F473573
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 663 | 272 | 663 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0235262|Ga0466961_0235262_213_824 |
| Length | 203 |
| Sequence | MALRVIAGSRKGHKLAAPRGHDTRPTSDRVRENIFNLVGPVDGARVLDLFAGSGALGIEALSRGATSAVFVERDPDAVRTIERNLDKLRLTGARVVHGDVLHAIAQEATAGAKYDLVLVDPPYGMLNDIQSRLARHLPLLLAANGLLVVETDARTEPELGLTIRTSRKYGQTRVTLFEAGGLGPTEPPGSGGAGVYGAGAGNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 110 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 123 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 129 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 132 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 133 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 141 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 142 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 143 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 144 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 270 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 272 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0.75 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.75 |
| Rhizosphere | 91.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10013374 | 3300005327 | Bacteria | 6584 |
| 2 | Ga0070658_10021338 | 3300005327 | Bacteria | 5191 |
| 3 | Ga0070683_100039772 | 3300005329 | Bacteria | 4319 |
| 4 | Ga0070683_100041387 | 3300005329 | Bacteria | 4238 |
| 5 | Ga0070680_100009628 | 3300005336 | Bacteria | 7429 |
| 6 | Ga0070680_100139973 | 3300005336 | Bacteria | 2029 |
| 7 | Ga0070682_100157395 | 3300005337 | Bacteria | 1565 |
| 8 | Ga0070682_100633466 | 3300005337 | Bacteria | 849 |
| 9 | Ga0070660_100007385 | 3300005339 | Bacteria | 7656 |
| 10 | Ga0070660_100016180 | 3300005339 | Bacteria | 5408 |
| 11 | Ga0070660_100150697 | 3300005339 | Bacteria | 1869 |
| 12 | Ga0070689_100864543 | 3300005340 | Bacteria | 798 |
| 13 | Ga0070661_100033902 | 3300005344 | Bacteria | 3701 |
| 14 | Ga0070661_100291142 | 3300005344 | Bacteria | 1269 |
| 15 | Ga0070659_100034400 | 3300005366 | Bacteria | 3941 |
| 16 | Ga0070659_100099627 | 3300005366 | Bacteria | 2338 |
| 17 | Ga0070659_100260698 | 3300005366 | Bacteria | 1438 |
| 18 | Ga0070709_10054490 | 3300005434 | Bacteria | 2521 |
| 19 | Ga0070709_10193813 | 3300005434 | Bacteria | 1435 |
| 20 | Ga0070709_10218145 | 3300005434 | Bacteria | 1359 |
| 21 | Ga0070714_100001136 | 3300005435 | Bacteria | 19099 |
| 22 | Ga0070714_100002733 | 3300005435 | Bacteria | 13002 |
| 23 | Ga0070714_100022837 | 3300005435 | Bacteria | 5133 |
| 24 | Ga0070714_100026293 | 3300005435 | Bacteria | 4809 |
| 25 | Ga0070714_100034163 | 3300005435 | Bacteria | 4257 |
| 26 | Ga0070714_100047538 | 3300005435 | Bacteria | 3646 |
| 27 | Ga0070714_100097099 | 3300005435 | Bacteria | 2589 |
| 28 | Ga0070714_100251352 | 3300005435 | Bacteria | 1635 |
| 29 | Ga0070714_100348500 | 3300005435 | Bacteria | 1390 |
| 30 | Ga0070713_100015877 | 3300005436 | Bacteria | 5645 |
| 31 | Ga0070713_100046101 | 3300005436 | Bacteria | 3575 |
| 32 | Ga0070713_100093949 | 3300005436 | Bacteria | 2585 |
| 33 | Ga0070713_100146367 | 3300005436 | Bacteria | 2097 |
| 34 | Ga0070713_101153324 | 3300005436 | Bacteria | 750 |
| 35 | Ga0070710_10046578 | 3300005437 | Bacteria | 2415 |
| 36 | Ga0070711_100075027 | 3300005439 | Bacteria | 2393 |
| 37 | Ga0070711_100083627 | 3300005439 | Bacteria | 2281 |
| 38 | Ga0070694_100212933 | 3300005444 | Bacteria | 1446 |
| 39 | Ga0070708_100414365 | 3300005445 | Bacteria | 1270 |
| 40 | Ga0070708_100656789 | 3300005445 | Bacteria | 988 |
| 41 | Ga0070708_101250811 | 3300005445 | Bacteria | 694 |
| 42 | Ga0070681_10041652 | 3300005458 | Bacteria | 4603 |
| 43 | Ga0070681_10125168 | 3300005458 | Bacteria | 2503 |
| 44 | Ga0070681_10166640 | 3300005458 | Bacteria | 2126 |
| 45 | Ga0070685_10687025 | 3300005466 | Bacteria | 745 |
| 46 | Ga0070706_100143947 | 3300005467 | Bacteria | 2226 |
| 47 | Ga0070707_100006214 | 3300005468 | Bacteria | 11123 |
| 48 | Ga0070707_100281342 | 3300005468 | Bacteria | 1617 |
| 49 | Ga0070707_100286163 | 3300005468 | Bacteria | 1602 |
| 50 | Ga0070707_100477723 | 3300005468 | Bacteria | 1208 |
| 51 | Ga0070707_100935765 | 3300005468 | Bacteria | 831 |
| 52 | Ga0070707_101370338 | 3300005468 | Bacteria | 674 |
| 53 | Ga0070698_100073048 | 3300005471 | Bacteria | 3437 |
| 54 | Ga0070698_100103583 | 3300005471 | Bacteria | 2816 |
| 55 | Ga0070698_100130968 | 3300005471 | Bacteria | 2463 |
| 56 | Ga0070698_100151186 | 3300005471 | Bacteria | 2269 |
| 57 | Ga0070698_100213818 | 3300005471 | Bacteria | 1862 |
| 58 | Ga0070698_100863997 | 3300005471 | Bacteria | 850 |
| 59 | Ga0070698_101159593 | 3300005471 | Bacteria | 722 |
| 60 | Ga0070698_101313427 | 3300005471 | Bacteria | 673 |
| 61 | Ga0070698_101538846 | 3300005471 | Bacteria | 617 |
| 62 | Ga0070699_100807374 | 3300005518 | Bacteria | 859 |
| 63 | Ga0070699_100973024 | 3300005518 | Bacteria | 778 |
| 64 | Ga0070679_100060118 | 3300005530 | Bacteria | 3787 |
| 65 | Ga0070679_101343321 | 3300005530 | Bacteria | 661 |
| 66 | Ga0070684_100093517 | 3300005535 | Bacteria | 2676 |
| 67 | Ga0070684_100469733 | 3300005535 | Bacteria | 1163 |
| 68 | Ga0070684_100949999 | 3300005535 | Bacteria | 806 |
| 69 | Ga0070695_100000837 | 3300005545 | Bacteria | 16613 |
| 70 | Ga0070704_100105578 | 3300005549 | Bacteria | 2133 |
| 71 | Ga0068855_100137311 | 3300005563 | Bacteria | 2789 |
| 72 | Ga0068857_100003516 | 3300005577 | Bacteria | 13090 |
| 73 | Ga0068854_100117615 | 3300005578 | Bacteria | 2013 |
| 74 | Ga0068854_101030974 | 3300005578 | Bacteria | 730 |
| 75 | Ga0068856_100706034 | 3300005614 | Bacteria | 1029 |
| 76 | Ga0068852_100641285 | 3300005616 | Bacteria | 1069 |
| 77 | Ga0068866_10270113 | 3300005718 | Bacteria | 1049 |
| 78 | Ga0068858_100535538 | 3300005842 | Bacteria | 1133 |
| 79 | Ga0081455_10052759 | 3300005937 | Bacteria | 3478 |
| 80 | Ga0081538_10228953 | 3300005981 | Bacteria | 728 |
| 81 | Ga0081539_10004223 | 3300005985 | Bacteria | 16177 |
| 82 | Ga0081539_10026584 | 3300005985 | Bacteria | 3688 |
| 83 | Ga0070717_10003257 | 3300006028 | Bacteria | 11608 |
| 84 | Ga0070717_10049174 | 3300006028 | Bacteria | 3461 |
| 85 | Ga0070717_10052709 | 3300006028 | Bacteria | 3352 |
| 86 | Ga0070717_10094099 | 3300006028 | Bacteria | 2534 |
| 87 | Ga0070717_10118155 | 3300006028 | Bacteria | 2269 |
| 88 | Ga0070717_10235391 | 3300006028 | Bacteria | 1613 |
| 89 | Ga0070717_10440769 | 3300006028 | Bacteria | 1173 |
| 90 | Ga0070715_10035614 | 3300006163 | Bacteria | 2048 |
| 91 | Ga0070716_100023259 | 3300006173 | Bacteria | 3283 |
| 92 | Ga0070716_100058838 | 3300006173 | Bacteria | 2213 |
| 93 | Ga0070716_100131051 | 3300006173 | Bacteria | 1585 |
| 94 | Ga0070716_100272417 | 3300006173 | Bacteria | 1164 |
| 95 | Ga0070716_100763366 | 3300006173 | Bacteria | 745 |
| 96 | Ga0070712_100005908 | 3300006175 | Bacteria | 7573 |
| 97 | Ga0070712_100084373 | 3300006175 | Bacteria | 2309 |
| 98 | Ga0070712_100135680 | 3300006175 | Bacteria | 1871 |
| 99 | Ga0070712_100248622 | 3300006175 | Bacteria | 1420 |
| 100 | Ga0070712_100822400 | 3300006175 | Bacteria | 798 |
| 101 | Ga0075428_100752649 | 3300006844 | Bacteria | 1037 |
| 102 | Ga0075433_10805442 | 3300006852 | Bacteria | 821 |
| 103 | Ga0075434_100008573 | 3300006871 | Bacteria | 9510 |
| 104 | Ga0075434_100087644 | 3300006871 | Bacteria | 3114 |
| 105 | Ga0075436_100292172 | 3300006914 | Bacteria | 1167 |
| 106 | Ga0075435_100050921 | 3300007076 | Bacteria | 3334 |
| 107 | Ga0105240_10006843 | 3300009093 | Bacteria | 16668 |
| 108 | Ga0105240_10056712 | 3300009093 | Bacteria | 4900 |
| 109 | Ga0111539_10034378 | 3300009094 | Bacteria | 6147 |
| 110 | Ga0111539_12048342 | 3300009094 | Bacteria | 664 |
| 111 | Ga0105245_10301976 | 3300009098 | Bacteria | 1571 |
| 112 | Ga0114129_11571449 | 3300009147 | Bacteria | 806 |
| 113 | Ga0105242_10660205 | 3300009176 | Bacteria | 1018 |
| 114 | Ga0105242_10948365 | 3300009176 | Bacteria | 864 |
| 115 | Ga0105248_10550940 | 3300009177 | Bacteria | 1301 |
| 116 | Ga0105237_10045015 | 3300009545 | Bacteria | 4443 |
| 117 | Ga0105238_10194048 | 3300009551 | Bacteria | 2006 |
| 118 | Ga0105238_11614995 | 3300009551 | Bacteria | 678 |
| 119 | Ga0105239_10276235 | 3300010375 | Bacteria | 1890 |
| 120 | Ga0105246_10160502 | 3300011119 | Bacteria | 1712 |
| 121 | Ga0157373_10151334 | 3300013100 | Bacteria | 1632 |
| 122 | Ga0157370_10012715 | 3300013104 | Bacteria | 8711 |
| 123 | Ga0157370_10329264 | 3300013104 | Bacteria | 1408 |
| 124 | Ga0157369_10006695 | 3300013105 | Bacteria | 13309 |
| 125 | Ga0157369_10110889 | 3300013105 | Bacteria | 2916 |
| 126 | Ga0157369_10208763 | 3300013105 | Bacteria | 2048 |
| 127 | Ga0157372_10260460 | 3300013307 | Bacteria | 2014 |
| 128 | Ga0157372_10339683 | 3300013307 | Bacteria | 1749 |
| 129 | Ga0157372_10931972 | 3300013307 | Bacteria | 1007 |
| 130 | Ga0157380_11987019 | 3300014326 | Bacteria | 643 |
| 131 | Ga0182008_10042547 | 3300014497 | Bacteria | 2263 |
| 132 | Ga0182008_10240388 | 3300014497 | Bacteria | 931 |
| 133 | Ga0182008_10465486 | 3300014497 | Bacteria | 690 |
| 134 | Ga0197907_10281088 | 3300020069 | Bacteria | 3428 |
| 135 | Ga0206356_10252104 | 3300020070 | Bacteria | 1413 |
| 136 | Ga0206356_11592742 | 3300020070 | Bacteria | 1653 |
| 137 | Ga0206354_11527074 | 3300020081 | Bacteria | 1795 |
| 138 | Ga0206353_11846493 | 3300020082 | Bacteria | 4093 |
| 139 | Ga0207692_10054038 | 3300025898 | Bacteria | 2048 |
| 140 | Ga0207699_10022264 | 3300025906 | Bacteria | 3431 |
| 141 | Ga0207699_10254007 | 3300025906 | Bacteria | 1212 |
| 142 | Ga0207699_10366390 | 3300025906 | Bacteria | 1020 |
| 143 | Ga0207705_10027373 | 3300025909 | Bacteria | 4066 |
| 144 | Ga0207705_10305657 | 3300025909 | Bacteria | 1220 |
| 145 | Ga0207684_10336198 | 3300025910 | Bacteria | 1301 |
| 146 | Ga0207684_10350231 | 3300025910 | Bacteria | 1271 |
| 147 | Ga0207707_10027158 | 3300025912 | Bacteria | 5005 |
| 148 | Ga0207707_10078401 | 3300025912 | Bacteria | 2885 |
| 149 | Ga0207707_10127723 | 3300025912 | Bacteria | 2223 |
| 150 | Ga0207707_10222523 | 3300025912 | Bacteria | 1643 |
| 151 | Ga0207707_10300755 | 3300025912 | Bacteria | 1387 |
| 152 | Ga0207695_10015041 | 3300025913 | Bacteria | 9132 |
| 153 | Ga0207671_10190823 | 3300025914 | Bacteria | 1598 |
| 154 | Ga0207693_10003767 | 3300025915 | Bacteria | 12922 |
| 155 | Ga0207693_10006329 | 3300025915 | Bacteria | 9815 |
| 156 | Ga0207693_10134215 | 3300025915 | Bacteria | 1946 |
| 157 | Ga0207693_10321956 | 3300025915 | Bacteria | 1210 |
| 158 | Ga0207693_10336880 | 3300025915 | Bacteria | 1181 |
| 159 | Ga0207693_10471251 | 3300025915 | Bacteria | 981 |
| 160 | Ga0207663_10060745 | 3300025916 | Bacteria | 2396 |
| 161 | Ga0207660_10130691 | 3300025917 | Bacteria | 1911 |
| 162 | Ga0207660_10368621 | 3300025917 | Bacteria | 1153 |
| 163 | Ga0207660_10476337 | 3300025917 | Bacteria | 1011 |
| 164 | Ga0207657_10001172 | 3300025919 | Bacteria | 27807 |
| 165 | Ga0207657_10015625 | 3300025919 | Bacteria | 7345 |
| 166 | Ga0207657_10026306 | 3300025919 | Bacteria | 5349 |
| 167 | Ga0207649_10019214 | 3300025920 | Bacteria | 3903 |
| 168 | Ga0207652_10036795 | 3300025921 | Bacteria | 4139 |
| 169 | Ga0207652_10206122 | 3300025921 | Bacteria | 1770 |
| 170 | Ga0207652_10340252 | 3300025921 | Bacteria | 1354 |
| 171 | Ga0207652_10445981 | 3300025921 | Bacteria | 1167 |
