 3300049822 Bacteria 2317
570 Ga0501035_0230476 3300049822 Bacteria 1578
571 Ga0501044_0011484 3300049823 Bacteria 9596
572 Ga0501044_0073254 3300049823 Bacteria 3481
573 Ga0501044_0081186 3300049823 Bacteria 3283
574 Ga0501044_0098676 3300049823 Bacteria 2940
575 Ga0501044_0232068 3300049823 Bacteria 1792
576 Ga0501045_0054293 3300049824 Bacteria 2929
577 nmdc:mga04h51_143560_c1 3300050495 Bacteria 907
578 nmdc:mga0n895_402613_c1 3300050512 Bacteria 1384
579 nmdc:mga0rr50_223479_c1 3300050513 Bacteria 1555
580 Ga0495601_0023311 3300053077 Bacteria 3803
581 Ga0495612_0016273 3300053078 Bacteria 2980
582 Ga0500610_0163295 3300053079 Bacteria 1106
583 Ga0495595_0065732 3300053084 Bacteria 1706
584 Ga0495619_0003877 3300053085 Bacteria 9612
585 Ga0495619_0017271 3300053085 Bacteria 4569
586 Ga0500578_0234770 3300053086 Bacteria 1110
587 Ga0500647_0263091 3300053091 Bacteria 753
588 Ga0500640_016663 3300053095 Bacteria 3103
589 Ga0500641_0125228 3300053096 Bacteria 1108
590 Ga0500660_016856 3300053100 Bacteria 3920
591 Ga0500569_020249 3300053109 Bacteria 1742
592 Ga0500652_001344 3300053131 Bacteria 7701
593 Ga0500600_0036268 3300053149 Bacteria 2867
594 Ga0500616_0008588 3300053153 Bacteria 6324
595 Ga0500634_0030032 3300053161 Bacteria 2961
596 Ga0466962_0014401 3300061719 Bacteria 3810
597 2547409533 2547132111 Bacteria 8013147
598 2585299819 2582581312 Bacteria 7308206
599 2585306858 2582581313 Bacteria 10042643
600 2585320856 2582581314 Bacteria 11452267
601 2616694338 2616644814 Bacteria 11555299
602 2616899484 2616644941 Bacteria 8510691
603 2643897429 2643221578 Bacteria 9213798
604 2643945103 2643221587 Bacteria 7586415
605 2644265487 2643221647 Bacteria 10741251
606 2644387335 2643221670 Bacteria 6497041
607 2644408573 2643221673 Bacteria 9196637
608 2644432002 2643221677 Bacteria 7584031
609 2644435834 2643221678 Bacteria 9540101
610 2644463223 2643221682 Bacteria 6743283
611 2644632277 2643221714 Bacteria 9015452
612 2784587438 2784132148 Bacteria 8627943
613 2785367987 2784746768 Bacteria 10036182
614 2786669040 2786546132 Bacteria 10419719
615 2808840646 2808606359 Bacteria 9866990
616 2808919232 2808606375 Bacteria 9466072
617 2809231011 2808606448 Bacteria 8656184
618 2811847654 2808606982 Bacteria 7791042
619 2812359535 2811994879 Bacteria 9313447
620 2812481663 2811994917 Bacteria 7761064
621 2852638488 2852635781 Bacteria 8251373
622 2862182894 2862178590 Bacteria 8583590
623 2862288628 2862281513 Bacteria 9621493
624 2862514347 2862507626 Bacteria 9425308
625 2862582886 2862574272 Bacteria 10567477
626 2863406153 2863404153 Bacteria 9672205
627 2867435596 2867428634 Bacteria 9590268
628 2873156965 2873151551 Bacteria 8625867
629 2875393373 2875391855 Bacteria 7600475
630 2877682556 2877676314 Bacteria 9512378
631 2912721583 2912715099 Bacteria 9460473
632 2912725430 2912723979 Bacteria 8557534
633 2918503245 2918501144 Bacteria 8668083
634 2919468196 2919468124 Bacteria 9133025
635 2946051319 2946045630 Bacteria 8527308
636 2946066375 2946064051 Bacteria 8957905
637 2946074639 2946072368 Bacteria 8999607
638 2947230995 2947224130 Bacteria 9938529
639 2954004310 2954002825 Bacteria 9173742