| 172 | Ga0207646_10000268 | 3300025922 | Bacteria | 71093 |
| 173 | Ga0207646_10319344 | 3300025922 | Bacteria | 1403 |
| 174 | Ga0207646_10639599 | 3300025922 | Bacteria | 953 |
| 175 | Ga0207646_10906589 | 3300025922 | Bacteria | 782 |
| 176 | Ga0207694_10350218 | 3300025924 | Unclassified | 1222 |
| 177 | Ga0207687_10206251 | 3300025927 | Bacteria | 1539 |
| 178 | Ga0207700_10072094 | 3300025928 | Bacteria | 2662 |
| 179 | Ga0207700_10073111 | 3300025928 | Bacteria | 2646 |
| 180 | Ga0207700_10157989 | 3300025928 | Bacteria | 1880 |
| 181 | Ga0207664_10061369 | 3300025929 | Bacteria | 2999 |
| 182 | Ga0207664_10079909 | 3300025929 | Bacteria | 2656 |
| 183 | Ga0207664_10080089 | 3300025929 | Bacteria | 2654 |
| 184 | Ga0207664_10096964 | 3300025929 | Bacteria | 2428 |
| 185 | Ga0207664_10127977 | 3300025929 | Bacteria | 2134 |
| 186 | Ga0207664_10138740 | 3300025929 | Bacteria | 2054 |
| 187 | Ga0207664_10352347 | 3300025929 | Bacteria | 1303 |
| 188 | Ga0207664_10369386 | 3300025929 | Bacteria | 1272 |
| 189 | Ga0207664_10374992 | 3300025929 | Bacteria | 1262 |
| 190 | Ga0207664_10465682 | 3300025929 | Bacteria | 1129 |
| 191 | Ga0207664_11269532 | 3300025929 | Bacteria | 656 |
| 192 | Ga0207690_10167134 | 3300025932 | Bacteria | 1645 |
| 193 | Ga0207690_10173067 | 3300025932 | Bacteria | 1619 |
| 194 | Ga0207690_10237390 | 3300025932 | Bacteria | 1402 |
| 195 | Ga0207686_10158992 | 3300025934 | Bacteria | 1582 |
| 196 | Ga0207686_10902572 | 3300025934 | Bacteria | 713 |
| 197 | Ga0207670_10851369 | 3300025936 | Bacteria | 762 |
| 198 | Ga0207665_10002880 | 3300025939 | Bacteria | 11539 |
| 199 | Ga0207665_10065656 | 3300025939 | Bacteria | 2468 |
| 200 | Ga0207661_10143845 | 3300025944 | Bacteria | 2055 |
| 201 | Ga0207661_10161116 | 3300025944 | Bacteria | 1946 |
| 202 | Ga0207679_10270882 | 3300025945 | Bacteria | 1452 |
| 203 | Ga0207667_10133809 | 3300025949 | Bacteria | 2553 |
| 204 | Ga0207640_10120690 | 3300025981 | Bacteria | 1877 |
| 205 | Ga0207702_10117913 | 3300026078 | Bacteria | 2371 |
| 206 | Ga0207674_10004342 | 3300026116 | Bacteria | 17098 |
| 207 | Ga0207683_10596407 | 3300026121 | Bacteria | 1022 |
| 208 | Ga0265326_10034844 | 3300028558 | Bacteria | 1432 |
| 209 | Ga0265326_10060100 | 3300028558 | Bacteria | 1075 |
| 210 | Ga0265319_1001478 | 3300028563 | Bacteria | 14041 |
| 211 | Ga0265319_1007290 | 3300028563 | Bacteria | 4991 |
| 212 | Ga0265334_10000882 | 3300028573 | Bacteria | 15013 |
| 213 | Ga0265334_10008358 | 3300028573 | Bacteria | 4401 |
| 214 | Ga0265334_10031290 | 3300028573 | Bacteria | 2127 |
| 215 | Ga0265318_10000530 | 3300028577 | Bacteria | 27345 |
| 216 | Ga0265318_10006013 | 3300028577 | Bacteria | 5629 |
| 217 | Ga0265323_10059318 | 3300028653 | Bacteria | 1335 |
| 218 | Ga0265322_10006239 | 3300028654 | Bacteria | 3508 |
| 219 | Ga0265336_10020341 | 3300028666 | Bacteria | 2131 |
| 220 | Ga0265338_10003899 | 3300028800 | Bacteria | 20611 |
| 221 | Ga0265338_10029121 | 3300028800 | Bacteria | 5485 |
| 222 | Ga0265338_10035929 | 3300028800 | Bacteria | 4751 |
| 223 | Ga0265338_10036613 | 3300028800 | Bacteria | 4692 |
| 224 | Ga0265324_10021048 | 3300029957 | Bacteria | 2340 |
| 225 | Ga0265324_10028859 | 3300029957 | Bacteria | 1954 |
| 226 | Ga0265324_10086061 | 3300029957 | Bacteria | 1069 |
| 227 | Ga0265330_10000639 | 3300031235 | Bacteria | 22518 |
| 228 | Ga0265330_10059201 | 3300031235 | Bacteria | 1668 |
| 229 | Ga0265330_10088280 | 3300031235 | Bacteria | 1332 |
| 230 | Ga0265332_10011930 | 3300031238 | Bacteria | 3860 |
| 231 | Ga0265332_10146939 | 3300031238 | Bacteria | 987 |
| 232 | Ga0265328_10000260 | 3300031239 | Bacteria | 24416 |
| 233 | Ga0265320_10005160 | 3300031240 | Bacteria | 8428 |
| 234 | Ga0265320_10009679 | 3300031240 | Bacteria | 5791 |
| 235 | Ga0265325_10005799 | 3300031241 | Bacteria | 7570 |
| 236 | Ga0265325_10052415 | 3300031241 | Bacteria | 2095 |
| 237 | Ga0265329_10000312 | 3300031242 | Bacteria | 25792 |
| 238 | Ga0265329_10013860 | 3300031242 | Bacteria | 2861 |
| 239 | Ga0265340_10003471 | 3300031247 | Bacteria | 8889 |
| 240 | Ga0265339_10004250 | 3300031249 | Bacteria | 9807 |
| 241 | Ga0265339_10046850 | 3300031249 | Bacteria | 2374 |
| 242 | Ga0265331_10006045 | 3300031250 | Bacteria | 7210 |
| 243 | Ga0265331_10133259 | 3300031250 | Bacteria | 1133 |
| 244 | Ga0265327_10002384 | 3300031251 | Bacteria | 19957 |
| 245 | Ga0265327_10025465 | 3300031251 | Bacteria | 3448 |
| 246 | Ga0265316_10017452 | 3300031344 | Bacteria | 6202 |
| 247 | Ga0265316_10055780 | 3300031344 | Bacteria | 3088 |
| 248 | Ga0265316_10100171 | 3300031344 | Bacteria | 2203 |
| 249 | Ga0265316_10525086 | 3300031344 | Bacteria | 844 |
| 250 | Ga0265313_10006320 | 3300031595 | Bacteria | 8430 |
| 251 | Ga0265313_10027719 | 3300031595 | Bacteria | 2960 |
| 252 | Ga0265313_10069176 | 3300031595 | Bacteria | 1629 |
| 253 | Ga0265313_10165789 | 3300031595 | Bacteria | 936 |
| 254 | Ga0265314_10004081 | 3300031711 | Bacteria | 13766 |
| 255 | Ga0265314_10021281 | 3300031711 | Bacteria | 4991 |
| 256 | Ga0265342_10003116 | 3300031712 | Bacteria | 13857 |
| 257 | Ga0307416_100077943 | 3300032002 | Bacteria | 2786 |
| 258 | Ga0373951_0042916 | 3300035091 | Bacteria | 1095 |
| 259 | Ga0373945_0181461 | 3300035116 | Bacteria | 867 |
| 260 | Ga0373953_0129231 | 3300035117 | Bacteria | 1077 |
| 261 | Ga0373956_0060210 | 3300035119 | Bacteria | 1719 |
| 262 | Ga0373957_0062019 | 3300035120 | Bacteria | 1450 |
| 263 | Ga0373943_0006289 | 3300035170 | Bacteria | 5331 |
| 264 | Ga0373946_0009153 | 3300035171 | Bacteria | 3645 |
| 265 | Ga0373955_0277595 | 3300035172 | Bacteria | 1008 |
| 266 | Ga0373942_0170404 | 3300035207 | Bacteria | 708 |
| 267 | Ga0373961_0045467 | 3300035241 | Bacteria | 1284 |
| 268 | Ga0373924_0119261 | 3300035410 | Bacteria | 1144 |
| 269 | Ga0373931_0258338 | 3300035691 | Bacteria | 1062 |
| 270 | Ga0373935_0008028 | 3300035692 | Bacteria | 6325 |
| 271 | Ga0373935_0018888 | 3300035692 | Bacteria | 4202 |
| 272 | Ga0373935_0053915 | 3300035692 | Bacteria | 2559 |
| 273 | Ga0373935_0344407 | 3300035692 | Bacteria | 1062 |
| 274 | Ga0373927_0899408 | 3300035695 | Bacteria | 584 |
| 275 | Ga0373947_0000125 | 3300035725 | Bacteria | 38878 |
| 276 | Ga0373937_0001655 | 3300036401 | Bacteria | 18730 |
| 277 | Ga0373937_0325306 | 3300036401 | Bacteria | 1455 |
| 278 | Ga0373937_0553643 | 3300036401 | Bacteria | 1093 |
| 279 | Ga0373925_0011706 | 3300037068 | Bacteria | 6343 |
| 280 | Ga0395899_0072843 | 3300037312 | Bacteria | 2513 |
| 281 | Ga0395900_0032016 | 3300037418 | Bacteria | 5406 |
| 282 | Ga0395900_0064558 | 3300037418 | Bacteria | 3762 |
| 283 | Ga0395900_0615956 | 3300037418 | Bacteria | 1025 |
| 284 | Ga0395900_0911724 | 3300037418 | Bacteria | 802 |
| 285 | Ga0395900_1010819 | 3300037418 | Bacteria | 751 |
| 286 | Ga0395900_1329613 | 3300037418 | Bacteria | 632 |
| 287 | Ga0395898_0043986 | 3300037466 | Bacteria | 4399 |
| 288 | Ga0395898_0061347 | 3300037466 | Bacteria | 3653 |
| 289 | Ga0395898_0217522 | 3300037466 | Bacteria | 1822 |
| 290 | Ga0395898_0333920 | 3300037466 | Bacteria | 1445 |
| 291 | Ga0395898_0458695 | 3300037466 | Bacteria | 1213 |
| 292 | Ga0395898_0832588 | 3300037466 | Bacteria | 862 |
| 293 | Ga0395898_0946234 | 3300037466 | Bacteria | 799 |
| 294 | Ga0395905_0097411 | 3300037471 | Bacteria | 2761 |
| 295 | Ga0395905_0106195 | 3300037471 | Bacteria | 2637 |
| 296 | Ga0395905_0157076 | 3300037471 | Bacteria | 2139 |
| 297 | Ga0395905_0189059 | 3300037471 | Bacteria | 1932 |
| 298 | Ga0395901_0139498 | 3300038443 | Bacteria | 2548 |
| 299 | Ga0395901_0177641 | 3300038443 | Bacteria | 2233 |
| 300 | Ga0395901_0250201 | 3300038443 | Bacteria | 1846 |
| 301 | Ga0395901_0259428 | 3300038443 | Bacteria | 1809 |
| 302 | Ga0395901_0260035 | 3300038443 | Bacteria | 1807 |
| 303 | Ga0395901_0271353 | 3300038443 | Bacteria | 1764 |
| 304 | Ga0395901_0448327 | 3300038443 | Bacteria | 1320 |
| 305 | Ga0395901_0706984 | 3300038443 | Bacteria | 1005 |
| 306 | Ga0395901_0907139 | 3300038443 | Bacteria | 863 |
| 307 | Ga0395901_0915770 | 3300038443 | Bacteria | 858 |
| 308 | Ga0395901_1070703 | 3300038443 | Bacteria | 778 |
| 309 | Ga0436360_1019093 | 3300039438 | Bacteria | 6455 |
| 310 | Ga0439448_0022099 | 3300042005 | Bacteria | 1975 |
| 311 | Ga0439448_0123607 | 3300042005 | Bacteria | 889 |
| 312 | Ga0439459_0132816 | 3300042438 | Bacteria | 637 |
| 313 | Ga0451577_0730390 | 3300042876 | Bacteria | 896 |
| 314 | Ga0466969_0176351 | 3300044656 | Bacteria | 979 |
| 315 | Ga0466969_0350520 | 3300044656 | Bacteria | 668 |
| 316 | Ga0466972_0075876 | 3300044658 | Bacteria | 1602 |
| 317 | Ga0466965_0170179 | 3300044683 | Bacteria | 1146 |
| 318 | Ga0466966_0005863 | 3300044684 | Bacteria | 8101 |
| 319 | Ga0466961_0013026 | 3300044693 | Bacteria | 5320 |
| 320 | Ga0466961_0063795 | 3300044693 | Bacteria | 2341 |
| 321 | Ga0466961_0081301 | 3300044693 | Bacteria | 2050 |
| 322 | Ga0466961_0235262 | 3300044693 | Bacteria | 1127 |
| 323 | Ga0466963_0000135 | 3300044694 | Bacteria | 28446 |
| 324 | Ga0466963_0000185 | 3300044694 | Bacteria | 26033 |
| 325 | Ga0466963_0003099 | 3300044694 | Bacteria | 9427 |
| 326 | Ga0466963_0004811 | 3300044694 | Bacteria | 7871 |
| 327 | Ga0466963_0011793 | 3300044694 | Bacteria | 5331 |
| 328 | Ga0466963_0073659 | 3300044694 | Bacteria | 2302 |
| 329 | Ga0466963_0150423 | 3300044694 | Bacteria | 1616 |
| 330 | Ga0466963_0160835 | 3300044694 | Bacteria | 1563 |
| 331 | Ga0466963_0308276 | 3300044694 | Bacteria | 1113 |
| 332 | Ga0466964_0000686 | 3300044706 | Bacteria | 10938 |
| 333 | Ga0466964_0018299 | 3300044706 | Bacteria | 2687 |
| 334 | Ga0466964_0088461 | 3300044706 | Bacteria | 1343 |
| 335 | Ga0453684_2213223 | 3300044712 | Bacteria | 549 |
| 336 | Ga0466971_0016469 | 3300044719 | Bacteria | 3263 |
| 337 | Ga0466971_0164405 | 3300044719 | Bacteria | 1039 |
| 338 | Ga0466971_0237229 | 3300044719 | Bacteria | 867 |
| 339 | Ga0466971_0421935 | 3300044719 | Bacteria | 652 |
| 340 | Ga0466968_0030786 | 3300044735 | Bacteria | 2224 |
| 341 | Ga0466968_0035090 | 3300044735 | Bacteria | 2097 |
| 342 | Ga0466968_0297829 | 3300044735 | Bacteria | 775 |
| 343 | Ga0466968_0381984 | 3300044735 | Bacteria | 688 |
| 344 | Ga0466957_0001309 | 3300044842 | Bacteria | 13003 |
| 345 | Ga0466957_0020997 | 3300044842 | Bacteria | 3843 |
| 346 | Ga0466957_0072586 | 3300044842 | Bacteria | 2131 |
| 347 | Ga0466957_0084573 | 3300044842 | Bacteria | 1980 |
| 348 | Ga0466957_0183886 | 3300044842 | Bacteria | 1366 |
| 349 | Ga0466960_0011201 | 3300044901 | Bacteria | 3743 |
| 350 | Ga0466960_0058882 | 3300044901 | Bacteria | 1877 |
| 351 | Ga0466960_0570051 | 3300044901 | Bacteria | 669 |
| 352 | Ga0466959_0047124 | 3300045049 | Bacteria | 3171 |
| 353 | Ga0466959_0049465 | 3300045049 | Bacteria | 3088 |
| 354 | Ga0466959_0548526 | 3300045049 | Bacteria | 780 |
| 355 | Ga0451576_0755111 | 3300045051 | Bacteria | 1022 |
| 356 | Ga0466958_0001421 | 3300045836 | Bacteria | 11340 |
| 357 | Ga0466958_0003530 | 3300045836 | Bacteria | 8130 |
| 358 | Ga0466958_0004915 | 3300045836 | Bacteria | 7124 |
| 359 | Ga0466958_0029122 | 3300045836 | Bacteria | 3275 |
| 360 | Ga0466958_0292036 | 3300045836 | Bacteria | 1046 |
| 361 | Ga0466967_0000086 | 3300045976 | Bacteria | 34116 |
| 362 | Ga0466967_0000886 | 3300045976 | Bacteria | 15966 |
| 363 | Ga0466967_0001422 | 3300045976 | Bacteria | 13861 |