640 2954387754 2954380949 Bacteria 10050426
641 2954675323 2954673503 Bacteria 9685905
642 2954688809 2954682443 Bacteria 9862841
643 2954698565 2954691527 Bacteria 10720516
644 2954703659 2954701450 Bacteria 10834262
645 2954717539 2954711539 Bacteria 10867210
646 2954727503 2954721474 Bacteria 10456478
647 2954734298 2954731030 Bacteria 10243860
648 2954746399 2954740390 Bacteria 10229294
649 2954753181 2954749733 Bacteria 10366972
650 2954765514 2954759201 Bacteria 9358192
651 2966603687 2966598605 Bacteria 7676064
652 2990063861 2990059506 Bacteria 9321252
653 2995464734 2995463766 Bacteria 8577691
654 3006396088 3006393351 Bacteria 6615579
655 3006427679 3006425503 Bacteria 6491253
656 3006495601 3006493962 Bacteria 8825450
657 8008580027 8008574985 Bacteria 7815457
658 8023627450 8023623736 Bacteria 8593882
659 8047899563 8047893842 Bacteria 11723082
660 8048359367 8048356638 Bacteria 11044339
661 8048376513 8048369669 Bacteria 11666822
662 8048385566 8048379754 Bacteria 11877923
663 8056449811 8056447290 Bacteria 7680491
664 8056836485 8056829672 Bacteria 9045328
665 Ga0501038_0181961
666 JGI24737J22298_10054646
667 JGI24738J21930_10005305
668 rootH1_10002866
669 rootH2_10041012
670 rootH2_10089834
671 Ga0006562J51391_1184680
672 Ga0006562J51391_1212009
673 Ga0070683_100104696
674 Ga0070690_100043401
675 Ga0068869_100285810
676 Ga0070680_100048824
677 Ga0068868_100135477
678 Ga0070691_10050277
679 Ga0070687_100148350
680 Ga0070669_100391162
681 Ga0070675_100114559
682 Ga0070671_100086396
683 Ga0070673_100079811
684 Ga0070659_100144273
685 Ga0070709_10068795
686 Ga0070714_100209898
687 Ga0070710_10000129
688 Ga0070710_10030553
689 Ga0070710_10175401
690 Ga0070711_100033172
691 Ga0070694_100073024
692 Ga0070708_100124988
693 Ga0070663_100008324
694 Ga0070663_100186012
695 Ga0070678_100107235
696 Ga0070662_100090592
697 Ga0070681_10417476
698 Ga0070706_100017393
699 Ga0070698_100019448
700 Ga0070698_100025324
701 Ga0070698_100241812
702 Ga0070679_100236226
703 Ga0070684_100040780
704 Ga0068853_100094477
705 Ga0070672_100076289
706 Ga0070686_100250358
707 Ga0070695_100091746
708 Ga0068855_100368307
709 Ga0068857_100438124
710 Ga0068859_100319884
711 Ga0068864_100290479
712 Ga0068866_10140784
713 Ga0068861_100079100
714 Ga0068851_10088689
715 Ga0068863_100490767
716 Ga0081540_1000999
717 Ga0070717_10002996
718 Ga0070717_10070022
719 Ga0075363_100035290
720 Ga0070715_10008678
721 Ga0070715_10114133
722 Ga0070716_100100301
723 Ga0070716_100223180
724 Ga0070712_100004540
725 Ga0070712_100145517
726 Ga0075370_10062279
727 Ga0068871_100013305
728 Ga0068865_100319392
729 Ga0097620_100319888
730 Ga0075435_100230500
731 Ga0105251_10058223
732 Ga0105244_10079792
733 Ga0105240_10326114
734 Ga0105245_10981563
735 Ga0105247_10038484
736 Ga0105241_10122449
737 Ga0105242_10333684
738 Ga0105248_10517541
739 Ga0105249_10124848
740 Ga0157340_1001955
741 Ga0157335_1002338
742 Ga0157373_10009543
743 Ga0157371_10133197
744 Ga0157369_10796155
745 Ga0157374_10107345
746 Ga0157378_10145454
747 Ga0163162_10349018
748 Ga0157372_10209234
749 Ga0157380_10206456
750 Ga0182008_10002024
751 Ga0182006_1030454
752 Ga0182007_10002089
753 Ga0183367_1009
754 Ga0206356_10674126
755 Ga0206354_10641540
756 Ga0213876_10209332
757 Ga0213875_10009391
758 Ga0213875_10215485
759 Ga0224572_1015381
760 Ga0209758_1017113
761 Ga0207713_1050990
762 Ga0207692_10002281
763 Ga0207692_10008438
764 Ga0207692_10271873
765 Ga0207642_10060430
766 Ga0207688_10052604
767 Ga0207680_10047405
768 Ga0207647_10009867
769 Ga0207647_10144459
770 Ga0207685_10169037
771 Ga0207699_10004233
772 Ga0207699_10300749
773 Ga0207645_10072226
774 Ga0207643_10230691
775 Ga0207705_10107160
776 Ga0207693_10039601
777 Ga0207693_10198980
778 Ga0207663_10019410
779 Ga0207657_10038694
780 Ga0207646_10018392
781 Ga0207646_10027258
782 Ga0207700_10121008
783 Ga0207700_10157307
784 Ga0207700_10180032
785 Ga0207664_10015623
786 Ga0207664_10085512
787 Ga0207664_10136352
788 Ga0207644_10317913
789 Ga0207706_10033248
790 Ga0207665_10007940
791 Ga0207665_10019313
792 Ga0207665_10115324
793 Ga0207691_10078448
794 Ga0207689_10008810
795 Ga0207661_10080717
796 Ga0207679_10275907
797 Ga0207667_10619486
798 Ga0207668_10203430
799 Ga0207658_10187248
800 Ga0207639_10085382
801 Ga0207678_10014590
802 Ga0207708_10104834
803 Ga0207702_10108603
804 Ga0207702_10286084
805 Ga0207648_10267334
806 Ga0207674_10299850
807 Ga0207675_100170734
808 Ga0207683_10015392
809 Ga0209371_1009483
810 Ga0268266_10432053
811 Ga0307517_10012336
812 Ga0307517_10115683
813 Ga0307515_10005600
814 Ga0307515_10038856
815 Ga0307515_10089739
816 Ga0307511_10000088
817 Ga0307511_10008073
818 Ga0307511_10051776
819 Ga0307511_10096866
820 Ga0307512_10005133
821 Ga0307512_10084593
822 Ga0316177_1139923
823 Ga0316176_1094698
824 Ga0307513_10005529
825 Ga0307513_10161477
826 Ga0307513_10184713
827 Ga0307509_10026722
828 Ga0307509_10111674
829 Ga0307508_10005331
830 Ga0307508_10099500
831 Ga0307508_10265502
832 Ga0307514_10014144
833 Ga0307514_10054240
834 Ga0307514_10194396
835 Ga0307516_10043952
836 Ga0307518_10032258
837 Ga0307518_10045056
838 Ga0307507_10035594
839 Ga0307507_10058826
840 Ga0307507_10299031
841 Ga0307510_10007657
842 Ga0307510_10108702
843 Ga0373926_0002613
844 Ga0373934_0023380
845 Ga0373944_0000325
846 Ga0373923_0003575
847 Ga0373936_0000807
848 Ga0373945_0000971
849 Ga0373945_0108850
850 Ga0373953_0012297
851 Ga0373954_0021897
852 Ga0373956_0012533
853 Ga0373957_0057006
854 Ga0373943_0075875
855 Ga0373943_0250774
856 Ga0373946_0002855
857 Ga0373946_0226515
858 Ga0373955_0025127
859 Ga0373955_0069226
860 Ga0373942_0062670
861 Ga0373962_0010548
862 Ga0373935_0005296
863 Ga0373935_0123742
864 Ga0373927_0004348
865 Ga0373927_0018663
866 Ga0373927_0233666
867 Ga0373933_0010209
868 Ga0373947_0477779
869 Ga0373937_0053548
870 Ga0373937_0070115
871 Ga0372808_006361
872 Ga0373925_0003682
873 Ga0373925_0028743
874 Ga0395900_0174889
875 Ga0395898_0003321
876 Ga0395898_0008976
877 Ga0395905_0327216
878 Ga0436364_0531259
879 Ga0436364_0718441
880 Ga0436364_1213055
881 Ga0395901_0111620
882 Ga0436365_1844393
883 Ga0436363_0263622
884 Ga0436362_1210270
885 Ga0439436_0002265
886 Ga0439439_0001295
887 Ga0451843_0031383
888 Ga0451853_2753409
889 Ga0451853_3551741
890 Ga0439433_0009736
891 Ga0439448_0002077
892 Ga0439448_0025520