| 364 | Ga0466967_0005702 | 3300045976 | Bacteria | 8683 |
| 365 | Ga0466967_0008784 | 3300045976 | Bacteria | 7446 |
| 366 | Ga0466967_0017765 | 3300045976 | Bacteria | 5661 |
| 367 | Ga0466967_0020328 | 3300045976 | Bacteria | 5363 |
| 368 | Ga0466967_0040758 | 3300045976 | Bacteria | 3999 |
| 369 | Ga0466967_0050843 | 3300045976 | Bacteria | 3630 |
| 370 | Ga0466967_0053200 | 3300045976 | Bacteria | 3557 |
| 371 | Ga0466967_0071889 | 3300045976 | Bacteria | 3098 |
| 372 | Ga0466967_0130011 | 3300045976 | Bacteria | 2336 |
| 373 | Ga0466967_0191441 | 3300045976 | Bacteria | 1933 |
| 374 | Ga0466967_0208334 | 3300045976 | Bacteria | 1854 |
| 375 | Ga0466967_0253301 | 3300045976 | Bacteria | 1682 |
| 376 | Ga0466967_0274366 | 3300045976 | Bacteria | 1616 |
| 377 | Ga0466967_0351114 | 3300045976 | Bacteria | 1427 |
| 378 | Ga0466967_0370454 | 3300045976 | Bacteria | 1389 |
| 379 | Ga0466967_0441011 | 3300045976 | Bacteria | 1271 |
| 380 | Ga0495592_0000125 | 3300046454 | Bacteria | 68045 |
| 381 | Ga0495592_0023488 | 3300046454 | Bacteria | 4689 |
| 382 | Ga0495592_0036718 | 3300046454 | Bacteria | 3689 |
| 383 | Ga0495592_0081922 | 3300046454 | Bacteria | 2333 |
| 384 | Ga0495592_0144468 | 3300046454 | Bacteria | 1651 |
| 385 | Ga0495603_0006179 | 3300046455 | Bacteria | 7161 |
| 386 | Ga0495603_0231423 | 3300046455 | Bacteria | 1065 |
| 387 | Ga0495629_0236715 | 3300046459 | Bacteria | 1257 |
| 388 | Ga0495641_0007350 | 3300046461 | Bacteria | 6897 |
| 389 | Ga0495641_0032945 | 3300046461 | Bacteria | 2463 |
| 390 | Ga0495641_0071515 | 3300046461 | Bacteria | 1557 |
| 391 | Ga0495651_0000011 | 3300046462 | Bacteria | 147193 |
| 392 | Ga0495651_0010221 | 3300046462 | Bacteria | 7204 |
| 393 | Ga0495651_0025885 | 3300046462 | Bacteria | 4568 |
| 394 | Ga0495653_0001602 | 3300046463 | Bacteria | 17779 |
| 395 | Ga0495653_0029523 | 3300046463 | Bacteria | 4376 |
| 396 | Ga0495653_0039472 | 3300046463 | Bacteria | 3698 |
| 397 | Ga0495653_0078647 | 3300046463 | Bacteria | 2445 |
| 398 | Ga0495653_0206618 | 3300046463 | Bacteria | 1329 |
| 399 | Ga0495653_0212174 | 3300046463 | Bacteria | 1307 |
| 400 | Ga0495653_0421727 | 3300046463 | Bacteria | 844 |
| 401 | Ga0495653_0942294 | 3300046463 | Bacteria | 513 |
| 402 | Ga0495582_0001075 | 3300046473 | Bacteria | 15353 |
| 403 | Ga0495582_0033633 | 3300046473 | Bacteria | 2819 |
| 404 | Ga0495582_0078084 | 3300046473 | Bacteria | 1836 |
| 405 | Ga0495639_0007680 | 3300046475 | Bacteria | 4637 |
| 406 | Ga0495662_0003247 | 3300046476 | Bacteria | 8215 |
| 407 | Ga0495664_0009793 | 3300046477 | Bacteria | 5373 |
| 408 | Ga0495664_0064092 | 3300046477 | Bacteria | 2190 |
| 409 | Ga0495585_0262591 | 3300046492 | Bacteria | 858 |
| 410 | Ga0495585_0294166 | 3300046492 | Bacteria | 800 |
| 411 | Ga0495594_0244607 | 3300046499 | Bacteria | 1022 |
| 412 | Ga0495607_0054542 | 3300046501 | Bacteria | 2303 |
| 413 | Ga0495607_0140028 | 3300046501 | Bacteria | 1249 |
| 414 | Ga0495608_0001526 | 3300046511 | Bacteria | 16479 |
| 415 | Ga0495608_0010696 | 3300046511 | Bacteria | 6402 |
| 416 | Ga0495608_0147827 | 3300046511 | Bacteria | 1498 |
| 417 | Ga0495618_0011398 | 3300046514 | Bacteria | 5391 |
| 418 | Ga0495618_0016806 | 3300046514 | Bacteria | 4480 |
| 419 | Ga0495618_0226276 | 3300046514 | Bacteria | 1179 |
| 420 | Ga0495628_0000024 | 3300046516 | Bacteria | 130196 |
| 421 | Ga0495628_0216592 | 3300046516 | Bacteria | 1439 |
| 422 | Ga0495628_0507432 | 3300046516 | Bacteria | 870 |
| 423 | Ga0495630_0002944 | 3300046517 | Bacteria | 11829 |
| 424 | Ga0495630_0053750 | 3300046517 | Bacteria | 3016 |
| 425 | Ga0495630_0076050 | 3300046517 | Bacteria | 2529 |
| 426 | Ga0495630_0105391 | 3300046517 | Bacteria | 2135 |
| 427 | Ga0495630_0127066 | 3300046517 | Bacteria | 1935 |
| 428 | Ga0495630_0137973 | 3300046517 | Bacteria | 1853 |
| 429 | Ga0495630_0221807 | 3300046517 | Bacteria | 1443 |
| 430 | Ga0495630_0369302 | 3300046517 | Bacteria | 1099 |
| 431 | Ga0495630_0386076 | 3300046517 | Bacteria | 1073 |
| 432 | Ga0495630_0393993 | 3300046517 | Bacteria | 1061 |
| 433 | Ga0495630_0409248 | 3300046517 | Bacteria | 1039 |
| 434 | Ga0495644_0004460 | 3300046523 | Bacteria | 5501 |
| 435 | Ga0495644_0036888 | 3300046523 | Bacteria | 1844 |
| 436 | Ga0495666_0001078 | 3300046526 | Bacteria | 12995 |
| 437 | Ga0495652_0000299 | 3300046529 | Bacteria | 58948 |
| 438 | Ga0495652_0052430 | 3300046529 | Bacteria | 3479 |
| 439 | Ga0495652_0084313 | 3300046529 | Bacteria | 2613 |
| 440 | Ga0495652_0200141 | 3300046529 | Bacteria | 1516 |
| 441 | Ga0495652_0295584 | 3300046529 | Bacteria | 1180 |
| 442 | Ga0495652_0756143 | 3300046529 | Bacteria | 650 |
| 443 | Ga0495665_0009951 | 3300046531 | Bacteria | 5149 |
| 444 | Ga0495640_0010056 | 3300046533 | Bacteria | 7333 |
| 445 | Ga0495640_0566594 | 3300046533 | Unclassified | 688 |
| 446 | Ga0495586_0004633 | 3300046535 | Bacteria | 7351 |
| 447 | Ga0495587_0003192 | 3300046536 | Bacteria | 10946 |
| 448 | Ga0495587_0004974 | 3300046536 | Bacteria | 8703 |
| 449 | Ga0495587_0290182 | 3300046536 | Bacteria | 916 |
| 450 | Ga0495598_0145912 | 3300046537 | Bacteria | 822 |
| 451 | Ga0495609_0086090 | 3300046538 | Bacteria | 1370 |
| 452 | Ga0495645_0000035 | 3300046543 | Bacteria | 102305 |
| 453 | Ga0495667_0021742 | 3300046559 | Bacteria | 4328 |
| 454 | Ga0495667_0064029 | 3300046559 | Bacteria | 2406 |
| 455 | Ga0495667_0123072 | 3300046559 | Bacteria | 1674 |
| 456 | Ga0495667_0139928 | 3300046559 | Bacteria | 1560 |
| 457 | Ga0495667_0166418 | 3300046559 | Bacteria | 1417 |
| 458 | Ga0495634_0038985 | 3300046642 | Bacteria | 3237 |
| 459 | Ga0495634_0059891 | 3300046642 | Bacteria | 2534 |
| 460 | Ga0495634_0096301 | 3300046642 | Bacteria | 1916 |
| 461 | Ga0495634_0156077 | 3300046642 | Bacteria | 1441 |
| 462 | Ga0495635_0027023 | 3300046663 | Bacteria | 3992 |
| 463 | Ga0495635_0054681 | 3300046663 | Bacteria | 2749 |
| 464 | Ga0495635_0086534 | 3300046663 | Bacteria | 2144 |
| 465 | Ga0495635_0110600 | 3300046663 | Bacteria | 1877 |
| 466 | Ga0495635_0395642 | 3300046663 | Bacteria | 918 |
| 467 | Ga0495657_0053029 | 3300046675 | Bacteria | 2715 |
| 468 | Ga0495657_0055510 | 3300046675 | Bacteria | 2641 |
| 469 | Ga0495657_0068713 | 3300046675 | Bacteria | 2320 |
| 470 | Ga0495657_0134596 | 3300046675 | Bacteria | 1545 |
| 471 | Ga0495657_0139952 | 3300046675 | Bacteria | 1509 |
| 472 | Ga0495657_0283496 | 3300046675 | Bacteria | 991 |
| 473 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 474 | Ga0495599_0008788 | 3300046678 | Bacteria | 6147 |
| 475 | Ga0495599_0040906 | 3300046678 | Bacteria | 2910 |
| 476 | Ga0495623_0000039 | 3300046679 | Bacteria | 80360 |
| 477 | Ga0495623_0278295 | 3300046679 | Bacteria | 932 |
| 478 | Ga0495646_0135294 | 3300046680 | Bacteria | 1383 |
| 479 | Ga0495658_0048287 | 3300046683 | Bacteria | 2399 |
| 480 | Ga0495658_0197922 | 3300046683 | Bacteria | 1251 |
| 481 | Ga0495613_0186969 | 3300046689 | Bacteria | 1465 |
| 482 | Ga0495624_0007741 | 3300046690 | Bacteria | 7535 |
| 483 | Ga0495624_0023332 | 3300046690 | Bacteria | 4081 |
| 484 | Ga0495624_0176625 | 3300046690 | Bacteria | 1302 |
| 485 | Ga0495589_0049015 | 3300046794 | Bacteria | 2090 |
| 486 | Ga0495600_0029214 | 3300046809 | Bacteria | 3569 |
| 487 | Ga0495600_0127598 | 3300046809 | Bacteria | 1654 |
| 488 | Ga0495600_0189449 | 3300046809 | Bacteria | 1323 |
| 489 | Ga0495600_0543175 | 3300046809 | Bacteria | 711 |
| 490 | Ga0495581_0003524 | 3300047315 | Bacteria | 8978 |
| 491 | Ga0495604_0000847 | 3300047317 | Bacteria | 25539 |
| 492 | Ga0495604_0181229 | 3300047317 | Bacteria | 1473 |
| 493 | Ga0495604_0189087 | 3300047317 | Bacteria | 1436 |
| 494 | Ga0495636_0309901 | 3300047318 | Bacteria | 740 |
| 495 | Ga0495674_0012370 | 3300047319 | Bacteria | 8039 |
| 496 | Ga0495674_0018066 | 3300047319 | Bacteria | 6564 |
| 497 | Ga0495674_0087433 | 3300047319 | Bacteria | 2667 |
| 498 | Ga0495674_0091756 | 3300047319 | Bacteria | 2594 |
| 499 | Ga0495674_0289421 | 3300047319 | Bacteria | 1340 |
| 500 | Ga0495674_0834111 | 3300047319 | Bacteria | 715 |
| 501 | Ga0495674_1153340 | 3300047319 | Bacteria | 588 |
| 502 | Ga0495676_0019590 | 3300047321 | Bacteria | 5949 |
| 503 | Ga0495676_0044097 | 3300047321 | Bacteria | 3644 |
| 504 | Ga0495676_0098224 | 3300047321 | Bacteria | 2173 |
| 505 | Ga0495680_0003362 | 3300047322 | Bacteria | 15797 |
| 506 | Ga0495680_0009330 | 3300047322 | Bacteria | 8838 |
| 507 | Ga0495680_0046273 | 3300047322 | Bacteria | 3431 |
| 508 | Ga0495680_0102466 | 3300047322 | Bacteria | 2131 |
| 509 | Ga0495680_0210767 | 3300047322 | Bacteria | 1391 |
| 510 | Ga0495680_0288440 | 3300047322 | Bacteria | 1155 |
| 511 | Ga0495675_0000137 | 3300047444 | Bacteria | 50947 |
| 512 | Ga0495675_0220882 | 3300047444 | Bacteria | 1147 |
| 513 | Ga0495675_0286259 | 3300047444 | Unclassified | 982 |
| 514 | Ga0495677_0081275 | 3300047445 | Bacteria | 1215 |
| 515 | Ga0495684_0022569 | 3300047471 | Bacteria | 4839 |
| 516 | Ga0495684_0025357 | 3300047471 | Bacteria | 4558 |
| 517 | Ga0495684_0026959 | 3300047471 | Bacteria | 4415 |
| 518 | Ga0495684_0043100 | 3300047471 | Bacteria | 3455 |
| 519 | Ga0495684_0118618 | 3300047471 | Bacteria | 1994 |
| 520 | Ga0495684_0120812 | 3300047471 | Bacteria | 1973 |
| 521 | Ga0495684_0191735 | 3300047471 | Bacteria | 1511 |
| 522 | Ga0495684_0227029 | 3300047471 | Bacteria | 1367 |
| 523 | Ga0495684_0552623 | 3300047471 | Bacteria | 784 |
| 524 | Ga0495593_0001553 | 3300047673 | Bacteria | 13534 |
| 525 | Ga0495593_0022548 | 3300047673 | Bacteria | 3507 |
| 526 | Ga0495602_0003800 | 3300048088 | Bacteria | 15695 |
| 527 | Ga0495602_0108840 | 3300048088 | Bacteria | 2256 |
| 528 | Ga0495602_0215065 | 3300048088 | Bacteria | 1455 |
| 529 | Ga0495602_0297614 | 3300048088 | Bacteria | 1182 |
| 530 | Ga0496100_0034608 | 3300048903 | Bacteria | 3171 |
| 531 | Ga0496101_0473622 | 3300048904 | Bacteria | 989 |
| 532 | Ga0496101_0941789 | 3300048904 | Bacteria | 680 |
| 533 | Ga0496102_0008326 | 3300048905 | Bacteria | 8882 |
| 534 | Ga0496102_0117360 | 3300048905 | Bacteria | 2483 |
| 535 | Ga0496103_0002930 | 3300048906 | Bacteria | 10569 |
| 536 | Ga0496103_0017357 | 3300048906 | Bacteria | 4307 |
| 537 | Ga0496103_0467888 | 3300048906 | Bacteria | 808 |
| 538 | Ga0496104_0000796 | 3300048907 | Bacteria | 27065 |
| 539 | Ga0496104_0068003 | 3300048907 | Bacteria | 3384 |
| 540 | Ga0496104_0075320 | 3300048907 | Bacteria | 3213 |
| 541 | Ga0496104_0129120 | 3300048907 | Bacteria | 2427 |
| 542 | Ga0496104_0144537 | 3300048907 | Bacteria | 2284 |
| 543 | Ga0496104_0307670 | 3300048907 | Bacteria | 1497 |
| 544 | Ga0496105_0005625 | 3300048908 | Bacteria | 9533 |
| 545 | Ga0496105_0010287 | 3300048908 | Bacteria | 7354 |
| 546 | Ga0496105_0041730 | 3300048908 | Bacteria | 3781 |
| 547 | Ga0496105_0095477 | 3300048908 | Bacteria | 2455 |
| 548 | Ga0496105_0279102 | 3300048908 | Bacteria | 1347 |
| 549 | Ga0496105_0391469 | 3300048908 | Bacteria | 1104 |
| 550 | Ga0496106_0001399 | 3300048909 | Bacteria | 18089 |
| 551 | Ga0496106_0033733 | 3300048909 | Bacteria | 3820 |
| 552 | Ga0496107_0000426 | 3300048910 | Bacteria | 22865 |
| 553 | Ga0496107_0155947 | 3300048910 | Bacteria | 1690 |
| 554 | Ga0496108_0117528 | 3300048911 | Bacteria | 2278 |
| 555 | Ga0496108_0174487 | 3300048911 | Bacteria | 1860 |
| 556 | Ga0496108_0211983 | 3300048911 | Bacteria | 1682 |
| 557 | Ga0496109_0002033 | 3300048912 | Bacteria | 16781 |