893 Ga0439449_0000279
894 Ga0439449_0042539
895 Ga0439457_035394
896 Ga0439462_0001689
897 Ga0450903_000093
898 Ga0439458_0002412
899 Ga0439458_0002669
900 Ga0466969_0003788
901 Ga0466972_0006064
902 Ga0466972_0020352
903 Ga0466972_0022452
904 Ga0466972_0029282
905 Ga0466972_0053177
906 Ga0466965_0034561
907 Ga0466965_0037051
908 Ga0466965_0045027
909 Ga0466965_0093142
910 Ga0466966_0007694
911 Ga0466961_0001695
912 Ga0466963_0004356
913 Ga0466963_0093180
914 Ga0466963_0252740
915 Ga0466964_0005134
916 Ga0466971_0000510
917 Ga0466970_0001024
918 Ga0466970_0001875
919 Ga0466970_0033602
920 Ga0466957_0001191
921 Ga0466960_0013633
922 Ga0466960_0019256
923 Ga0466960_0028829
924 Ga0466960_0116491
925 Ga0466960_0331743
926 Ga0466959_0005245
927 Ga0466959_0067430
928 Ga0466958_0002354
929 Ga0466958_0115059
930 Ga0466967_0004151
931 Ga0466967_0004188
932 Ga0466967_0021917
933 Ga0466967_0050462
934 Ga0466967_0269011
935 Ga0495617_001952
936 Ga0495627_030400
937 Ga0495627_052694
938 Ga0495592_0007274
939 Ga0495592_0010705
940 Ga0495592_0014555
941 Ga0495592_0079426
942 Ga0495603_0001075
943 Ga0495603_0003649
944 Ga0495603_0005411
945 Ga0495603_0011115
946 Ga0495603_0029569
947 Ga0495629_0004479
948 Ga0495629_0019408
949 Ga0495629_0021984
950 Ga0495629_0043314
951 Ga0495638_0045738
952 Ga0495638_0046683
953 Ga0495638_0060322
954 Ga0495641_0054888
955 Ga0495651_0003010
956 Ga0495651_0004222
957 Ga0495651_0029100
958 Ga0495651_0078483
959 Ga0495653_0005197
960 Ga0495653_0048178
961 Ga0495653_0051277
962 Ga0495580_0019236
963 Ga0495580_0060579
964 Ga0495580_0297059
965 Ga0495582_0014773
966 Ga0495582_0191836
967 Ga0495582_0359600
968 Ga0495605_0020981
969 Ga0495605_0066772
970 Ga0495639_0003571
971 Ga0495639_0021959
972 Ga0495639_0036931
973 Ga0495662_0001207
974 Ga0495662_0006770
975 Ga0495662_0021352
976 Ga0495662_0025775
977 Ga0495662_0027649
978 Ga0495664_0000649
979 Ga0495664_0002616
980 Ga0495664_0011744
981 Ga0495664_0197735
982 Ga0495664_0201591
983 Ga0495585_0043049
984 Ga0495594_0000363
985 Ga0495594_0010966
986 Ga0495594_0037395
987 Ga0495594_0060582
988 Ga0495594_0073674
989 Ga0495594_0121378
990 Ga0495607_0092830
991 Ga0495583_0049937
992 Ga0495606_0013408
993 Ga0495606_0022889
994 Ga0495608_0008707
995 Ga0495608_0224125
996 Ga0495610_0112904
997 Ga0495616_0019023
998 Ga0495618_0030938
999 Ga0495618_0144270
1000 Ga0495618_0150785
1001 Ga0495618_0182347
1002 Ga0495618_0289593
1003 Ga0495620_0003127
1004 Ga0495628_0020969
1005 Ga0495628_0217906
1006 Ga0495630_0014734
1007 Ga0495630_0040215
1008 Ga0495630_0104629
1009 Ga0495632_0019329
1010 Ga0495632_0168450
1011 Ga0495643_0030333
1012 Ga0495648_0105579
1013 Ga0495666_0004465
1014 Ga0495666_0022819
1015 Ga0495666_0039923
1016 Ga0495666_0119273
1017 Ga0495642_0039141
1018 Ga0495652_0014431
1019 Ga0495652_0016205
1020 Ga0495652_0055349
1021 Ga0495652_0190669
1022 Ga0495665_0008218
1023 Ga0495640_0009893
1024 Ga0495640_0019065
1025 Ga0495640_0031941
1026 Ga0495586_0005841
1027 Ga0495587_0041245
1028 Ga0495587_0093290
1029 Ga0495587_0106139
1030 Ga0495587_0360305
1031 Ga0495597_0018697
1032 Ga0495597_0046360
1033 Ga0495645_0007619
1034 Ga0495645_0075188
1035 Ga0495645_0130878
1036 Ga0495645_0280392
1037 Ga0495622_0026396
1038 Ga0495622_0080772
1039 Ga0495633_0013716
1040 Ga0495667_0004309
1041 Ga0495667_0399900
1042 Ga0495668_0009645
1043 Ga0495634_0005500
1044 Ga0495634_0061041
1045 Ga0495634_0134674
1046 Ga0495634_0242861
1047 Ga0495634_0419727
1048 Ga0495611_0008601
1049 Ga0495611_0069581
1050 Ga0495625_0068053
1051 Ga0495625_0104754
1052 Ga0495635_0001411
1053 Ga0495635_0002399
1054 Ga0495635_0009300
1055 Ga0495635_0090039
1056 Ga0495635_0114477
1057 Ga0495635_0131841
1058 Ga0495661_0080872
1059 Ga0495588_0001782
1060 Ga0495588_0012138
1061 Ga0495588_0043673
1062 Ga0495588_0064825
1063 Ga0495657_0003277
1064 Ga0495657_0003998
1065 Ga0495657_0012266
1066 Ga0495657_0040134
1067 Ga0495657_0122884
1068 Ga0495599_0022646
1069 Ga0495599_0031817
1070 Ga0495599_0088307
1071 Ga0495599_0105541
1072 Ga0495623_0136772
1073 Ga0495646_0003405
1074 Ga0495646_0012447
1075 Ga0495646_0097255
1076 Ga0495647_0026925
1077 Ga0495658_0027652
1078 Ga0495658_0032377
1079 Ga0495658_0078823
1080 Ga0495613_0000795
1081 Ga0495613_0002803
1082 Ga0495613_0006620
1083 Ga0495613_0015118
1084 Ga0495613_0030354
1085 Ga0495613_0083073
1086 Ga0495613_0083107
1087 Ga0495613_0137332
1088 Ga0495613_0155473
1089 Ga0495613_0164847
1090 Ga0495624_0007339
1091 Ga0495624_0069729
1092 Ga0495624_0329864
1093 Ga0495670_0025052
1094 Ga0495671_0001819
1095 Ga0495589_0009738
1096 Ga0495589_0040050
1097 Ga0495589_0043724
1098 Ga0495600_0004517
1099 Ga0495600_0009062
1100 Ga0495600_0012333
1101 Ga0495581_0003472
1102 Ga0495581_0007540
1103 Ga0495581_0014643
1104 Ga0495581_0019261
1105 Ga0495581_0087886
1106 Ga0495604_0000793
1107 Ga0495604_0000970
1108 Ga0495604_0189185
1109 Ga0495636_0019695
1110 Ga0495674_0006117
1111 Ga0495674_0011271
1112 Ga0495674_0101266
1113 Ga0495674_0124395
1114 Ga0495672_0062257
1115 Ga0495676_0004478
1116 Ga0495676_0005323
1117 Ga0495676_0006527
1118 Ga0495676_0013750
1119 Ga0495676_0039066
1120 Ga0495676_0139535
1121 Ga0495676_0295529
1122 Ga0495680_0002084
1123 Ga0495680_0006315
1124 Ga0495680_0011629
1125 Ga0495683_0037452
1126 Ga0495683_0167337
1127 Ga0495687_001165
1128 Ga0495687_002539
1129 Ga0495687_010691
1130 Ga0495687_047674
1131 Ga0495687_081172
1132 Ga0495687_082262
1133 Ga0495675_0013564
1134 Ga0495675_0042601
1135 Ga0495675_0054077
1136 Ga0495675_0086270
1137 Ga0495675_0209943
1138 Ga0495675_0226470
1139 Ga0495677_0038968
1140 Ga0495685_003289
1141 Ga0495685_004683
1142 Ga0495685_010836
1143 Ga0495685_021831
1144 Ga0495685_032252
1145 Ga0495685_104288
1146 Ga0495681_0002877
1147 Ga0495681_0010940
1148 Ga0495681_0058174
1149 Ga0495684_0004574
1150 Ga0495684_0008033
1151 Ga0495684_0071391
1152 Ga0495686_0070410
1153 Ga0495593_0001968
1154 Ga0495593_0021034
1155 Ga0495593_0037604
1156 Ga0495593_0077099
1157 Ga0495593_0092099
1158 Ga0495602_0021244
1159 Ga0495602_0022183
1160 Ga0495602_0195355
1161 Ga0495614_0002599
1162 Ga0495614_0003383
1163 Ga0495614_0023478
1164 Ga0495614_0035027
1165 Ga0495626_0011826
1166 Ga0496101_0084149
1167 Ga0496102_0114040
1168 Ga0496104_0110243
1169 Ga0496104_0633323
1170 Ga0496105_0097924
1171 Ga0496105_0446068
1172 Ga0496107_0053494
1173 Ga0496109_0026797