| 558 | Ga0496109_0060856 | 3300048912 | Bacteria | 3451 |
| 559 | Ga0496109_0073103 | 3300048912 | Bacteria | 3150 |
| 560 | Ga0496109_0246097 | 3300048912 | Bacteria | 1683 |
| 561 | Ga0496109_0571545 | 3300048912 | Bacteria | 1066 |
| 562 | Ga0496110_0035511 | 3300048913 | Bacteria | 4325 |
| 563 | Ga0496110_0426511 | 3300048913 | Bacteria | 1209 |
| 564 | Ga0496110_0546554 | 3300048913 | Bacteria | 1053 |
| 565 | Ga0496111_0030439 | 3300048914 | Bacteria | 3837 |
| 566 | Ga0496111_0212220 | 3300048914 | Bacteria | 1438 |
| 567 | Ga0496111_0388930 | 3300048914 | Bacteria | 1031 |
| 568 | Ga0496111_0403470 | 3300048914 | Bacteria | 1010 |
| 569 | Ga0496112_0013153 | 3300048915 | Bacteria | 7636 |
| 570 | Ga0496112_0013970 | 3300048915 | Bacteria | 7432 |
| 571 | Ga0496112_0123433 | 3300048915 | Bacteria | 2561 |
| 572 | Ga0496112_0294886 | 3300048915 | Bacteria | 1567 |
| 573 | Ga0496112_0335662 | 3300048915 | Bacteria | 1455 |
| 574 | Ga0496112_0406787 | 3300048915 | Bacteria | 1300 |
| 575 | Ga0496112_1254974 | 3300048915 | Bacteria | 657 |
| 576 | Ga0496112_1547786 | 3300048915 | Bacteria | 577 |
| 577 | Ga0496113_0102392 | 3300048916 | Bacteria | 2220 |
| 578 | Ga0496113_0194434 | 3300048916 | Bacteria | 1611 |
| 579 | Ga0496113_0236430 | 3300048916 | Bacteria | 1457 |
| 580 | Ga0496113_1148244 | 3300048916 | Bacteria | 608 |
| 581 | Ga0496114_0051067 | 3300048917 | Bacteria | 3442 |
| 582 | Ga0496114_0068794 | 3300048917 | Bacteria | 2973 |
| 583 | Ga0496114_0243469 | 3300048917 | Bacteria | 1582 |
| 584 | Ga0496115_0003499 | 3300048918 | Bacteria | 11289 |
| 585 | Ga0496115_0206057 | 3300048918 | Bacteria | 1624 |
| 586 | Ga0496115_0221175 | 3300048918 | Bacteria | 1562 |
| 587 | Ga0496115_0809884 | 3300048918 | Bacteria | 728 |
| 588 | Ga0501031_0001066 | 3300049568 | Bacteria | 16641 |
| 589 | Ga0501032_0005293 | 3300049569 | Bacteria | 9596 |
| 590 | Ga0501033_0002948 | 3300049570 | Bacteria | 14221 |
| 591 | Ga0501034_0073663 | 3300049571 | Bacteria | 3424 |
| 592 | Ga0501036_0000227 | 3300049572 | Bacteria | 37896 |
| 593 | Ga0501037_0000071 | 3300049573 | Bacteria | 94548 |
| 594 | Ga0501038_0002331 | 3300049574 | Bacteria | 17683 |
| 595 | Ga0501039_0000817 | 3300049575 | Bacteria | 22459 |
| 596 | Ga0501040_0000444 | 3300049576 | Bacteria | 24601 |
| 597 | Ga0501040_0621670 | 3300049576 | Bacteria | 780 |
| 598 | Ga0501041_0000836 | 3300049577 | Bacteria | 16532 |
| 599 | Ga0501042_0000314 | 3300049578 | Bacteria | 24226 |
| 600 | Ga0501042_0427123 | 3300049578 | Bacteria | 960 |
| 601 | Ga0501043_0000898 | 3300049579 | Bacteria | 26388 |
| 602 | Ga0501046_0000158 | 3300049580 | Bacteria | 70218 |
| 603 | Ga0501046_0270674 | 3300049580 | Bacteria | 1246 |
| 604 | Ga0501047_0004798 | 3300049581 | Bacteria | 12724 |
| 605 | Ga0501048_0002270 | 3300049582 | Bacteria | 14668 |
| 606 | Ga0501067_0128965 | 3300049583 | Bacteria | 1407 |
| 607 | Ga0501067_0396748 | 3300049583 | Bacteria | 769 |
| 608 | Ga0501068_0000071 | 3300049584 | Bacteria | 40485 |
| 609 | Ga0501069_0005870 | 3300049585 | Bacteria | 6396 |
| 610 | Ga0501069_0026069 | 3300049585 | Bacteria | 3200 |
| 611 | Ga0501070_0003160 | 3300049586 | Bacteria | 14326 |
| 612 | Ga0501070_0384456 | 3300049586 | Bacteria | 1137 |
| 613 | Ga0501071_0087510 | 3300049587 | Bacteria | 2285 |
| 614 | Ga0501071_0109694 | 3300049587 | Bacteria | 2039 |
| 615 | Ga0501072_0005409 | 3300049588 | Bacteria | 9723 |
| 616 | Ga0501072_0937709 | 3300049588 | Bacteria | 676 |
| 617 | Ga0501073_0181751 | 3300049589 | Bacteria | 1455 |
| 618 | Ga0501074_0000343 | 3300049590 | Bacteria | 27140 |
| 619 | Ga0501075_0005968 | 3300049591 | Bacteria | 8338 |
| 620 | Ga0501076_0000241 | 3300049592 | Bacteria | 33566 |
| 621 | Ga0501077_0003562 | 3300049593 | Bacteria | 9358 |
| 622 | Ga0501077_0287967 | 3300049593 | Bacteria | 1046 |
| 623 | Ga0501079_0001771 | 3300049741 | Bacteria | 15406 |
| 624 | Ga0501080_0000443 | 3300049742 | Bacteria | 32155 |
| 625 | Ga0501081_0019765 | 3300049743 | Bacteria | 4487 |
| 626 | Ga0501083_0003766 | 3300049744 | Bacteria | 10645 |
| 627 | Ga0501035_0000856 | 3300049822 | Bacteria | 32437 |
| 628 | Ga0501044_0041027 | 3300049823 | Bacteria | 4818 |
| 629 | Ga0501045_0008611 | 3300049824 | Bacteria | 7110 |
| 630 | Ga0501045_0452089 | 3300049824 | Bacteria | 955 |
| 631 | nmdc:mga05p37_735541_c1 | 3300050507 | Bacteria | 1090 |
| 632 | nmdc:mga06r32_1207448_c1 | 3300050510 | Bacteria | 702 |
| 633 | nmdc:mga08y16_16438_c1 | 3300050511 | Bacteria | 7781 |
| 634 | nmdc:mga0n895_731111_c1 | 3300050512 | Bacteria | 984 |
| 635 | nmdc:mga0n895_7837_c1 | 3300050512 | Bacteria | 9206 |
| 636 | nmdc:mga0n895_92559_c1 | 3300050512 | Bacteria | 3026 |
| 637 | nmdc:mga0rr50_88365_c1 | 3300050513 | Bacteria | 2407 |
| 638 | nmdc:mga08x19_100416_c1 | 3300050514 | Bacteria | 1919 |
| 639 | Ga0495601_0000659 | 3300053077 | Bacteria | 18407 |
| 640 | Ga0495601_0031959 | 3300053077 | Bacteria | 3274 |
| 641 | Ga0495601_0063206 | 3300053077 | Bacteria | 2353 |
| 642 | Ga0495601_0119269 | 3300053077 | Bacteria | 1712 |
| 643 | Ga0495601_0663415 | 3300053077 | Bacteria | 667 |
| 644 | Ga0495595_0002860 | 3300053084 | Bacteria | 6804 |
| 645 | Ga0495595_0040232 | 3300053084 | Bacteria | 2136 |
| 646 | Ga0495595_0062812 | 3300053084 | Bacteria | 1742 |
| 647 | Ga0495595_0076177 | 3300053084 | Bacteria | 1592 |
| 648 | Ga0495595_0166210 | 3300053084 | Bacteria | 1090 |
| 649 | Ga0495619_0001721 | 3300053085 | Bacteria | 14524 |
| 650 | Ga0495619_0024348 | 3300053085 | Bacteria | 3882 |
| 651 | Ga0495619_0028120 | 3300053085 | Bacteria | 3625 |
| 652 | Ga0495619_0057818 | 3300053085 | Bacteria | 2573 |
| 653 | Ga0495619_0240886 | 3300053085 | Bacteria | 1253 |
| 654 | Ga0501084_0000072 | 3300054114 | Bacteria | 75958 |
| 655 | Ga0501084_0377334 | 3300054114 | Bacteria | 1198 |
| 656 | Ga0590075_022267 | 3300059424 | Bacteria | 1585 |
| 657 | Ga0501082_0000605 | 3300060353 | Bacteria | 31641 |
| 658 | Ga0501082_0584063 | 3300060353 | Bacteria | 977 |
| 659 | Ga0466962_0004904 | 3300061719 | Bacteria | 6436 |
| 660 | Ga0466962_0013058 | 3300061719 | Bacteria | 3995 |
| 661 | Ga0466962_0017064 | 3300061719 | Bacteria | 3498 |
| 662 | Ga0466962_0120943 | 3300061719 | Bacteria | 1263 |
| 663 | Ga0530510_0003067 | 3300061734 | Bacteria | 11472 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005344 | Ga0070661_100291142 | Ga0070661_1002911422 | 129 |
| 2 | 3300035695 | Ga0373927_0899408 | Ga0373927_0899408_106_546 | 141 |
| 3 | 3300047317 | Ga0495604_0181229 | Ga0495604_0181229_38_478 | 141 |
| 4 | 3300048917 | Ga0496114_0243469 | Ga0496114_0243469_34_474 | 141 |
| 5 | 3300037418 | Ga0395900_1010819 | Ga0395900_1010819_44_481 | 143 |
| 6 | 3300013104 | Ga0157370_10012715 | Ga0157370_100127154 | 145 |
| 7 | 3300013105 | Ga0157369_10006695 | Ga0157369_100066955 | 145 |
| 8 | 3300037418 | Ga0395900_1329613 | Ga0395900_1329613_26_463 | 145 |
| 9 | 3300044712 | Ga0453684_2213223 | Ga0453684_2213223_81_536 | 145 |
| 10 | 3300045049 | Ga0466959_0548526 | Ga0466959_0548526_53_490 | 145 |
| 11 | 3300046463 | Ga0495653_0942294 | Ga0495653_0942294_44_490 | 145 |
| 12 | 3300046517 | Ga0495630_0409248 | Ga0495630_0409248_535_987 | 145 |
| 13 | 3300005329 | Ga0070683_100039772 | Ga0070683_1000397723 | 156 |
| 14 | 3300005336 | Ga0070680_100009628 | Ga0070680_1000096284 | 156 |
| 15 | 3300005337 | Ga0070682_100157395 | Ga0070682_1001573952 | 156 |
| 16 | 3300005339 | Ga0070660_100007385 | Ga0070660_1000073854 | 156 |
| 17 | 3300005366 | Ga0070659_100099627 | Ga0070659_1000996272 | 156 |
| 18 | 3300005458 | Ga0070681_10041652 | Ga0070681_100416523 | 156 |
| 19 | 3300005535 | Ga0070684_100093517 | Ga0070684_1000935172 | 156 |
| 20 | 3300005578 | Ga0068854_100117615 | Ga0068854_1001176153 | 156 |
| 21 | 3300005616 | Ga0068852_100641285 | Ga0068852_1006412852 | 156 |
| 22 | 3300013104 | Ga0157370_10329264 | Ga0157370_103292642 | 156 |
| 23 | 3300013307 | Ga0157372_10339683 | Ga0157372_103396832 | 156 |
| 24 | 3300014497 | Ga0182008_10465486 | Ga0182008_104654861 | 156 |
| 25 | 3300020082 | Ga0206353_11846493 | Ga0206353_118464933 | 156 |
| 26 | 3300025912 | Ga0207707_10127723 | Ga0207707_101277232 | 156 |
| 27 | 3300025917 | Ga0207660_10476337 | Ga0207660_104763372 | 156 |
| 28 | 3300025919 | Ga0207657_10026306 | Ga0207657_100263064 | 156 |
| 29 | 3300025932 | Ga0207690_10167134 | Ga0207690_101671342 | 156 |
| 30 | 3300025944 | Ga0207661_10143845 | Ga0207661_101438453 | 156 |
| 31 | 3300025981 | Ga0207640_10120690 | Ga0207640_101206903 | 156 |
| 32 | 3300044735 | Ga0466968_0297829 | Ga0466968_0297829_79_618 | 156 |
| 33 | 3300044842 | Ga0466957_0072586 | Ga0466957_0072586_910_1449 | 156 |
| 34 | 3300045976 | Ga0466967_0040758 | Ga0466967_0040758_3142_3681 | 156 |
| 35 | 3300045976 | Ga0466967_0351114 | Ga0466967_0351114_777_1316 | 156 |
| 36 | 3300006175 | Ga0070712_100005908 | Ga0070712_1000059083 | 157 |
| 37 | 3300048904 | Ga0496101_0473622 | Ga0496101_0473622_351_887 | 157 |
| 38 | 3300045976 | Ga0466967_0191441 | Ga0466967_0191441_1205_1744 | 160 |
| 39 | 3300005985 | Ga0081539_10026584 | Ga0081539_100265845 | 165 |
| 40 | 3300048907 | Ga0496104_0144537 | Ga0496104_0144537_417_935 | 165 |
| 41 | 3300009098 | Ga0105245_10301976 | Ga0105245_103019762 | 170 |
| 42 | 3300035692 | Ga0373935_0053915 | Ga0373935_0053915_827_1360 | 170 |
| 43 | 3300037466 | Ga0395898_0458695 | Ga0395898_0458695_210_728 | 170 |
| 44 | 3300038443 | Ga0395901_0448327 | Ga0395901_0448327_86_604 | 170 |
| 45 | 3300044693 | Ga0466961_0081301 | Ga0466961_0081301_779_1312 | 170 |
| 46 | 3300046517 | Ga0495630_0053750 | Ga0495630_0053750_978_1511 | 170 |
| 47 | 3300061719 | Ga0466962_0120943 | Ga0466962_0120943_622_1155 | 170 |
| 48 | 3300005327 | Ga0070658_10013374 | Ga0070658_100133746 | 172 |
| 49 | 3300005327 | Ga0070658_10021338 | Ga0070658_100213386 | 172 |
| 50 | 3300005329 | Ga0070683_100041387 | Ga0070683_1000413873 | 172 |
| 51 | 3300005336 | Ga0070680_100139973 | Ga0070680_1001399731 | 172 |
| 52 | 3300005337 | Ga0070682_100633466 | Ga0070682_1006334662 | 172 |
| 53 | 3300005339 | Ga0070660_100016180 | Ga0070660_1000161806 | 172 |
| 54 | 3300005339 | Ga0070660_100150697 | Ga0070660_1001506972 | 172 |
| 55 | 3300005340 | Ga0070689_100864543 | Ga0070689_1008645432 | 172 |
| 56 | 3300005344 | Ga0070661_100033902 | Ga0070661_1000339026 | 172 |
| 57 | 3300005366 | Ga0070659_100034400 | Ga0070659_1000344003 | 172 |
| 58 | 3300005366 | Ga0070659_100260698 | Ga0070659_1002606982 | 172 |
| 59 | 3300005434 | Ga0070709_10054490 | Ga0070709_100544904 | 172 |
| 60 | 3300005434 | Ga0070709_10193813 | Ga0070709_101938132 | 172 |
| 61 | 3300005434 | Ga0070709_10218145 | Ga0070709_102181452 | 172 |
| 62 | 3300005435 | Ga0070714_100001136 | Ga0070714_10000113612 | 172 |
| 63 | 3300005435 | Ga0070714_100002733 | Ga0070714_1000027332 | 172 |
| 64 | 3300005435 | Ga0070714_100022837 | Ga0070714_1000228375 | 172 |
| 65 | 3300005435 | Ga0070714_100026293 | Ga0070714_1000262935 | 172 |
| 66 | 3300005435 | Ga0070714_100034163 | Ga0070714_1000341633 | 172 |
| 67 | 3300005435 | Ga0070714_100047538 | Ga0070714_1000475383 | 172 |
| 68 | 3300005435 | Ga0070714_100097099 | Ga0070714_1000970992 | 172 |
| 69 | 3300005435 | Ga0070714_100251352 | Ga0070714_1002513522 | 172 |
| 70 | 3300005435 | Ga0070714_100348500 | Ga0070714_1003485002 | 172 |
| 71 | 3300005436 | Ga0070713_100015877 | Ga0070713_1000158772 | 172 |
| 72 | 3300005436 | Ga0070713_100046101 | Ga0070713_1000461014 | 172 |
| 73 | 3300005436 | Ga0070713_100093949 | Ga0070713_1000939494 | 172 |
| 74 | 3300005436 | Ga0070713_100146367 | Ga0070713_1001463671 | 172 |
| 75 | 3300005436 | Ga0070713_101153324 | Ga0070713_1011533241 | 172 |
| 76 | 3300005437 | Ga0070710_10046578 | Ga0070710_100465784 | 172 |
| 77 | 3300005439 | Ga0070711_100075027 | Ga0070711_1000750273 | 172 |
| 78 | 3300005439 | Ga0070711_100083627 | Ga0070711_1000836272 | 172 |
| 79 | 3300005444 | Ga0070694_100212933 | Ga0070694_1002129332 | 172 |
| 80 | 3300005445 | Ga0070708_100414365 | Ga0070708_1004143651 | 172 |
| 81 | 3300005445 | Ga0070708_100656789 | Ga0070708_1006567891 | 172 |
| 82 | 3300005445 | Ga0070708_101250811 | Ga0070708_1012508111 | 172 |
| 83 | 3300005458 | Ga0070681_10125168 | Ga0070681_101251684 | 172 |
| 84 | 3300005458 | Ga0070681_10166640 | Ga0070681_101666403 | 172 |
| 85 | 3300005466 | Ga0070685_10687025 | Ga0070685_106870252 | 172 |
| 86 | 3300005467 | Ga0070706_100143947 | Ga0070706_1001439472 | 172 |
| 87 | 3300005468 | Ga0070707_100006214 | Ga0070707_1000062146 | 172 |
| 88 | 3300005468 | Ga0070707_100281342 | Ga0070707_1002813422 | 172 |
| 89 | 3300005468 | Ga0070707_100286163 | Ga0070707_1002861632 | 172 |
| 90 | 3300005468 | Ga0070707_100477723 | Ga0070707_1004777232 | 172 |
| 91 | 3300005468 | Ga0070707_100935765 | Ga0070707_1009357651 | 172 |
| 92 | 3300005468 | Ga0070707_101370338 | Ga0070707_1013703381 | 172 |
| 93 | 3300005471 | Ga0070698_100073048 | Ga0070698_1000730486 | 172 |
| 94 | 3300005471 | Ga0070698_100103583 | Ga0070698_1001035832 | 172 |
| 95 | 3300005471 | Ga0070698_100130968 | Ga0070698_1001309684 | 172 |
| 96 | 3300005471 | Ga0070698_100151186 | Ga0070698_1001511862 | 172 |
| 97 | 3300005471 | Ga0070698_100213818 | Ga0070698_1002138183 | 172 |
| 98 | 3300005471 | Ga0070698_100863997 | Ga0070698_1008639971 | 172 |
| 99 | 3300005471 | Ga0070698_101159593 | Ga0070698_1011595931 | 172 |
| 100 | 3300005471 | Ga0070698_101313427 | Ga0070698_1013134271 | 172 |
| 101 | 3300005471 | Ga0070698_101538846 | Ga0070698_1015388461 | 172 |
| 102 | 3300005518 | Ga0070699_100807374 | Ga0070699_1008073741 | 172 |
| 103 | 3300005518 | Ga0070699_100973024 | Ga0070699_1009730242 | 172 |
| 104 | 3300005530 | Ga0070679_100060118 | Ga0070679_1000601182 | 172 |
| 105 | 3300005530 | Ga0070679_101343321 | Ga0070679_1013433211 | 172 |
| 106 | 3300005535 | Ga0070684_100469733 | Ga0070684_1004697332 | 172 |
| 107 | 3300005535 | Ga0070684_100949999 | Ga0070684_1009499991 | 172 |
| 108 | 3300005545 | Ga0070695_100000837 | Ga0070695_1000008376 | 172 |
| 109 | 3300005549 | Ga0070704_100105578 | Ga0070704_1001055783 | 172 |
| 110 | 3300005563 | Ga0068855_100137311 | Ga0068855_1001373114 | 172 |
| 111 | 3300005577 | Ga0068857_100003516 | Ga0068857_1000035166 | 172 |
| 112 | 3300005578 | Ga0068854_101030974 | Ga0068854_1010309742 | 172 |
| 113 | 3300005614 | Ga0068856_100706034 | Ga0068856_1007060342 | 172 |
| 114 | 3300005718 | Ga0068866_10270113 | Ga0068866_102701132 | 172 |
| 115 | 3300005842 | Ga0068858_100535538 | Ga0068858_1005355382 | 172 |
| 116 | 3300005937 | Ga0081455_10052759 | Ga0081455_100527594 | 172 |
| 117 | 3300005981 | Ga0081538_10228953 | Ga0081538_102289532 | 172 |
| 118 | 3300005985 | Ga0081539_10004223 | Ga0081539_1000422320 | 172 |
| 119 | 3300006028 | Ga0070717_10003257 | Ga0070717_1000325710 | 172 |
| 120 | 3300006028 | Ga0070717_10049174 | Ga0070717_100491745 | 172 |
| 121 | 3300006028 | Ga0070717_10052709 | Ga0070717_100527092 | 172 |
| 122 | 3300006028 | Ga0070717_10094099 | Ga0070717_100940992 | 172 |
| 123 | 3300006028 | Ga0070717_10118155 | Ga0070717_101181553 | 172 |
| 124 | 3300006028 | Ga0070717_10235391 | Ga0070717_102353912 | 172 |
| 125 | 3300006028 | Ga0070717_10440769 | Ga0070717_104407692 | 172 |
| 126 | 3300006163 | Ga0070715_10035614 | Ga0070715_100356143 | 172 |
| 127 | 3300006173 | Ga0070716_100023259 | Ga0070716_1000232595 | 172 |
| 128 | 3300006173 | Ga0070716_100058838 | Ga0070716_1000588383 | 172 |
| 129 | 3300006173 | Ga0070716_100131051 | Ga0070716_1001310512 | 172 |
| 130 | 3300006173 | Ga0070716_100272417 | Ga0070716_1002724172 | 172 |
| 131 | 3300006173 | Ga0070716_100763366 | Ga0070716_1007633662 | 172 |
| 132 | 3300006175 | Ga0070712_100084373 | Ga0070712_1000843733 | 172 |
| 133 | 3300006175 | Ga0070712_100135680 | Ga0070712_1001356801 | 172 |
| 134 | 3300006175 | Ga0070712_100248622 | Ga0070712_1002486222 | 172 |
| 135 | 3300006175 | Ga0070712_100822400 | Ga0070712_1008224002 | 172 |
| 136 | 3300006844 | Ga0075428_100752649 | Ga0075428_1007526492 | 172 |
| 137 | 3300006852 | Ga0075433_10805442 | Ga0075433_108054422 | 172 |
| 138 | 3300006871 | Ga0075434_100008573 | Ga0075434_10000857310 | 172 |
| 139 | 3300006871 | Ga0075434_100087644 | Ga0075434_1000876443 | 172 |
| 140 | 3300006914 | Ga0075436_100292172 | Ga0075436_1002921722 | 172 |
| 141 | 3300007076 | Ga0075435_100050921 | Ga0075435_1000509212 | 172 |
| 142 | 3300009093 | Ga0105240_10006843 | Ga0105240_100068436 | 172 |
| 143 | 3300009093 | Ga0105240_10056712 | Ga0105240_100567126 | 172 |
| 144 | 3300009094 | Ga0111539_10034378 | Ga0111539_100343782 | 172 |
| 145 | 3300009094 | Ga0111539_12048342 | Ga0111539_120483421 | 172 |
| 146 | 3300009147 | Ga0114129_11571449 | Ga0114129_115714492 | 172 |
| 147 | 3300009176 | Ga0105242_10660205 | Ga0105242_106602052 | 172 |
| 148 | 3300009176 | Ga0105242_10948365 | Ga0105242_109483652 | 172 |
| 149 | 3300009177 | Ga0105248_10550940 | Ga0105248_105509403 | 172 |
| 150 | 3300009545 | Ga0105237_10045015 | Ga0105237_100450155 | 172 |
| 151 | 3300009551 | Ga0105238_10194048 | Ga0105238_101940483 | 172 |
| 152 | 3300009551 | Ga0105238_11614995 | Ga0105238_116149951 | 172 |
| 153 | 3300010375 | Ga0105239_10276235 | Ga0105239_102762354 | 172 |
| 154 | 3300011119 | Ga0105246_10160502 | Ga0105246_101605023 | 172 |
| 155 | 3300013100 | Ga0157373_10151334 | Ga0157373_101513342 | 172 |
| 156 | 3300013105 | Ga0157369_10110889 | Ga0157369_101108892 | 172 |
| 157 | 3300013105 | Ga0157369_10208763 | Ga0157369_102087634 | 172 |
| 158 | 3300013307 | Ga0157372_10260460 | Ga0157372_102604603 | 172 |
| 159 | 3300013307 | Ga0157372_10931972 | Ga0157372_109319722 | 172 |
| 160 | 3300014326 | Ga0157380_11987019 | Ga0157380_119870191 | 172 |
| 161 | 3300014497 | Ga0182008_10042547 | Ga0182008_100425474 | 172 |
| 162 | 3300014497 | Ga0182008_10240388 | Ga0182008_102403881 | 172 |
| 163 | 3300020069 | Ga0197907_10281088 | Ga0197907_102810883 | 172 |
| 164 | 3300020070 | Ga0206356_10252104 | Ga0206356_102521042 | 172 |
| 165 | 3300020070 | Ga0206356_11592742 | Ga0206356_115927423 | 172 |
| 166 | 3300020081 | Ga0206354_11527074 | Ga0206354_115270743 | 172 |
| 167 | 3300025898 | Ga0207692_10054038 | Ga0207692_100540382 | 172 |
| 168 | 3300025906 | Ga0207699_10022264 | Ga0207699_100222644 | 172 |
| 169 | 3300025906 | Ga0207699_10254007 | Ga0207699_102540072 | 172 |
| 170 | 3300025906 | Ga0207699_10366390 | Ga0207699_103663902 | 172 |
| 171 | 3300025909 | Ga0207705_10027373 | Ga0207705_100273732 | 172 |
| 172 | 3300025909 | Ga0207705_10305657 | Ga0207705_103056572 | 172 |
| 173 | 3300025910 | Ga0207684_10336198 | Ga0207684_103361982 | 172 |
| 174 | 3300025910 | Ga0207684_10350231 | Ga0207684_103502312 | 172 |
| 175 | 3300025912 | Ga0207707_10027158 | Ga0207707_100271584 | 172 |
| 176 | 3300025912 | Ga0207707_10078401 | Ga0207707_100784012 | 172 |
| 177 | 3300025912 | Ga0207707_10222523 | Ga0207707_102225232 | 172 |
| 178 | 3300025912 | Ga0207707_10300755 | Ga0207707_103007553 | 172 |
| 179 | 3300025913 | Ga0207695_10015041 | Ga0207695_1001504111 | 172 |
| 180 | 3300025914 | Ga0207671_10190823 | Ga0207671_101908232 | 172 |
| 181 | 3300025915 | Ga0207693_10003767 | Ga0207693_1000376715 | 172 |
| 182 | 3300025915 | Ga0207693_10006329 | Ga0207693_1000632910 | 172 |
| 183 | 3300025915 | Ga0207693_10134215 | Ga0207693_101342153 | 172 |
| 184 | 3300025915 | Ga0207693_10321956 | Ga0207693_103219562 | 172 |
| 185 | 3300025915 | Ga0207693_10336880 | Ga0207693_103368802 | 172 |
| 186 | 3300025915 | Ga0207693_10471251 | Ga0207693_104712512 | 172 |
| 187 | 3300025916 | Ga0207663_10060745 | Ga0207663_100607454 | 172 |
| 188 | 3300025917 | Ga0207660_10130691 | Ga0207660_101306913 | 172 |
| 189 | 3300025917 | Ga0207660_10368621 | Ga0207660_103686212 | 172 |
| 190 | 3300025919 | Ga0207657_10001172 | Ga0207657_1000117232 | 172 |
| 191 | 3300025919 | Ga0207657_10015625 | Ga0207657_100156258 | 172 |
| 192 | 3300025920 | Ga0207649_10019214 | Ga0207649_100192146 | 172 |
| 193 | 3300025921 | Ga0207652_10036795 | Ga0207652_100367952 | 172 |
| 194 | 3300025921 | Ga0207652_10206122 | Ga0207652_102061223 | 172 |
| 195 | 3300025921 | Ga0207652_10340252 | Ga0207652_103402522 | 172 |
| 196 | 3300025921 | Ga0207652_10445981 | Ga0207652_104459812 | 172 |
| 197 | 3300025922 | Ga0207646_10000268 | Ga0207646_1000026865 | 172 |
| 198 | 3300025922 | Ga0207646_10319344 | Ga0207646_103193442 | 172 |
| 199 | 3300025922 | Ga0207646_10639599 | Ga0207646_106395992 | 172 |
| 200 | 3300025922 | Ga0207646_10906589 | Ga0207646_109065891 | 172 |
| 201 | 3300025924 | Ga0207694_10350218 | Ga0207694_103502183 | 172 |
| 202 | 3300025927 | Ga0207687_10206251 | Ga0207687_102062513 | 172 |
| 203 | 3300025928 | Ga0207700_10072094 | Ga0207700_100720944 | 172 |
| 204 | 3300025928 | Ga0207700_10073111 | Ga0207700_100731112 | 172 |
| 205 | 3300025928 | Ga0207700_10157989 | Ga0207700_101579892 | 172 |
| 206 | 3300025929 | Ga0207664_10061369 | Ga0207664_100613692 | 172 |
| 207 | 3300025929 | Ga0207664_10079909 | Ga0207664_100799093 | 172 |
| 208 | 3300025929 | Ga0207664_10080089 | Ga0207664_100800892 | 172 |
| 209 | 3300025929 | Ga0207664_10096964 | Ga0207664_100969643 | 172 |
| 210 | 3300025929 | Ga0207664_10127977 | Ga0207664_101279772 | 172 |
| 211 | 3300025929 | Ga0207664_10138740 | Ga0207664_101387403 | 172 |
| 212 | 3300025929 | Ga0207664_10352347 | Ga0207664_103523471 | 172 |
| 213 | 3300025929 | Ga0207664_10369386 | Ga0207664_103693861 | 172 |
| 214 | 3300025929 | Ga0207664_10374992 | Ga0207664_103749922 | 172 |
| 215 | 3300025929 | Ga0207664_10465682 | Ga0207664_104656822 | 172 |
| 216 | 3300025929 | Ga0207664_11269532 | Ga0207664_112695321 | 172 |
| 217 | 3300025932 | Ga0207690_10173067 | Ga0207690_101730673 | 172 |
| 218 | 3300025932 | Ga0207690_10237390 | Ga0207690_102373901 | 172 |
| 219 | 3300025934 | Ga0207686_10158992 | Ga0207686_101589922 | 172 |
| 220 | 3300025934 | Ga0207686_10902572 | Ga0207686_109025722 | 172 |
| 221 | 3300025936 | Ga0207670_10851369 | Ga0207670_108513691 | 172 |
| 222 | 3300025939 | Ga0207665_10002880 | Ga0207665_100028805 | 172 |
| 223 | 3300025939 | Ga0207665_10065656 | Ga0207665_100656563 | 172 |
| 224 | 3300025944 | Ga0207661_10161116 | Ga0207661_101611162 | 172 |
| 225 | 3300025945 | Ga0207679_10270882 | Ga0207679_102708822 | 172 |
| 226 | 3300025949 | Ga0207667_10133809 | Ga0207667_101338093 | 172 |
| 227 | 3300026078 | Ga0207702_10117913 | Ga0207702_101179133 | 172 |
| 228 | 3300026116 | Ga0207674_10004342 | Ga0207674_100043422 | 172 |
| 229 | 3300026121 | Ga0207683_10596407 | Ga0207683_105964072 | 172 |
| 230 | 3300028558 | Ga0265326_10034844 | Ga0265326_100348442 | 172 |
| 231 | 3300028558 | Ga0265326_10060100 | Ga0265326_100601001 | 172 |
| 232 | 3300028563 | Ga0265319_1001478 | Ga0265319_100147813 | 172 |
| 233 | 3300028563 | Ga0265319_1007290 | Ga0265319_10072904 | 172 |