1174 Ga0496110_0187601
1175 Ga0496111_0186408
1176 Ga0496112_0248983
1177 Ga0496113_0048860
1178 Ga0496115_0039568
1179 Ga0496126_0218996
1180 Ga0495678_017775
1181 Ga0501318_003128
1182 Ga0501031_0034760
1183 Ga0501031_0126271
1184 Ga0501032_0005173
1185 Ga0501032_0038362
1186 Ga0501032_0102301
1187 Ga0501032_0293093
1188 Ga0501033_0002327
1189 Ga0501033_0028176
1190 Ga0501033_0055732
1191 Ga0501033_0084742
1192 Ga0501034_0021407
1193 Ga0501034_0035577
1194 Ga0501034_0055145
1195 Ga0501034_0108919
1196 Ga0501034_0331811
1197 Ga0501034_0368762
1198 Ga0501036_0011373
1199 Ga0501036_0061317
1200 Ga0501036_0286497
1201 Ga0501037_0020977
1202 Ga0501037_0027502
1203 Ga0501037_0058689
1204 Ga0501037_0117115
1205 Ga0501038_0002224
1206 Ga0501038_0023644
1207 Ga0501038_0031437
1208 Ga0501038_0259695
1209 Ga0501038_0342796
1210 Ga0501042_0232305
1211 Ga0501043_0020667
1212 Ga0501043_0025466
1213 Ga0501043_0028456
1214 Ga0501043_0031220
1215 Ga0501043_0045748
1216 Ga0501043_0046949
1217 Ga0501046_0014560
1218 Ga0501047_0000189
1219 Ga0501047_0012368
1220 Ga0501047_0024495
1221 Ga0501047_0093869
1222 Ga0501047_0138058
1223 Ga0501048_0090189
1224 Ga0501069_0086437
1225 Ga0501070_0009831
1226 Ga0501080_0034843
1227 Ga0501083_0229617
1228 Ga0501035_0014702
1229 Ga0501035_0016857
1230 Ga0501035_0034865
1231 Ga0501035_0056837
1232 Ga0501035_0069750
1233 Ga0501035_0118436
1234 Ga0501035_0230476
1235 Ga0501044_0011484
1236 Ga0501044_0073254
1237 Ga0501044_0081186
1238 Ga0501044_0098676
1239 Ga0501044_0232068
1240 Ga0501045_0054293
1241 nmdc:mga04h51_143560_c1
1242 nmdc:mga0n895_402613_c1
1243 nmdc:mga0rr50_223479_c1
1244 Ga0495601_0023311
1245 Ga0495612_0016273
1246 Ga0500610_0163295
1247 Ga0495595_0065732
1248 Ga0495619_0003877
1249 Ga0495619_0017271
1250 Ga0500578_0234770
1251 Ga0500647_0263091
1252 Ga0500640_016663
1253 Ga0500641_0125228
1254 Ga0500660_016856
1255 Ga0500569_020249
1256 Ga0500652_001344
1257 Ga0500600_0036268
1258 Ga0500616_0008588
1259 Ga0500634_0030032
1260 Ga0466962_0014401
1261 2547409533
1262 2585299819
1263 2585306858
1264 2585320856
1265 2616694338
1266 2616899484
1267 2643897429
1268 2643945103
1269 2644265487
1270 2644387335
1271 2644408573
1272 2644432002
1273 2644435834
1274 2644463223
1275 2644632277
1276 2784587438
1277 2785367987
1278 2786669040
1279 2808840646
1280 2808919232
1281 2809231011
1282 2811847654
1283 2812359535
1284 2812481663
1285 2852638488
1286 2862182894
1287 2862288628
1288 2862514347
1289 2862582886
1290 2863406153
1291 2867435596
1292 2873156965
1293 2875393373
1294 2877682556
1295 2912721583
1296 2912725430
1297 2918503245
1298 2919468196
1299 2946051319
1300 2946066375
1301 2946074639
1302 2947230995
1303 2954004310
1304 2954387754
1305 2954675323
1306 2954688809
1307 2954698565
1308 2954703659
1309 2954717539
1310 2954727503
1311 2954734298
1312 2954746399
1313 2954753181
1314 2954765514
1315 2966603687
1316 2990063861
1317 2995464734
1318 3006396088
1319 3006427679
1320 3006495601
1321 8008580027
1322 8023627450
1323 8047899563
1324 8048359367
1325 8048376513
1326 8048385566
1327 8056449811
1328 8056836485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