| 234 | 3300028573 | Ga0265334_10000882 | Ga0265334_100008825 | 172 |
| 235 | 3300028573 | Ga0265334_10008358 | Ga0265334_100083584 | 172 |
| 236 | 3300028573 | Ga0265334_10031290 | Ga0265334_100312902 | 172 |
| 237 | 3300028577 | Ga0265318_10000530 | Ga0265318_1000053015 | 172 |
| 238 | 3300028577 | Ga0265318_10006013 | Ga0265318_100060133 | 172 |
| 239 | 3300028653 | Ga0265323_10059318 | Ga0265323_100593182 | 172 |
| 240 | 3300028654 | Ga0265322_10006239 | Ga0265322_100062394 | 172 |
| 241 | 3300028666 | Ga0265336_10020341 | Ga0265336_100203414 | 172 |
| 242 | 3300028800 | Ga0265338_10003899 | Ga0265338_1000389913 | 172 |
| 243 | 3300028800 | Ga0265338_10029121 | Ga0265338_100291217 | 172 |
| 244 | 3300028800 | Ga0265338_10035929 | Ga0265338_100359294 | 172 |
| 245 | 3300028800 | Ga0265338_10036613 | Ga0265338_100366137 | 172 |
| 246 | 3300029957 | Ga0265324_10021048 | Ga0265324_100210483 | 172 |
| 247 | 3300029957 | Ga0265324_10028859 | Ga0265324_100288593 | 172 |
| 248 | 3300029957 | Ga0265324_10086061 | Ga0265324_100860612 | 172 |
| 249 | 3300031235 | Ga0265330_10000639 | Ga0265330_1000063927 | 172 |
| 250 | 3300031235 | Ga0265330_10059201 | Ga0265330_100592012 | 172 |
| 251 | 3300031235 | Ga0265330_10088280 | Ga0265330_100882803 | 172 |
| 252 | 3300031238 | Ga0265332_10011930 | Ga0265332_100119305 | 172 |
| 253 | 3300031238 | Ga0265332_10146939 | Ga0265332_101469392 | 172 |
| 254 | 3300031239 | Ga0265328_10000260 | Ga0265328_1000026016 | 172 |
| 255 | 3300031240 | Ga0265320_10005160 | Ga0265320_1000516010 | 172 |
| 256 | 3300031240 | Ga0265320_10009679 | Ga0265320_100096797 | 172 |
| 257 | 3300031241 | Ga0265325_10005799 | Ga0265325_100057995 | 172 |
| 258 | 3300031241 | Ga0265325_10052415 | Ga0265325_100524151 | 172 |
| 259 | 3300031242 | Ga0265329_10000312 | Ga0265329_1000031224 | 172 |
| 260 | 3300031242 | Ga0265329_10013860 | Ga0265329_100138604 | 172 |
| 261 | 3300031247 | Ga0265340_10003471 | Ga0265340_100034714 | 172 |
| 262 | 3300031249 | Ga0265339_10004250 | Ga0265339_100042509 | 172 |
| 263 | 3300031249 | Ga0265339_10046850 | Ga0265339_100468502 | 172 |
| 264 | 3300031250 | Ga0265331_10006045 | Ga0265331_100060454 | 172 |
| 265 | 3300031250 | Ga0265331_10133259 | Ga0265331_101332592 | 172 |
| 266 | 3300031251 | Ga0265327_10002384 | Ga0265327_100023843 | 172 |
| 267 | 3300031251 | Ga0265327_10025465 | Ga0265327_100254655 | 172 |
| 268 | 3300031344 | Ga0265316_10017452 | Ga0265316_100174527 | 172 |
| 269 | 3300031344 | Ga0265316_10055780 | Ga0265316_100557802 | 172 |
| 270 | 3300031344 | Ga0265316_10100171 | Ga0265316_101001713 | 172 |
| 271 | 3300031344 | Ga0265316_10525086 | Ga0265316_105250861 | 172 |
| 272 | 3300031595 | Ga0265313_10006320 | Ga0265313_100063208 | 172 |
| 273 | 3300031595 | Ga0265313_10027719 | Ga0265313_100277194 | 172 |
| 274 | 3300031595 | Ga0265313_10069176 | Ga0265313_100691762 | 172 |
| 275 | 3300031595 | Ga0265313_10165789 | Ga0265313_101657892 | 172 |
| 276 | 3300031711 | Ga0265314_10004081 | Ga0265314_1000408114 | 172 |
| 277 | 3300031711 | Ga0265314_10021281 | Ga0265314_100212817 | 172 |
| 278 | 3300031712 | Ga0265342_10003116 | Ga0265342_100031165 | 172 |
| 279 | 3300032002 | Ga0307416_100077943 | Ga0307416_1000779433 | 172 |
| 280 | 3300035091 | Ga0373951_0042916 | Ga0373951_0042916_115_657 | 172 |
| 281 | 3300035116 | Ga0373945_0181461 | Ga0373945_0181461_254_793 | 172 |
| 282 | 3300035117 | Ga0373953_0129231 | Ga0373953_0129231_494_1036 | 172 |
| 283 | 3300035119 | Ga0373956_0060210 | Ga0373956_0060210_160_699 | 172 |
| 284 | 3300035120 | Ga0373957_0062019 | Ga0373957_0062019_312_902 | 172 |
| 285 | 3300035170 | Ga0373943_0006289 | Ga0373943_0006289_265_804 | 172 |
| 286 | 3300035171 | Ga0373946_0009153 | Ga0373946_0009153_1724_2263 | 172 |
| 287 | 3300035172 | Ga0373955_0277595 | Ga0373955_0277595_429_971 | 172 |
| 288 | 3300035207 | Ga0373942_0170404 | Ga0373942_0170404_106_648 | 172 |
| 289 | 3300035241 | Ga0373961_0045467 | Ga0373961_0045467_387_929 | 172 |
| 290 | 3300035410 | Ga0373924_0119261 | Ga0373924_0119261_560_1099 | 172 |
| 291 | 3300035691 | Ga0373931_0258338 | Ga0373931_0258338_94_636 | 172 |
| 292 | 3300035692 | Ga0373935_0008028 | Ga0373935_0008028_2386_2925 | 172 |
| 293 | 3300035692 | Ga0373935_0018888 | Ga0373935_0018888_2652_3194 | 172 |
| 294 | 3300035692 | Ga0373935_0344407 | Ga0373935_0344407_305_844 | 172 |
| 295 | 3300035725 | Ga0373947_0000125 | Ga0373947_0000125_13294_13833 | 172 |
| 296 | 3300036401 | Ga0373937_0001655 | Ga0373937_0001655_16995_17534 | 172 |
| 297 | 3300036401 | Ga0373937_0325306 | Ga0373937_0325306_446_973 | 172 |
| 298 | 3300036401 | Ga0373937_0553643 | Ga0373937_0553643_38_565 | 172 |
| 299 | 3300037068 | Ga0373925_0011706 | Ga0373925_0011706_4617_5156 | 172 |
| 300 | 3300037312 | Ga0395899_0072843 | Ga0395899_0072843_1897_2433 | 172 |
| 301 | 3300037418 | Ga0395900_0032016 | Ga0395900_0032016_4786_5337 | 172 |
| 302 | 3300037418 | Ga0395900_0064558 | Ga0395900_0064558_587_1117 | 172 |
| 303 | 3300037418 | Ga0395900_0615956 | Ga0395900_0615956_154_675 | 172 |
| 304 | 3300037418 | Ga0395900_0911724 | Ga0395900_0911724_205_741 | 172 |
| 305 | 3300037466 | Ga0395898_0043986 | Ga0395898_0043986_303_833 | 172 |
| 306 | 3300037466 | Ga0395898_0061347 | Ga0395898_0061347_17_544 | 172 |
| 307 | 3300037466 | Ga0395898_0217522 | Ga0395898_0217522_1173_1709 | 172 |
| 308 | 3300037466 | Ga0395898_0333920 | Ga0395898_0333920_681_1199 | 172 |
| 309 | 3300037466 | Ga0395898_0832588 | Ga0395898_0832588_122_652 | 172 |
| 310 | 3300037466 | Ga0395898_0946234 | Ga0395898_0946234_86_628 | 172 |
| 311 | 3300037471 | Ga0395905_0097411 | Ga0395905_0097411_1104_1640 | 172 |
| 312 | 3300037471 | Ga0395905_0106195 | Ga0395905_0106195_755_1285 | 172 |
| 313 | 3300037471 | Ga0395905_0157076 | Ga0395905_0157076_494_1024 | 172 |
| 314 | 3300037471 | Ga0395905_0189059 | Ga0395905_0189059_1048_1599 | 172 |
| 315 | 3300038443 | Ga0395901_0139498 | Ga0395901_0139498_37_576 | 172 |
| 316 | 3300038443 | Ga0395901_0177641 | Ga0395901_0177641_1405_1935 | 172 |
| 317 | 3300038443 | Ga0395901_0250201 | Ga0395901_0250201_779_1315 | 172 |
| 318 | 3300038443 | Ga0395901_0259428 | Ga0395901_0259428_170_691 | 172 |
| 319 | 3300038443 | Ga0395901_0260035 | Ga0395901_0260035_722_1264 | 172 |
| 320 | 3300038443 | Ga0395901_0271353 | Ga0395901_0271353_704_1234 | 172 |
| 321 | 3300038443 | Ga0395901_0706984 | Ga0395901_0706984_62_592 | 172 |
| 322 | 3300038443 | Ga0395901_0907139 | Ga0395901_0907139_276_815 | 172 |
| 323 | 3300038443 | Ga0395901_0915770 | Ga0395901_0915770_57_584 | 172 |
| 324 | 3300038443 | Ga0395901_1070703 | Ga0395901_1070703_195_713 | 172 |
| 325 | 3300039438 | Ga0436360_1019093 | Ga0436360_1019093_1044_1583 | 172 |
| 326 | 3300042005 | Ga0439448_0022099 | Ga0439448_0022099_850_1377 | 172 |
| 327 | 3300042005 | Ga0439448_0123607 | Ga0439448_0123607_303_845 | 172 |
| 328 | 3300042438 | Ga0439459_0132816 | Ga0439459_0132816_61_597 | 172 |
| 329 | 3300042876 | Ga0451577_0730390 | Ga0451577_0730390_308_841 | 172 |
| 330 | 3300044656 | Ga0466969_0176351 | Ga0466969_0176351_158_697 | 172 |
| 331 | 3300044656 | Ga0466969_0350520 | Ga0466969_0350520_45_587 | 172 |
| 332 | 3300044658 | Ga0466972_0075876 | Ga0466972_0075876_403_930 | 172 |
| 333 | 3300044683 | Ga0466965_0170179 | Ga0466965_0170179_224_766 | 172 |
| 334 | 3300044684 | Ga0466966_0005863 | Ga0466966_0005863_1030_1572 | 172 |
| 335 | 3300044693 | Ga0466961_0013026 | Ga0466961_0013026_26_571 | 172 |
| 336 | 3300044693 | Ga0466961_0063795 | Ga0466961_0063795_1723_2265 | 172 |
| 337 | 3300044693 | Ga0466961_0235262 | Ga0466961_0235262_213_824 | 172 |
| 338 | 3300044694 | Ga0466963_0000135 | Ga0466963_0000135_26542_27084 | 172 |
| 339 | 3300044694 | Ga0466963_0000185 | Ga0466963_0000185_15664_16275 | 172 |
| 340 | 3300044694 | Ga0466963_0003099 | Ga0466963_0003099_3189_3794 | 172 |
| 341 | 3300044694 | Ga0466963_0004811 | Ga0466963_0004811_4794_5336 | 172 |
| 342 | 3300044694 | Ga0466963_0011793 | Ga0466963_0011793_1510_2049 | 172 |
| 343 | 3300044694 | Ga0466963_0073659 | Ga0466963_0073659_819_1358 | 172 |
| 344 | 3300044694 | Ga0466963_0150423 | Ga0466963_0150423_639_1181 | 172 |
| 345 | 3300044694 | Ga0466963_0160835 | Ga0466963_0160835_949_1476 | 172 |
| 346 | 3300044694 | Ga0466963_0308276 | Ga0466963_0308276_118_660 | 172 |
| 347 | 3300044706 | Ga0466964_0000686 | Ga0466964_0000686_4776_5381 | 172 |
| 348 | 3300044706 | Ga0466964_0018299 | Ga0466964_0018299_1340_1879 | 172 |
| 349 | 3300044706 | Ga0466964_0088461 | Ga0466964_0088461_726_1253 | 172 |
| 350 | 3300044719 | Ga0466971_0016469 | Ga0466971_0016469_83_625 | 172 |
| 351 | 3300044719 | Ga0466971_0164405 | Ga0466971_0164405_397_939 | 172 |
| 352 | 3300044719 | Ga0466971_0237229 | Ga0466971_0237229_154_693 | 172 |
| 353 | 3300044719 | Ga0466971_0421935 | Ga0466971_0421935_12_557 | 172 |
| 354 | 3300044735 | Ga0466968_0030786 | Ga0466968_0030786_1099_1626 | 172 |
| 355 | 3300044735 | Ga0466968_0035090 | Ga0466968_0035090_169_780 | 172 |
| 356 | 3300044735 | Ga0466968_0381984 | Ga0466968_0381984_130_672 | 172 |
| 357 | 3300044842 | Ga0466957_0001309 | Ga0466957_0001309_9673_10284 | 172 |
| 358 | 3300044842 | Ga0466957_0020997 | Ga0466957_0020997_3254_3796 | 172 |
| 359 | 3300044842 | Ga0466957_0084573 | Ga0466957_0084573_772_1314 | 172 |
| 360 | 3300044842 | Ga0466957_0183886 | Ga0466957_0183886_319_924 | 172 |
| 361 | 3300044901 | Ga0466960_0011201 | Ga0466960_0011201_2835_3440 | 172 |
| 362 | 3300044901 | Ga0466960_0058882 | Ga0466960_0058882_856_1398 | 172 |
| 363 | 3300044901 | Ga0466960_0570051 | Ga0466960_0570051_73_612 | 172 |
| 364 | 3300045049 | Ga0466959_0047124 | Ga0466959_0047124_168_707 | 172 |
| 365 | 3300045049 | Ga0466959_0049465 | Ga0466959_0049465_1276_1818 | 172 |
| 366 | 3300045051 | Ga0451576_0755111 | Ga0451576_0755111_281_835 | 172 |
| 367 | 3300045836 | Ga0466958_0001421 | Ga0466958_0001421_6011_6622 | 172 |
| 368 | 3300045836 | Ga0466958_0003530 | Ga0466958_0003530_6350_6892 | 172 |
| 369 | 3300045836 | Ga0466958_0004915 | Ga0466958_0004915_2798_3340 | 172 |
| 370 | 3300045836 | Ga0466958_0029122 | Ga0466958_0029122_1769_2308 | 172 |
| 371 | 3300045836 | Ga0466958_0292036 | Ga0466958_0292036_74_616 | 172 |
| 372 | 3300045976 | Ga0466967_0000086 | Ga0466967_0000086_10469_10996 | 172 |
| 373 | 3300045976 | Ga0466967_0000886 | Ga0466967_0000886_677_1219 | 172 |
| 374 | 3300045976 | Ga0466967_0001422 | Ga0466967_0001422_6252_6779 | 172 |
| 375 | 3300045976 | Ga0466967_0005702 | Ga0466967_0005702_4301_4840 | 172 |
| 376 | 3300045976 | Ga0466967_0008784 | Ga0466967_0008784_6374_6985 | 172 |
| 377 | 3300045976 | Ga0466967_0017765 | Ga0466967_0017765_3168_3689 | 172 |
| 378 | 3300045976 | Ga0466967_0020328 | Ga0466967_0020328_2967_3506 | 172 |
| 379 | 3300045976 | Ga0466967_0050843 | Ga0466967_0050843_653_1195 | 172 |
| 380 | 3300045976 | Ga0466967_0053200 | Ga0466967_0053200_2034_2573 | 172 |
| 381 | 3300045976 | Ga0466967_0071889 | Ga0466967_0071889_689_1228 | 172 |
| 382 | 3300045976 | Ga0466967_0130011 | Ga0466967_0130011_1024_1566 | 172 |
| 383 | 3300045976 | Ga0466967_0208334 | Ga0466967_0208334_1093_1632 | 172 |
| 384 | 3300045976 | Ga0466967_0253301 | Ga0466967_0253301_221_760 | 172 |
| 385 | 3300045976 | Ga0466967_0274366 | Ga0466967_0274366_178_705 | 172 |
| 386 | 3300045976 | Ga0466967_0370454 | Ga0466967_0370454_793_1332 | 172 |
| 387 | 3300045976 | Ga0466967_0441011 | Ga0466967_0441011_181_786 | 172 |
| 388 | 3300046454 | Ga0495592_0000125 | Ga0495592_0000125_14880_15419 | 172 |
| 389 | 3300046454 | Ga0495592_0023488 | Ga0495592_0023488_1366_1905 | 172 |
| 390 | 3300046454 | Ga0495592_0036718 | Ga0495592_0036718_2938_3471 | 172 |
| 391 | 3300046454 | Ga0495592_0081922 | Ga0495592_0081922_609_1148 | 172 |
| 392 | 3300046454 | Ga0495592_0144468 | Ga0495592_0144468_125_652 | 172 |
| 393 | 3300046455 | Ga0495603_0006179 | Ga0495603_0006179_5565_6107 | 172 |
| 394 | 3300046455 | Ga0495603_0231423 | Ga0495603_0231423_391_930 | 172 |
| 395 | 3300046459 | Ga0495629_0236715 | Ga0495629_0236715_382_921 | 172 |
| 396 | 3300046461 | Ga0495641_0007350 | Ga0495641_0007350_142_681 | 172 |
| 397 | 3300046461 | Ga0495641_0032945 | Ga0495641_0032945_131_673 | 172 |
| 398 | 3300046461 | Ga0495641_0071515 | Ga0495641_0071515_77_616 | 172 |
| 399 | 3300046462 | Ga0495651_0000011 | Ga0495651_0000011_34539_35078 | 172 |
| 400 | 3300046462 | Ga0495651_0010221 | Ga0495651_0010221_1270_1809 | 172 |
| 401 | 3300046462 | Ga0495651_0025885 | Ga0495651_0025885_3713_4255 | 172 |
| 402 | 3300046463 | Ga0495653_0001602 | Ga0495653_0001602_429_968 | 172 |
| 403 | 3300046463 | Ga0495653_0029523 | Ga0495653_0029523_700_1239 | 172 |
| 404 | 3300046463 | Ga0495653_0039472 | Ga0495653_0039472_201_740 | 172 |
| 405 | 3300046463 | Ga0495653_0078647 | Ga0495653_0078647_1124_1714 | 172 |
| 406 | 3300046463 | Ga0495653_0206618 | Ga0495653_0206618_91_627 | 172 |
| 407 | 3300046463 | Ga0495653_0212174 | Ga0495653_0212174_297_830 | 172 |
| 408 | 3300046463 | Ga0495653_0421727 | Ga0495653_0421727_148_690 | 172 |
| 409 | 3300046473 | Ga0495582_0001075 | Ga0495582_0001075_12529_13068 | 172 |
| 410 | 3300046473 | Ga0495582_0033633 | Ga0495582_0033633_513_1055 | 172 |
| 411 | 3300046473 | Ga0495582_0078084 | Ga0495582_0078084_1020_1559 | 172 |
| 412 | 3300046475 | Ga0495639_0007680 | Ga0495639_0007680_4083_4622 | 172 |
| 413 | 3300046476 | Ga0495662_0003247 | Ga0495662_0003247_7117_7656 | 172 |
| 414 | 3300046477 | Ga0495664_0009793 | Ga0495664_0009793_4414_4953 | 172 |
| 415 | 3300046477 | Ga0495664_0064092 | Ga0495664_0064092_1218_1757 | 172 |
| 416 | 3300046492 | Ga0495585_0262591 | Ga0495585_0262591_90_629 | 172 |
| 417 | 3300046492 | Ga0495585_0294166 | Ga0495585_0294166_93_620 | 172 |
| 418 | 3300046499 | Ga0495594_0244607 | Ga0495594_0244607_330_872 | 172 |
| 419 | 3300046501 | Ga0495607_0054542 | Ga0495607_0054542_472_1011 | 172 |
| 420 | 3300046501 | Ga0495607_0140028 | Ga0495607_0140028_195_722 | 172 |
| 421 | 3300046511 | Ga0495608_0001526 | Ga0495608_0001526_3884_4423 | 172 |
| 422 | 3300046511 | Ga0495608_0010696 | Ga0495608_0010696_3484_4023 | 172 |
| 423 | 3300046511 | Ga0495608_0147827 | Ga0495608_0147827_100_639 | 172 |
| 424 | 3300046514 | Ga0495618_0011398 | Ga0495618_0011398_970_1509 | 172 |
| 425 | 3300046514 | Ga0495618_0016806 | Ga0495618_0016806_3630_4169 | 172 |
| 426 | 3300046514 | Ga0495618_0226276 | Ga0495618_0226276_457_990 | 172 |
| 427 | 3300046516 | Ga0495628_0000024 | Ga0495628_0000024_15174_15713 | 172 |
| 428 | 3300046516 | Ga0495628_0216592 | Ga0495628_0216592_76_609 | 172 |
| 429 | 3300046516 | Ga0495628_0507432 | Ga0495628_0507432_103_642 | 172 |
| 430 | 3300046517 | Ga0495630_0002944 | Ga0495630_0002944_560_1099 | 172 |
| 431 | 3300046517 | Ga0495630_0076050 | Ga0495630_0076050_1081_1620 | 172 |
| 432 | 3300046517 | Ga0495630_0105391 | Ga0495630_0105391_948_1481 | 172 |
| 433 | 3300046517 | Ga0495630_0127066 | Ga0495630_0127066_722_1258 | 172 |
| 434 | 3300046517 | Ga0495630_0137973 | Ga0495630_0137973_889_1428 | 172 |
| 435 | 3300046517 | Ga0495630_0221807 | Ga0495630_0221807_97_636 | 172 |
| 436 | 3300046517 | Ga0495630_0369302 | Ga0495630_0369302_35_568 | 172 |
| 437 | 3300046517 | Ga0495630_0386076 | Ga0495630_0386076_471_1004 | 172 |
| 438 | 3300046517 | Ga0495630_0393993 | Ga0495630_0393993_243_770 | 172 |
| 439 | 3300046523 | Ga0495644_0004460 | Ga0495644_0004460_2899_3438 | 172 |
| 440 | 3300046523 | Ga0495644_0036888 | Ga0495644_0036888_103_627 | 172 |
| 441 | 3300046526 | Ga0495666_0001078 | Ga0495666_0001078_12136_12675 | 172 |
| 442 | 3300046529 | Ga0495652_0000299 | Ga0495652_0000299_27166_27705 | 172 |
| 443 | 3300046529 | Ga0495652_0052430 | Ga0495652_0052430_1706_2245 | 172 |
| 444 | 3300046529 | Ga0495652_0084313 | Ga0495652_0084313_714_1253 | 172 |
| 445 | 3300046529 | Ga0495652_0200141 | Ga0495652_0200141_443_976 | 172 |
| 446 | 3300046529 | Ga0495652_0295584 | Ga0495652_0295584_371_913 | 172 |
| 447 | 3300046529 | Ga0495652_0756143 | Ga0495652_0756143_62_595 | 172 |
| 448 | 3300046531 | Ga0495665_0009951 | Ga0495665_0009951_393_932 | 172 |
| 449 | 3300046533 | Ga0495640_0010056 | Ga0495640_0010056_2054_2593 | 172 |
| 450 | 3300046533 | Ga0495640_0566594 | Ga0495640_0566594_109_651 | 172 |
| 451 | 3300046535 | Ga0495586_0004633 | Ga0495586_0004633_421_960 | 172 |
| 452 | 3300046536 | Ga0495587_0003192 | Ga0495587_0003192_3122_3661 | 172 |
| 453 | 3300046536 | Ga0495587_0004974 | Ga0495587_0004974_6939_7478 | 172 |
| 454 | 3300046536 | Ga0495587_0290182 | Ga0495587_0290182_114_641 | 172 |
| 455 | 3300046537 | Ga0495598_0145912 | Ga0495598_0145912_62_601 | 172 |
| 456 | 3300046538 | Ga0495609_0086090 | Ga0495609_0086090_556_1095 | 172 |
| 457 | 3300046543 | Ga0495645_0000035 | Ga0495645_0000035_53284_53823 | 172 |
| 458 | 3300046559 | Ga0495667_0021742 | Ga0495667_0021742_2897_3436 | 172 |
| 459 | 3300046559 | Ga0495667_0064029 | Ga0495667_0064029_1603_2139 | 172 |
| 460 | 3300046559 | Ga0495667_0123072 | Ga0495667_0123072_1092_1634 | 172 |
| 461 | 3300046559 | Ga0495667_0139928 | Ga0495667_0139928_429_962 | 172 |
| 462 | 3300046559 | Ga0495667_0166418 | Ga0495667_0166418_832_1371 | 172 |
| 463 | 3300046642 | Ga0495634_0038985 | Ga0495634_0038985_1521_2060 | 172 |
| 464 | 3300046642 | Ga0495634_0059891 | Ga0495634_0059891_712_1251 | 172 |
| 465 | 3300046642 | Ga0495634_0096301 | Ga0495634_0096301_1138_1677 | 172 |
| 466 | 3300046642 | Ga0495634_0156077 | Ga0495634_0156077_431_970 | 172 |
| 467 | 3300046663 | Ga0495635_0027023 | Ga0495635_0027023_809_1348 | 172 |
| 468 | 3300046663 | Ga0495635_0054681 | Ga0495635_0054681_1770_2309 | 172 |
| 469 | 3300046663 | Ga0495635_0086534 | Ga0495635_0086534_412_951 | 172 |
| 470 | 3300046663 | Ga0495635_0110600 | Ga0495635_0110600_605_1138 | 172 |
| 471 | 3300046663 | Ga0495635_0395642 | Ga0495635_0395642_115_648 | 172 |
| 472 | 3300046675 | Ga0495657_0053029 | Ga0495657_0053029_357_896 | 172 |
| 473 | 3300046675 | Ga0495657_0055510 | Ga0495657_0055510_1872_2411 | 172 |
| 474 | 3300046675 | Ga0495657_0068713 | Ga0495657_0068713_465_1007 | 172 |
| 475 | 3300046675 | Ga0495657_0134596 | Ga0495657_0134596_301_843 | 172 |
| 476 | 3300046675 | Ga0495657_0139952 | Ga0495657_0139952_750_1283 | 172 |
| 477 | 3300046675 | Ga0495657_0283496 | Ga0495657_0283496_414_956 | 172 |
| 478 | 3300046678 | Ga0495599_0000009 | Ga0495599_0000009_64464_65003 | 172 |
| 479 | 3300046678 | Ga0495599_0008788 | Ga0495599_0008788_4027_4566 | 172 |
| 480 | 3300046678 | Ga0495599_0040906 | Ga0495599_0040906_603_1136 | 172 |
| 481 | 3300046679 | Ga0495623_0000039 | Ga0495623_0000039_79378_79917 | 172 |
| 482 | 3300046679 | Ga0495623_0278295 | Ga0495623_0278295_267_809 | 172 |
| 483 | 3300046680 | Ga0495646_0135294 | Ga0495646_0135294_157_696 | 172 |
| 484 | 3300046683 | Ga0495658_0048287 | Ga0495658_0048287_880_1419 | 172 |
| 485 | 3300046683 | Ga0495658_0197922 | Ga0495658_0197922_30_572 | 172 |
| 486 | 3300046689 | Ga0495613_0186969 | Ga0495613_0186969_101_640 | 172 |
| 487 | 3300046690 | Ga0495624_0007741 | Ga0495624_0007741_6337_6876 | 172 |
| 488 | 3300046690 | Ga0495624_0023332 | Ga0495624_0023332_647_1186 | 172 |
| 489 | 3300046690 | Ga0495624_0176625 | Ga0495624_0176625_494_1033 | 172 |
| 490 | 3300046794 | Ga0495589_0049015 | Ga0495589_0049015_711_1250 | 172 |
| 491 | 3300046809 | Ga0495600_0029214 | Ga0495600_0029214_1453_1992 | 172 |
| 492 | 3300046809 | Ga0495600_0127598 | Ga0495600_0127598_498_1031 | 172 |
| 493 | 3300046809 | Ga0495600_0189449 | Ga0495600_0189449_50_589 | 172 |
| 494 | 3300046809 | Ga0495600_0543175 | Ga0495600_0543175_121_654 | 172 |
| 495 | 3300047315 | Ga0495581_0003524 | Ga0495581_0003524_4083_4622 | 172 |
| 496 | 3300047317 | Ga0495604_0000847 | Ga0495604_0000847_21117_21656 | 172 |
| 497 | 3300047317 | Ga0495604_0189087 | Ga0495604_0189087_312_902 | 172 |
| 498 | 3300047318 | Ga0495636_0309901 | Ga0495636_0309901_203_730 | 172 |
| 499 | 3300047319 | Ga0495674_0012370 | Ga0495674_0012370_946_1485 | 172 |
| 500 | 3300047319 | Ga0495674_0018066 | Ga0495674_0018066_5466_6005 | 172 |
| 501 | 3300047319 | Ga0495674_0087433 | Ga0495674_0087433_2022_2561 | 172 |
| 502 | 3300047319 | Ga0495674_0091756 | Ga0495674_0091756_1130_1663 | 172 |
| 503 | 3300047319 | Ga0495674_0289421 | Ga0495674_0289421_45_572 | 172 |
| 504 | 3300047319 | Ga0495674_0834111 | Ga0495674_0834111_44_583 | 172 |
| 505 | 3300047319 | Ga0495674_1153340 | Ga0495674_1153340_29_562 | 172 |
| 506 | 3300047321 | Ga0495676_0019590 | Ga0495676_0019590_4414_4953 | 172 |
| 507 | 3300047321 | Ga0495676_0044097 | Ga0495676_0044097_2009_2548 | 172 |
| 508 | 3300047321 | Ga0495676_0098224 | Ga0495676_0098224_764_1303 | 172 |
| 509 | 3300047322 | Ga0495680_0003362 | Ga0495680_0003362_9737_10276 | 172 |
| 510 | 3300047322 | Ga0495680_0009330 | Ga0495680_0009330_6148_6687 | 172 |
| 511 | 3300047322 | Ga0495680_0046273 | Ga0495680_0046273_1875_2417 | 172 |
| 512 | 3300047322 | Ga0495680_0102466 | Ga0495680_0102466_1178_1717 | 172 |
| 513 | 3300047322 | Ga0495680_0210767 | Ga0495680_0210767_793_1326 | 172 |
| 514 | 3300047322 | Ga0495680_0288440 | Ga0495680_0288440_128_661 | 172 |
| 515 | 3300047444 | Ga0495675_0000137 | Ga0495675_0000137_49336_49875 | 172 |
| 516 | 3300047444 | Ga0495675_0220882 | Ga0495675_0220882_419_958 | 172 |
| 517 | 3300047444 | Ga0495675_0286259 | Ga0495675_0286259_413_955 | 172 |
| 518 | 3300047445 | Ga0495677_0081275 | Ga0495677_0081275_493_1032 | 172 |
| 519 | 3300047471 | Ga0495684_0022569 | Ga0495684_0022569_1122_1661 | 172 |
| 520 | 3300047471 | Ga0495684_0025357 | Ga0495684_0025357_1641_2180 | 172 |
| 521 | 3300047471 | Ga0495684_0026959 | Ga0495684_0026959_3002_3544 | 172 |
| 522 | 3300047471 | Ga0495684_0043100 | Ga0495684_0043100_1800_2339 | 172 |
| 523 | 3300047471 | Ga0495684_0118618 | Ga0495684_0118618_102_644 | 172 |
| 524 | 3300047471 | Ga0495684_0120812 | Ga0495684_0120812_421_960 | 172 |
| 525 | 3300047471 | Ga0495684_0191735 | Ga0495684_0191735_394_927 | 172 |
| 526 | 3300047471 | Ga0495684_0227029 | Ga0495684_0227029_694_1227 | 172 |
| 527 | 3300047471 | Ga0495684_0552623 | Ga0495684_0552623_35_568 | 172 |
| 528 | 3300047673 | Ga0495593_0001553 | Ga0495593_0001553_1081_1620 | 172 |
| 529 | 3300047673 | Ga0495593_0022548 | Ga0495593_0022548_11_547 | 172 |
| 530 | 3300048088 | Ga0495602_0003800 | Ga0495602_0003800_7286_7825 | 172 |
| 531 | 3300048088 | Ga0495602_0108840 | Ga0495602_0108840_468_1010 | 172 |
| 532 | 3300048088 | Ga0495602_0215065 | Ga0495602_0215065_857_1396 | 172 |
| 533 | 3300048088 | Ga0495602_0297614 | Ga0495602_0297614_345_884 | 172 |
| 534 | 3300048903 | Ga0496100_0034608 | Ga0496100_0034608_411_953 | 172 |
| 535 | 3300048904 | Ga0496101_0941789 | Ga0496101_0941789_143_670 | 172 |
| 536 | 3300048905 | Ga0496102_0008326 | Ga0496102_0008326_4499_5038 | 172 |
| 537 | 3300048905 | Ga0496102_0117360 | Ga0496102_0117360_251_793 | 172 |
| 538 | 3300048906 | Ga0496103_0002930 | Ga0496103_0002930_1240_1779 | 172 |