65

168

0.94

PF08242

Methyltransf_12

Methyltransferase domain

65

166

0.93

PF13649

Methyltransf_25

Methyltransferase domain

64

164

0.92

PF13847

Methyltransf_31

Methyltransferase domain

58

192

0.88

PF13489

Methyltransf_23

Methyltransferase domain

38

209

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htf-assembly1.cif.gz_A crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine. 0.9003 2 232
4htf-assembly1.cif.gz_B crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine. 0.8984 2 233
8joz-assembly1.cif.gz_A crystal structure of cmom from e. coli complexed with sinefungin and cellularly expressed trna ser 0.8877 2 232
3lpm-assembly1.cif.gz_B crystal structure of putative methyltransferase small domain protein from listeria monocytogenes 0.8605 13 232
8joz-assembly1.cif.gz_A crystal structure of cmom from e. coli complexed with sinefungin and cellularly expressed trna ser 0.852 2 232
ID Description Score Start End Superfamily
af_P71794_42_196_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9268 3 115 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9174 19 63 3.40.50.150
af_Q4CM63_15_263_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.905 19 123 3.40.50.150
af_P36566_8_261_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8883 2 232 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.887 20 82 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q6I953-F1-model_v4 Methyltransferase domain-containing protein 0.9973 2 75 GO:0008168
GO:0009058
GO:0032259
AF-A0A177HNT9-F1-model_v4 Ubiquinone biosynthesis O-methyltransferase (EC 2.1.1.222, EC 2.1.1.64) 0.9931 2 233 GO:0032259
GO:0061542
GO:0102208
AF-A0A7M3LYS3-F1-model_v4 SAM-dependent methyltransferase 0.9931 2 233 GO:0008757
GO:0032259
AF-A0A4D4L244-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9891 15 116 GO:0008757
AF-A0A6B2WRC2-F1-model_v4 deleted 0.989 1 233

Map