| 539 | 3300048906 | Ga0496103_0017357 | Ga0496103_0017357_3624_4166 | 172 |
| 540 | 3300048906 | Ga0496103_0467888 | Ga0496103_0467888_145_678 | 172 |
| 541 | 3300048907 | Ga0496104_0000796 | Ga0496104_0000796_24325_24858 | 172 |
| 542 | 3300048907 | Ga0496104_0068003 | Ga0496104_0068003_1370_1909 | 172 |
| 543 | 3300048907 | Ga0496104_0075320 | Ga0496104_0075320_475_1017 | 172 |
| 544 | 3300048907 | Ga0496104_0129120 | Ga0496104_0129120_1095_1634 | 172 |
| 545 | 3300048907 | Ga0496104_0307670 | Ga0496104_0307670_475_1014 | 172 |
| 546 | 3300048908 | Ga0496105_0005625 | Ga0496105_0005625_3881_4420 | 172 |
| 547 | 3300048908 | Ga0496105_0010287 | Ga0496105_0010287_2809_3342 | 172 |
| 548 | 3300048908 | Ga0496105_0041730 | Ga0496105_0041730_417_956 | 172 |
| 549 | 3300048908 | Ga0496105_0095477 | Ga0496105_0095477_1557_2099 | 172 |
| 550 | 3300048908 | Ga0496105_0279102 | Ga0496105_0279102_478_1017 | 172 |
| 551 | 3300048908 | Ga0496105_0391469 | Ga0496105_0391469_519_1058 | 172 |
| 552 | 3300048909 | Ga0496106_0001399 | Ga0496106_0001399_8554_9087 | 172 |
| 553 | 3300048909 | Ga0496106_0033733 | Ga0496106_0033733_1988_2530 | 172 |
| 554 | 3300048910 | Ga0496107_0000426 | Ga0496107_0000426_16089_16622 | 172 |
| 555 | 3300048910 | Ga0496107_0155947 | Ga0496107_0155947_980_1522 | 172 |
| 556 | 3300048911 | Ga0496108_0117528 | Ga0496108_0117528_568_1110 | 172 |
| 557 | 3300048911 | Ga0496108_0174487 | Ga0496108_0174487_1224_1763 | 172 |
| 558 | 3300048911 | Ga0496108_0211983 | Ga0496108_0211983_917_1450 | 172 |
| 559 | 3300048912 | Ga0496109_0002033 | Ga0496109_0002033_1183_1722 | 172 |
| 560 | 3300048912 | Ga0496109_0060856 | Ga0496109_0060856_2691_3230 | 172 |
| 561 | 3300048912 | Ga0496109_0073103 | Ga0496109_0073103_2305_2847 | 172 |
| 562 | 3300048912 | Ga0496109_0246097 | Ga0496109_0246097_484_1023 | 172 |
| 563 | 3300048912 | Ga0496109_0571545 | Ga0496109_0571545_421_960 | 172 |
| 564 | 3300048913 | Ga0496110_0035511 | Ga0496110_0035511_1735_2277 | 172 |
| 565 | 3300048913 | Ga0496110_0426511 | Ga0496110_0426511_77_616 | 172 |
| 566 | 3300048913 | Ga0496110_0546554 | Ga0496110_0546554_217_750 | 172 |
| 567 | 3300048914 | Ga0496111_0030439 | Ga0496111_0030439_2255_2797 | 172 |
| 568 | 3300048914 | Ga0496111_0212220 | Ga0496111_0212220_873_1412 | 172 |
| 569 | 3300048914 | Ga0496111_0388930 | Ga0496111_0388930_169_717 | 172 |
| 570 | 3300048914 | Ga0496111_0403470 | Ga0496111_0403470_50_577 | 172 |
| 571 | 3300048915 | Ga0496112_0013153 | Ga0496112_0013153_5610_6146 | 172 |
| 572 | 3300048915 | Ga0496112_0013970 | Ga0496112_0013970_721_1254 | 172 |
| 573 | 3300048915 | Ga0496112_0123433 | Ga0496112_0123433_444_977 | 172 |
| 574 | 3300048915 | Ga0496112_0294886 | Ga0496112_0294886_562_1101 | 172 |
| 575 | 3300048915 | Ga0496112_0335662 | Ga0496112_0335662_562_1098 | 172 |
| 576 | 3300048915 | Ga0496112_0406787 | Ga0496112_0406787_135_668 | 172 |
| 577 | 3300048915 | Ga0496112_1254974 | Ga0496112_1254974_93_626 | 172 |
| 578 | 3300048915 | Ga0496112_1547786 | Ga0496112_1547786_16_555 | 172 |
| 579 | 3300048916 | Ga0496113_0102392 | Ga0496113_0102392_792_1331 | 172 |
| 580 | 3300048916 | Ga0496113_0194434 | Ga0496113_0194434_894_1433 | 172 |
| 581 | 3300048916 | Ga0496113_0236430 | Ga0496113_0236430_39_581 | 172 |
| 582 | 3300048916 | Ga0496113_1148244 | Ga0496113_1148244_52_588 | 172 |
| 583 | 3300048917 | Ga0496114_0051067 | Ga0496114_0051067_2698_3240 | 172 |
| 584 | 3300048917 | Ga0496114_0068794 | Ga0496114_0068794_566_1105 | 172 |
| 585 | 3300048918 | Ga0496115_0003499 | Ga0496115_0003499_4598_5137 | 172 |
| 586 | 3300048918 | Ga0496115_0206057 | Ga0496115_0206057_70_609 | 172 |
| 587 | 3300048918 | Ga0496115_0221175 | Ga0496115_0221175_47_589 | 172 |
| 588 | 3300048918 | Ga0496115_0809884 | Ga0496115_0809884_60_599 | 172 |
| 589 | 3300049568 | Ga0501031_0001066 | Ga0501031_0001066_1448_1990 | 172 |
| 590 | 3300049569 | Ga0501032_0005293 | Ga0501032_0005293_7879_8421 | 172 |
| 591 | 3300049570 | Ga0501033_0002948 | Ga0501033_0002948_3297_3839 | 172 |
| 592 | 3300049571 | Ga0501034_0073663 | Ga0501034_0073663_2471_3013 | 172 |
| 593 | 3300049572 | Ga0501036_0000227 | Ga0501036_0000227_31406_31948 | 172 |
| 594 | 3300049573 | Ga0501037_0000071 | Ga0501037_0000071_90369_90911 | 172 |
| 595 | 3300049574 | Ga0501038_0002331 | Ga0501038_0002331_15496_16038 | 172 |
| 596 | 3300049575 | Ga0501039_0000817 | Ga0501039_0000817_13378_13920 | 172 |
| 597 | 3300049576 | Ga0501040_0000444 | Ga0501040_0000444_17964_18506 | 172 |
| 598 | 3300049576 | Ga0501040_0621670 | Ga0501040_0621670_176_715 | 172 |
| 599 | 3300049577 | Ga0501041_0000836 | Ga0501041_0000836_8178_8720 | 172 |
| 600 | 3300049578 | Ga0501042_0000314 | Ga0501042_0000314_8366_8908 | 172 |
| 601 | 3300049578 | Ga0501042_0427123 | Ga0501042_0427123_257_796 | 172 |
| 602 | 3300049579 | Ga0501043_0000898 | Ga0501043_0000898_2025_2567 | 172 |
| 603 | 3300049580 | Ga0501046_0000158 | Ga0501046_0000158_29490_30032 | 172 |
| 604 | 3300049580 | Ga0501046_0270674 | Ga0501046_0270674_651_1190 | 172 |
| 605 | 3300049581 | Ga0501047_0004798 | Ga0501047_0004798_3169_3711 | 172 |
| 606 | 3300049582 | Ga0501048_0002270 | Ga0501048_0002270_8178_8720 | 172 |
| 607 | 3300049583 | Ga0501067_0128965 | Ga0501067_0128965_741_1280 | 172 |
| 608 | 3300049583 | Ga0501067_0396748 | Ga0501067_0396748_138_665 | 172 |
| 609 | 3300049584 | Ga0501068_0000071 | Ga0501068_0000071_36593_37135 | 172 |
| 610 | 3300049585 | Ga0501069_0005870 | Ga0501069_0005870_963_1502 | 172 |
| 611 | 3300049585 | Ga0501069_0026069 | Ga0501069_0026069_2486_3028 | 172 |
| 612 | 3300049586 | Ga0501070_0003160 | Ga0501070_0003160_2540_3082 | 172 |
| 613 | 3300049586 | Ga0501070_0384456 | Ga0501070_0384456_399_938 | 172 |
| 614 | 3300049587 | Ga0501071_0087510 | Ga0501071_0087510_226_768 | 172 |
| 615 | 3300049587 | Ga0501071_0109694 | Ga0501071_0109694_861_1403 | 172 |
| 616 | 3300049588 | Ga0501072_0005409 | Ga0501072_0005409_2773_3315 | 172 |
| 617 | 3300049588 | Ga0501072_0937709 | Ga0501072_0937709_34_576 | 172 |
| 618 | 3300049589 | Ga0501073_0181751 | Ga0501073_0181751_898_1440 | 172 |
| 619 | 3300049590 | Ga0501074_0000343 | Ga0501074_0000343_14521_15063 | 172 |
| 620 | 3300049591 | Ga0501075_0005968 | Ga0501075_0005968_505_1047 | 172 |
| 621 | 3300049592 | Ga0501076_0000241 | Ga0501076_0000241_29494_30036 | 172 |
| 622 | 3300049593 | Ga0501077_0003562 | Ga0501077_0003562_8440_8982 | 172 |
| 623 | 3300049593 | Ga0501077_0287967 | Ga0501077_0287967_137_676 | 172 |
| 624 | 3300049741 | Ga0501079_0001771 | Ga0501079_0001771_12206_12748 | 172 |
| 625 | 3300049742 | Ga0501080_0000443 | Ga0501080_0000443_4524_5066 | 172 |
| 626 | 3300049743 | Ga0501081_0019765 | Ga0501081_0019765_614_1156 | 172 |
| 627 | 3300049744 | Ga0501083_0003766 | Ga0501083_0003766_6799_7341 | 172 |
| 628 | 3300049822 | Ga0501035_0000856 | Ga0501035_0000856_2101_2643 | 172 |
| 629 | 3300049823 | Ga0501044_0041027 | Ga0501044_0041027_677_1219 | 172 |
| 630 | 3300049824 | Ga0501045_0008611 | Ga0501045_0008611_5051_5593 | 172 |
| 631 | 3300049824 | Ga0501045_0452089 | Ga0501045_0452089_43_582 | 172 |
| 632 | 3300050507 | nmdc:mga05p37_735541_c1 | nmdc:mga05p37_735541_c1_516_1055 | 172 |
| 633 | 3300050510 | nmdc:mga06r32_1207448_c1 | nmdc:mga06r32_1207448_c1_105_638 | 172 |
| 634 | 3300050511 | nmdc:mga08y16_16438_c1 | nmdc:mga08y16_16438_c1_5706_6278 | 172 |
| 635 | 3300050512 | nmdc:mga0n895_731111_c1 | nmdc:mga0n895_731111_c1_321_854 | 172 |
| 636 | 3300050512 | nmdc:mga0n895_7837_c1 | nmdc:mga0n895_7837_c1_7286_7825 | 172 |
| 637 | 3300050512 | nmdc:mga0n895_92559_c1 | nmdc:mga0n895_92559_c1_136_672 | 172 |
| 638 | 3300050513 | nmdc:mga0rr50_88365_c1 | nmdc:mga0rr50_88365_c1_1150_1689 | 172 |
| 639 | 3300050514 | nmdc:mga08x19_100416_c1 | nmdc:mga08x19_100416_c1_385_924 | 172 |
| 640 | 3300053077 | Ga0495601_0000659 | Ga0495601_0000659_709_1248 | 172 |
| 641 | 3300053077 | Ga0495601_0031959 | Ga0495601_0031959_2463_2996 | 172 |
| 642 | 3300053077 | Ga0495601_0063206 | Ga0495601_0063206_1536_2069 | 172 |
| 643 | 3300053077 | Ga0495601_0119269 | Ga0495601_0119269_469_1008 | 172 |
| 644 | 3300053077 | Ga0495601_0663415 | Ga0495601_0663415_65_592 | 172 |
| 645 | 3300053084 | Ga0495595_0002860 | Ga0495595_0002860_4333_4872 | 172 |
| 646 | 3300053084 | Ga0495595_0040232 | Ga0495595_0040232_865_1407 | 172 |
| 647 | 3300053084 | Ga0495595_0062812 | Ga0495595_0062812_697_1236 | 172 |
| 648 | 3300053084 | Ga0495595_0076177 | Ga0495595_0076177_312_845 | 172 |
| 649 | 3300053084 | Ga0495595_0166210 | Ga0495595_0166210_435_1001 | 172 |
| 650 | 3300053085 | Ga0495619_0001721 | Ga0495619_0001721_1962_2501 | 172 |
| 651 | 3300053085 | Ga0495619_0024348 | Ga0495619_0024348_2352_2891 | 172 |
| 652 | 3300053085 | Ga0495619_0028120 | Ga0495619_0028120_2731_3264 | 172 |
| 653 | 3300053085 | Ga0495619_0057818 | Ga0495619_0057818_420_959 | 172 |
| 654 | 3300053085 | Ga0495619_0240886 | Ga0495619_0240886_47_589 | 172 |
| 655 | 3300054114 | Ga0501084_0000072 | Ga0501084_0000072_68125_68667 | 172 |
| 656 | 3300054114 | Ga0501084_0377334 | Ga0501084_0377334_429_968 | 172 |
| 657 | 3300059424 | Ga0590075_022267 | Ga0590075_022267_666_1208 | 172 |
| 658 | 3300060353 | Ga0501082_0000605 | Ga0501082_0000605_15673_16215 | 172 |
| 659 | 3300060353 | Ga0501082_0584063 | Ga0501082_0584063_312_851 | 172 |
| 660 | 3300061719 | Ga0466962_0004904 | Ga0466962_0004904_4097_4639 | 172 |
| 661 | 3300061719 | Ga0466962_0013058 | Ga0466962_0013058_1403_1945 | 172 |
| 662 | 3300061719 | Ga0466962_0017064 | Ga0466962_0017064_572_1183 | 172 |
| 663 | 3300061734 | Ga0530510_0003067 | Ga0530510_0003067_676_1218 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m1c-assembly1.cif.gz_A | crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions | 0.9243 | 1 | 170 |
| 3p9n-assembly1.cif.gz_A | rv2966c of m. tuberculosis is a rsmd-like methyltransferase | 0.9209 | 1 | 171 |
| 3p9n-assembly1.cif.gz_A | rv2966c of m. tuberculosis is a rsmd-like methyltransferase | 0.9106 | 1 | 171 |
| 6m1c-assembly1.cif.gz_A | crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions | 0.9089 | 1 | 170 |
| 2esr-assembly1.cif.gz_B | conserved hypothetical protein- streptococcus pyogenes | 0.9003 | 29 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6aieC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9179 | 1 | 170 | 3.40.50.150 |
| af_A0A1D6EFY7_537_616_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9047 | 37 | 102 | 3.40.50.150 |
| 6aieC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9025 | 1 | 170 | 3.40.50.150 |
| af_Q2FZF6_1_156_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9012 | 25 | 171 | 3.40.50.150 |
| af_A0A0R0EHR2_116_316_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9003 | 1 | 172 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9EHG4-F1-model_v4 | RsmD family RNA methyltransferase | 0.9903 | 33 | 172 |
GO:0008168
GO:0031167 |
| AF-A0A538IHI6-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) | 0.98 | 1 | 171 |
GO:0003676
GO:0052913 |
| AF-A0A2V6IS55-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD | 0.9695 | 1 | 102 |
GO:0008168
GO:0031167 |
| AF-A0A538AEX8-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) | 0.9694 | 1 | 171 |
GO:0003676
GO:0052913 |
| AF-A0A538IHI6-F1-model_v4 | 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) | 0.9688 | 1 | 171 |
GO:0003676
GO:0052913 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar