F473573

General Info

Members Datasets Scaffolds Average Seq Length
663 272 663 178

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0235262|Ga0466961_0235262_213_824
Length 203
Sequence MALRVIAGSRKGHKLAAPRGHDTRPTSDRVRENIFNLVGPVDGARVLDLFAGSGALGIEALSRGATSAVFVERDPDAVRTIERNLDKLRLTGARVVHGDVLHAIAQEATAGAKYDLVLVDPPYGMLNDIQSRLARHLPLLLAANGLLVVETDARTEPELGLTIRTSRKYGQTRVTLFEAGGLGPTEPPGSGGAGVYGAGAGNP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.75
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10013374 3300005327 Bacteria 6584
2 Ga0070658_10021338 3300005327 Bacteria 5191
3 Ga0070683_100039772 3300005329 Bacteria 4319
4 Ga0070683_100041387 3300005329 Bacteria 4238
5 Ga0070680_100009628 3300005336 Bacteria 7429
6 Ga0070680_100139973 3300005336 Bacteria 2029
7 Ga0070682_100157395 3300005337 Bacteria 1565
8 Ga0070682_100633466 3300005337 Bacteria 849
9 Ga0070660_100007385 3300005339 Bacteria 7656
10 Ga0070660_100016180 3300005339 Bacteria 5408
11 Ga0070660_100150697 3300005339 Bacteria 1869
12 Ga0070689_100864543 3300005340 Bacteria 798
13 Ga0070661_100033902 3300005344 Bacteria 3701
14 Ga0070661_100291142 3300005344 Bacteria 1269
15 Ga0070659_100034400 3300005366 Bacteria 3941
16 Ga0070659_100099627 3300005366 Bacteria 2338
17 Ga0070659_100260698 3300005366 Bacteria 1438
18 Ga0070709_10054490 3300005434 Bacteria 2521
19 Ga0070709_10193813 3300005434 Bacteria 1435
20 Ga0070709_10218145 3300005434 Bacteria 1359
21 Ga0070714_100001136 3300005435 Bacteria 19099
22 Ga0070714_100002733 3300005435 Bacteria 13002
23 Ga0070714_100022837 3300005435 Bacteria 5133
24 Ga0070714_100026293 3300005435 Bacteria 4809
25 Ga0070714_100034163 3300005435 Bacteria 4257
26 Ga0070714_100047538 3300005435 Bacteria 3646
27 Ga0070714_100097099 3300005435 Bacteria 2589
28 Ga0070714_100251352 3300005435 Bacteria 1635
29 Ga0070714_100348500 3300005435 Bacteria 1390
30 Ga0070713_100015877 3300005436 Bacteria 5645
31 Ga0070713_100046101 3300005436 Bacteria 3575
32 Ga0070713_100093949 3300005436 Bacteria 2585
33 Ga0070713_100146367 3300005436 Bacteria 2097
34 Ga0070713_101153324 3300005436 Bacteria 750
35 Ga0070710_10046578 3300005437 Bacteria 2415
36 Ga0070711_100075027 3300005439 Bacteria 2393
37 Ga0070711_100083627 3300005439 Bacteria 2281
38 Ga0070694_100212933 3300005444 Bacteria 1446
39 Ga0070708_100414365 3300005445 Bacteria 1270
40 Ga0070708_100656789 3300005445 Bacteria 988
41 Ga0070708_101250811 3300005445 Bacteria 694
42 Ga0070681_10041652 3300005458 Bacteria 4603
43 Ga0070681_10125168 3300005458 Bacteria 2503
44 Ga0070681_10166640 3300005458 Bacteria 2126
45 Ga0070685_10687025 3300005466 Bacteria 745
46 Ga0070706_100143947 3300005467 Bacteria 2226
47 Ga0070707_100006214 3300005468 Bacteria 11123
48 Ga0070707_100281342 3300005468 Bacteria 1617
49 Ga0070707_100286163 3300005468 Bacteria 1602
50 Ga0070707_100477723 3300005468 Bacteria 1208
51 Ga0070707_100935765 3300005468 Bacteria 831
52 Ga0070707_101370338 3300005468 Bacteria 674
53 Ga0070698_100073048 3300005471 Bacteria 3437
54 Ga0070698_100103583 3300005471 Bacteria 2816
55 Ga0070698_100130968 3300005471 Bacteria 2463
56 Ga0070698_100151186 3300005471 Bacteria 2269
57 Ga0070698_100213818 3300005471 Bacteria 1862
58 Ga0070698_100863997 3300005471 Bacteria 850
59 Ga0070698_101159593 3300005471 Bacteria 722
60 Ga0070698_101313427 3300005471 Bacteria 673
61 Ga0070698_101538846 3300005471 Bacteria 617
62 Ga0070699_100807374 3300005518 Bacteria 859
63 Ga0070699_100973024 3300005518 Bacteria 778
64 Ga0070679_100060118 3300005530 Bacteria 3787
65 Ga0070679_101343321 3300005530 Bacteria 661
66 Ga0070684_100093517 3300005535 Bacteria 2676
67 Ga0070684_100469733 3300005535 Bacteria 1163
68 Ga0070684_100949999 3300005535 Bacteria 806
69 Ga0070695_100000837 3300005545 Bacteria 16613
70 Ga0070704_100105578 3300005549 Bacteria 2133
71 Ga0068855_100137311 3300005563 Bacteria 2789
72 Ga0068857_100003516 3300005577 Bacteria 13090
73 Ga0068854_100117615 3300005578 Bacteria 2013
74 Ga0068854_101030974 3300005578 Bacteria 730
75 Ga0068856_100706034 3300005614 Bacteria 1029
76 Ga0068852_100641285 3300005616 Bacteria 1069
77 Ga0068866_10270113 3300005718 Bacteria 1049
78 Ga0068858_100535538 3300005842 Bacteria 1133
79 Ga0081455_10052759 3300005937 Bacteria 3478
80 Ga0081538_10228953 3300005981 Bacteria 728
81 Ga0081539_10004223 3300005985 Bacteria 16177
82 Ga0081539_10026584 3300005985 Bacteria 3688
83 Ga0070717_10003257 3300006028 Bacteria 11608
84 Ga0070717_10049174 3300006028 Bacteria 3461
85 Ga0070717_10052709 3300006028 Bacteria 3352
86 Ga0070717_10094099 3300006028 Bacteria 2534
87 Ga0070717_10118155 3300006028 Bacteria 2269
88 Ga0070717_10235391 3300006028 Bacteria 1613
89 Ga0070717_10440769 3300006028 Bacteria 1173
90 Ga0070715_10035614 3300006163 Bacteria 2048
91 Ga0070716_100023259 3300006173 Bacteria 3283
92 Ga0070716_100058838 3300006173 Bacteria 2213
93 Ga0070716_100131051 3300006173 Bacteria 1585
94 Ga0070716_100272417 3300006173 Bacteria 1164
95 Ga0070716_100763366 3300006173 Bacteria 745
96 Ga0070712_100005908 3300006175 Bacteria 7573
97 Ga0070712_100084373 3300006175 Bacteria 2309
98 Ga0070712_100135680 3300006175 Bacteria 1871
99 Ga0070712_100248622 3300006175 Bacteria 1420
100 Ga0070712_100822400 3300006175 Bacteria 798
101 Ga0075428_100752649 3300006844 Bacteria 1037
102 Ga0075433_10805442 3300006852 Bacteria 821
103 Ga0075434_100008573 3300006871 Bacteria 9510
104 Ga0075434_100087644 3300006871 Bacteria 3114
105 Ga0075436_100292172 3300006914 Bacteria 1167
106 Ga0075435_100050921 3300007076 Bacteria 3334
107 Ga0105240_10006843 3300009093 Bacteria 16668
108 Ga0105240_10056712 3300009093 Bacteria 4900
109 Ga0111539_10034378 3300009094 Bacteria 6147
110 Ga0111539_12048342 3300009094 Bacteria 664
111 Ga0105245_10301976 3300009098 Bacteria 1571
112 Ga0114129_11571449 3300009147 Bacteria 806
113 Ga0105242_10660205 3300009176 Bacteria 1018
114 Ga0105242_10948365 3300009176 Bacteria 864
115 Ga0105248_10550940 3300009177 Bacteria 1301
116 Ga0105237_10045015 3300009545 Bacteria 4443
117 Ga0105238_10194048 3300009551 Bacteria 2006
118 Ga0105238_11614995 3300009551 Bacteria 678
119 Ga0105239_10276235 3300010375 Bacteria 1890
120 Ga0105246_10160502 3300011119 Bacteria 1712
121 Ga0157373_10151334 3300013100 Bacteria 1632
122 Ga0157370_10012715 3300013104 Bacteria 8711
123 Ga0157370_10329264 3300013104 Bacteria 1408
124 Ga0157369_10006695 3300013105 Bacteria 13309
125 Ga0157369_10110889 3300013105 Bacteria 2916
126 Ga0157369_10208763 3300013105 Bacteria 2048
127 Ga0157372_10260460 3300013307 Bacteria 2014
128 Ga0157372_10339683 3300013307 Bacteria 1749
129 Ga0157372_10931972 3300013307 Bacteria 1007
130 Ga0157380_11987019 3300014326 Bacteria 643
131 Ga0182008_10042547 3300014497 Bacteria 2263
132 Ga0182008_10240388 3300014497 Bacteria 931
133 Ga0182008_10465486 3300014497 Bacteria 690
134 Ga0197907_10281088 3300020069 Bacteria 3428
135 Ga0206356_10252104 3300020070 Bacteria 1413
136 Ga0206356_11592742 3300020070 Bacteria 1653
137 Ga0206354_11527074 3300020081 Bacteria 1795
138 Ga0206353_11846493 3300020082 Bacteria 4093
139 Ga0207692_10054038 3300025898 Bacteria 2048
140 Ga0207699_10022264 3300025906 Bacteria 3431
141 Ga0207699_10254007 3300025906 Bacteria 1212
142 Ga0207699_10366390 3300025906 Bacteria 1020
143 Ga0207705_10027373 3300025909 Bacteria 4066
144 Ga0207705_10305657 3300025909 Bacteria 1220
145 Ga0207684_10336198 3300025910 Bacteria 1301
146 Ga0207684_10350231 3300025910 Bacteria 1271
147 Ga0207707_10027158 3300025912 Bacteria 5005
148 Ga0207707_10078401 3300025912 Bacteria 2885
149 Ga0207707_10127723 3300025912 Bacteria 2223
150 Ga0207707_10222523 3300025912 Bacteria 1643
151 Ga0207707_10300755 3300025912 Bacteria 1387
152 Ga0207695_10015041 3300025913 Bacteria 9132
153 Ga0207671_10190823 3300025914 Bacteria 1598
154 Ga0207693_10003767 3300025915 Bacteria 12922
155 Ga0207693_10006329 3300025915 Bacteria 9815
156 Ga0207693_10134215 3300025915 Bacteria 1946
157 Ga0207693_10321956 3300025915 Bacteria 1210
158 Ga0207693_10336880 3300025915 Bacteria 1181
159 Ga0207693_10471251 3300025915 Bacteria 981
160 Ga0207663_10060745 3300025916 Bacteria 2396
161 Ga0207660_10130691 3300025917 Bacteria 1911
162 Ga0207660_10368621 3300025917 Bacteria 1153
163 Ga0207660_10476337 3300025917 Bacteria 1011
164 Ga0207657_10001172 3300025919 Bacteria 27807
165 Ga0207657_10015625 3300025919 Bacteria 7345
166 Ga0207657_10026306 3300025919 Bacteria 5349
167 Ga0207649_10019214 3300025920 Bacteria 3903
168 Ga0207652_10036795 3300025921 Bacteria 4139
169 Ga0207652_10206122 3300025921 Bacteria 1770
170 Ga0207652_10340252 3300025921 Bacteria 1354
171 Ga0207652_10445981 3300025921 Bacteria 1167
172 Ga0207646_10000268 3300025922 Bacteria 71093
173 Ga0207646_10319344 3300025922 Bacteria 1403
174 Ga0207646_10639599 3300025922 Bacteria 953
175 Ga0207646_10906589 3300025922 Bacteria 782
176 Ga0207694_10350218 3300025924 Unclassified 1222
177 Ga0207687_10206251 3300025927 Bacteria 1539
178 Ga0207700_10072094 3300025928 Bacteria 2662
179 Ga0207700_10073111 3300025928 Bacteria 2646
180 Ga0207700_10157989 3300025928 Bacteria 1880
181 Ga0207664_10061369 3300025929 Bacteria 2999
182 Ga0207664_10079909 3300025929 Bacteria 2656
183 Ga0207664_10080089 3300025929 Bacteria 2654
184 Ga0207664_10096964 3300025929 Bacteria 2428
185 Ga0207664_10127977 3300025929 Bacteria 2134
186 Ga0207664_10138740 3300025929 Bacteria 2054
187 Ga0207664_10352347 3300025929 Bacteria 1303
188 Ga0207664_10369386 3300025929 Bacteria 1272
189 Ga0207664_10374992 3300025929 Bacteria 1262
190 Ga0207664_10465682 3300025929 Bacteria 1129
191 Ga0207664_11269532 3300025929 Bacteria 656
192 Ga0207690_10167134 3300025932 Bacteria 1645
193 Ga0207690_10173067 3300025932 Bacteria 1619
194 Ga0207690_10237390 3300025932 Bacteria 1402
195 Ga0207686_10158992 3300025934 Bacteria 1582
196 Ga0207686_10902572 3300025934 Bacteria 713
197 Ga0207670_10851369 3300025936 Bacteria 762
198 Ga0207665_10002880 3300025939 Bacteria 11539
199 Ga0207665_10065656 3300025939 Bacteria 2468
200 Ga0207661_10143845 3300025944 Bacteria 2055
201 Ga0207661_10161116 3300025944 Bacteria 1946
202 Ga0207679_10270882 3300025945 Bacteria 1452
203 Ga0207667_10133809 3300025949 Bacteria 2553
204 Ga0207640_10120690 3300025981 Bacteria 1877
205 Ga0207702_10117913 3300026078 Bacteria 2371
206 Ga0207674_10004342 3300026116 Bacteria 17098
207 Ga0207683_10596407 3300026121 Bacteria 1022
208 Ga0265326_10034844 3300028558 Bacteria 1432
209 Ga0265326_10060100 3300028558 Bacteria 1075
210 Ga0265319_1001478 3300028563 Bacteria 14041
211 Ga0265319_1007290 3300028563 Bacteria 4991
212 Ga0265334_10000882 3300028573 Bacteria 15013
213 Ga0265334_10008358 3300028573 Bacteria 4401
214 Ga0265334_10031290 3300028573 Bacteria 2127
215 Ga0265318_10000530 3300028577 Bacteria 27345
216 Ga0265318_10006013 3300028577 Bacteria 5629
217 Ga0265323_10059318 3300028653 Bacteria 1335
218 Ga0265322_10006239 3300028654 Bacteria 3508
219 Ga0265336_10020341 3300028666 Bacteria 2131
220 Ga0265338_10003899 3300028800 Bacteria 20611
221 Ga0265338_10029121 3300028800 Bacteria 5485
222 Ga0265338_10035929 3300028800 Bacteria 4751
223 Ga0265338_10036613 3300028800 Bacteria 4692
224 Ga0265324_10021048 3300029957 Bacteria 2340
225 Ga0265324_10028859 3300029957 Bacteria 1954
226 Ga0265324_10086061 3300029957 Bacteria 1069
227 Ga0265330_10000639 3300031235 Bacteria 22518
228 Ga0265330_10059201 3300031235 Bacteria 1668
229 Ga0265330_10088280 3300031235 Bacteria 1332
230 Ga0265332_10011930 3300031238 Bacteria 3860
231 Ga0265332_10146939 3300031238 Bacteria 987
232 Ga0265328_10000260 3300031239 Bacteria 24416
233 Ga0265320_10005160 3300031240 Bacteria 8428
234 Ga0265320_10009679 3300031240 Bacteria 5791
235 Ga0265325_10005799 3300031241 Bacteria 7570
236 Ga0265325_10052415 3300031241 Bacteria 2095
237 Ga0265329_10000312 3300031242 Bacteria 25792
238 Ga0265329_10013860 3300031242 Bacteria 2861
239 Ga0265340_10003471 3300031247 Bacteria 8889
240 Ga0265339_10004250 3300031249 Bacteria 9807
241 Ga0265339_10046850 3300031249 Bacteria 2374
242 Ga0265331_10006045 3300031250 Bacteria 7210
243 Ga0265331_10133259 3300031250 Bacteria 1133
244 Ga0265327_10002384 3300031251 Bacteria 19957
245 Ga0265327_10025465 3300031251 Bacteria 3448
246 Ga0265316_10017452 3300031344 Bacteria 6202
247 Ga0265316_10055780 3300031344 Bacteria 3088
248 Ga0265316_10100171 3300031344 Bacteria 2203
249 Ga0265316_10525086 3300031344 Bacteria 844
250 Ga0265313_10006320 3300031595 Bacteria 8430
251 Ga0265313_10027719 3300031595 Bacteria 2960
252 Ga0265313_10069176 3300031595 Bacteria 1629
253 Ga0265313_10165789 3300031595 Bacteria 936
254 Ga0265314_10004081 3300031711 Bacteria 13766
255 Ga0265314_10021281 3300031711 Bacteria 4991
256 Ga0265342_10003116 3300031712 Bacteria 13857
257 Ga0307416_100077943 3300032002 Bacteria 2786
258 Ga0373951_0042916 3300035091 Bacteria 1095
259 Ga0373945_0181461 3300035116 Bacteria 867
260 Ga0373953_0129231 3300035117 Bacteria 1077
261 Ga0373956_0060210 3300035119 Bacteria 1719
262 Ga0373957_0062019 3300035120 Bacteria 1450
263 Ga0373943_0006289 3300035170 Bacteria 5331
264 Ga0373946_0009153 3300035171 Bacteria 3645
265 Ga0373955_0277595 3300035172 Bacteria 1008
266 Ga0373942_0170404 3300035207 Bacteria 708
267 Ga0373961_0045467 3300035241 Bacteria 1284
268 Ga0373924_0119261 3300035410 Bacteria 1144
269 Ga0373931_0258338 3300035691 Bacteria 1062
270 Ga0373935_0008028 3300035692 Bacteria 6325
271 Ga0373935_0018888 3300035692 Bacteria 4202
272 Ga0373935_0053915 3300035692 Bacteria 2559
273 Ga0373935_0344407 3300035692 Bacteria 1062
274 Ga0373927_0899408 3300035695 Bacteria 584
275 Ga0373947_0000125 3300035725 Bacteria 38878
276 Ga0373937_0001655 3300036401 Bacteria 18730
277 Ga0373937_0325306 3300036401 Bacteria 1455
278 Ga0373937_0553643 3300036401 Bacteria 1093
279 Ga0373925_0011706 3300037068 Bacteria 6343
280 Ga0395899_0072843 3300037312 Bacteria 2513
281 Ga0395900_0032016 3300037418 Bacteria 5406
282 Ga0395900_0064558 3300037418 Bacteria 3762
283 Ga0395900_0615956 3300037418 Bacteria 1025
284 Ga0395900_0911724 3300037418 Bacteria 802
285 Ga0395900_1010819 3300037418 Bacteria 751
286 Ga0395900_1329613 3300037418 Bacteria 632
287 Ga0395898_0043986 3300037466 Bacteria 4399
288 Ga0395898_0061347 3300037466 Bacteria 3653
289 Ga0395898_0217522 3300037466 Bacteria 1822
290 Ga0395898_0333920 3300037466 Bacteria 1445
291 Ga0395898_0458695 3300037466 Bacteria 1213
292 Ga0395898_0832588 3300037466 Bacteria 862
293 Ga0395898_0946234 3300037466 Bacteria 799
294 Ga0395905_0097411 3300037471 Bacteria 2761
295 Ga0395905_0106195 3300037471 Bacteria 2637
296 Ga0395905_0157076 3300037471 Bacteria 2139
297 Ga0395905_0189059 3300037471 Bacteria 1932
298 Ga0395901_0139498 3300038443 Bacteria 2548
299 Ga0395901_0177641 3300038443 Bacteria 2233
300 Ga0395901_0250201 3300038443 Bacteria 1846
301 Ga0395901_0259428 3300038443 Bacteria 1809
302 Ga0395901_0260035 3300038443 Bacteria 1807
303 Ga0395901_0271353 3300038443 Bacteria 1764
304 Ga0395901_0448327 3300038443 Bacteria 1320
305 Ga0395901_0706984 3300038443 Bacteria 1005
306 Ga0395901_0907139 3300038443 Bacteria 863
307 Ga0395901_0915770 3300038443 Bacteria 858
308 Ga0395901_1070703 3300038443 Bacteria 778
309 Ga0436360_1019093 3300039438 Bacteria 6455
310 Ga0439448_0022099 3300042005 Bacteria 1975
311 Ga0439448_0123607 3300042005 Bacteria 889
312 Ga0439459_0132816 3300042438 Bacteria 637
313 Ga0451577_0730390 3300042876 Bacteria 896
314 Ga0466969_0176351 3300044656 Bacteria 979
315 Ga0466969_0350520 3300044656 Bacteria 668
316 Ga0466972_0075876 3300044658 Bacteria 1602
317 Ga0466965_0170179 3300044683 Bacteria 1146
318 Ga0466966_0005863 3300044684 Bacteria 8101
319 Ga0466961_0013026 3300044693 Bacteria 5320
320 Ga0466961_0063795 3300044693 Bacteria 2341
321 Ga0466961_0081301 3300044693 Bacteria 2050
322 Ga0466961_0235262 3300044693 Bacteria 1127
323 Ga0466963_0000135 3300044694 Bacteria 28446
324 Ga0466963_0000185 3300044694 Bacteria 26033
325 Ga0466963_0003099 3300044694 Bacteria 9427
326 Ga0466963_0004811 3300044694 Bacteria 7871
327 Ga0466963_0011793 3300044694 Bacteria 5331
328 Ga0466963_0073659 3300044694 Bacteria 2302
329 Ga0466963_0150423 3300044694 Bacteria 1616
330 Ga0466963_0160835 3300044694 Bacteria 1563
331 Ga0466963_0308276 3300044694 Bacteria 1113
332 Ga0466964_0000686 3300044706 Bacteria 10938
333 Ga0466964_0018299 3300044706 Bacteria 2687
334 Ga0466964_0088461 3300044706 Bacteria 1343
335 Ga0453684_2213223 3300044712 Bacteria 549
336 Ga0466971_0016469 3300044719 Bacteria 3263
337 Ga0466971_0164405 3300044719 Bacteria 1039
338 Ga0466971_0237229 3300044719 Bacteria 867
339 Ga0466971_0421935 3300044719 Bacteria 652
340 Ga0466968_0030786 3300044735 Bacteria 2224
341 Ga0466968_0035090 3300044735 Bacteria 2097
342 Ga0466968_0297829 3300044735 Bacteria 775
343 Ga0466968_0381984 3300044735 Bacteria 688
344 Ga0466957_0001309 3300044842 Bacteria 13003
345 Ga0466957_0020997 3300044842 Bacteria 3843
346 Ga0466957_0072586 3300044842 Bacteria 2131
347 Ga0466957_0084573 3300044842 Bacteria 1980
348 Ga0466957_0183886 3300044842 Bacteria 1366
349 Ga0466960_0011201 3300044901 Bacteria 3743
350 Ga0466960_0058882 3300044901 Bacteria 1877
351 Ga0466960_0570051 3300044901 Bacteria 669
352 Ga0466959_0047124 3300045049 Bacteria 3171
353 Ga0466959_0049465 3300045049 Bacteria 3088
354 Ga0466959_0548526 3300045049 Bacteria 780
355 Ga0451576_0755111 3300045051 Bacteria 1022
356 Ga0466958_0001421 3300045836 Bacteria 11340
357 Ga0466958_0003530 3300045836 Bacteria 8130
358 Ga0466958_0004915 3300045836 Bacteria 7124
359 Ga0466958_0029122 3300045836 Bacteria 3275
360 Ga0466958_0292036 3300045836 Bacteria 1046
361 Ga0466967_0000086 3300045976 Bacteria 34116
362 Ga0466967_0000886 3300045976 Bacteria 15966
363 Ga0466967_0001422 3300045976 Bacteria 13861
364 Ga0466967_0005702 3300045976 Bacteria 8683
365 Ga0466967_0008784 3300045976 Bacteria 7446
366 Ga0466967_0017765 3300045976 Bacteria 5661
367 Ga0466967_0020328 3300045976 Bacteria 5363
368 Ga0466967_0040758 3300045976 Bacteria 3999
369 Ga0466967_0050843 3300045976 Bacteria 3630
370 Ga0466967_0053200 3300045976 Bacteria 3557
371 Ga0466967_0071889 3300045976 Bacteria 3098
372 Ga0466967_0130011 3300045976 Bacteria 2336
373 Ga0466967_0191441 3300045976 Bacteria 1933
374 Ga0466967_0208334 3300045976 Bacteria 1854
375 Ga0466967_0253301 3300045976 Bacteria 1682
376 Ga0466967_0274366 3300045976 Bacteria 1616
377 Ga0466967_0351114 3300045976 Bacteria 1427
378 Ga0466967_0370454 3300045976 Bacteria 1389
379 Ga0466967_0441011 3300045976 Bacteria 1271
380 Ga0495592_0000125 3300046454 Bacteria 68045
381 Ga0495592_0023488 3300046454 Bacteria 4689
382 Ga0495592_0036718 3300046454 Bacteria 3689
383 Ga0495592_0081922 3300046454 Bacteria 2333
384 Ga0495592_0144468 3300046454 Bacteria 1651
385 Ga0495603_0006179 3300046455 Bacteria 7161
386 Ga0495603_0231423 3300046455 Bacteria 1065
387 Ga0495629_0236715 3300046459 Bacteria 1257
388 Ga0495641_0007350 3300046461 Bacteria 6897
389 Ga0495641_0032945 3300046461 Bacteria 2463
390 Ga0495641_0071515 3300046461 Bacteria 1557
391 Ga0495651_0000011 3300046462 Bacteria 147193
392 Ga0495651_0010221 3300046462 Bacteria 7204
393 Ga0495651_0025885 3300046462 Bacteria 4568
394 Ga0495653_0001602 3300046463 Bacteria 17779
395 Ga0495653_0029523 3300046463 Bacteria 4376
396 Ga0495653_0039472 3300046463 Bacteria 3698
397 Ga0495653_0078647 3300046463 Bacteria 2445
398 Ga0495653_0206618 3300046463 Bacteria 1329
399 Ga0495653_0212174 3300046463 Bacteria 1307
400 Ga0495653_0421727 3300046463 Bacteria 844
401 Ga0495653_0942294 3300046463 Bacteria 513
402 Ga0495582_0001075 3300046473 Bacteria 15353
403 Ga0495582_0033633 3300046473 Bacteria 2819
404 Ga0495582_0078084 3300046473 Bacteria 1836
405 Ga0495639_0007680 3300046475 Bacteria 4637
406 Ga0495662_0003247 3300046476 Bacteria 8215
407 Ga0495664_0009793 3300046477 Bacteria 5373
408 Ga0495664_0064092 3300046477 Bacteria 2190
409 Ga0495585_0262591 3300046492 Bacteria 858
410 Ga0495585_0294166 3300046492 Bacteria 800
411 Ga0495594_0244607 3300046499 Bacteria 1022
412 Ga0495607_0054542 3300046501 Bacteria 2303
413 Ga0495607_0140028 3300046501 Bacteria 1249
414 Ga0495608_0001526 3300046511 Bacteria 16479
415 Ga0495608_0010696 3300046511 Bacteria 6402
416 Ga0495608_0147827 3300046511 Bacteria 1498
417 Ga0495618_0011398 3300046514 Bacteria 5391
418 Ga0495618_0016806 3300046514 Bacteria 4480
419 Ga0495618_0226276 3300046514 Bacteria 1179
420 Ga0495628_0000024 3300046516 Bacteria 130196
421 Ga0495628_0216592 3300046516 Bacteria 1439
422 Ga0495628_0507432 3300046516 Bacteria 870
423 Ga0495630_0002944 3300046517 Bacteria 11829
424 Ga0495630_0053750 3300046517 Bacteria 3016
425 Ga0495630_0076050 3300046517 Bacteria 2529
426 Ga0495630_0105391 3300046517 Bacteria 2135
427 Ga0495630_0127066 3300046517 Bacteria 1935
428 Ga0495630_0137973 3300046517 Bacteria 1853
429 Ga0495630_0221807 3300046517 Bacteria 1443
430 Ga0495630_0369302 3300046517 Bacteria 1099
431 Ga0495630_0386076 3300046517 Bacteria 1073
432 Ga0495630_0393993 3300046517 Bacteria 1061
433 Ga0495630_0409248 3300046517 Bacteria 1039
434 Ga0495644_0004460 3300046523 Bacteria 5501
435 Ga0495644_0036888 3300046523 Bacteria 1844
436 Ga0495666_0001078 3300046526 Bacteria 12995
437 Ga0495652_0000299 3300046529 Bacteria 58948
438 Ga0495652_0052430 3300046529 Bacteria 3479
439 Ga0495652_0084313 3300046529 Bacteria 2613
440 Ga0495652_0200141 3300046529 Bacteria 1516
441 Ga0495652_0295584 3300046529 Bacteria 1180
442 Ga0495652_0756143 3300046529 Bacteria 650
443 Ga0495665_0009951 3300046531 Bacteria 5149
444 Ga0495640_0010056 3300046533 Bacteria 7333
445 Ga0495640_0566594 3300046533 Unclassified 688
446 Ga0495586_0004633 3300046535 Bacteria 7351
447 Ga0495587_0003192 3300046536 Bacteria 10946
448 Ga0495587_0004974 3300046536 Bacteria 8703
449 Ga0495587_0290182 3300046536 Bacteria 916
450 Ga0495598_0145912 3300046537 Bacteria 822
451 Ga0495609_0086090 3300046538 Bacteria 1370
452 Ga0495645_0000035 3300046543 Bacteria 102305
453 Ga0495667_0021742 3300046559 Bacteria 4328
454 Ga0495667_0064029 3300046559 Bacteria 2406
455 Ga0495667_0123072 3300046559 Bacteria 1674
456 Ga0495667_0139928 3300046559 Bacteria 1560
457 Ga0495667_0166418 3300046559 Bacteria 1417
458 Ga0495634_0038985 3300046642 Bacteria 3237
459 Ga0495634_0059891 3300046642 Bacteria 2534
460 Ga0495634_0096301 3300046642 Bacteria 1916
461 Ga0495634_0156077 3300046642 Bacteria 1441
462 Ga0495635_0027023 3300046663 Bacteria 3992
463 Ga0495635_0054681 3300046663 Bacteria 2749
464 Ga0495635_0086534 3300046663 Bacteria 2144
465 Ga0495635_0110600 3300046663 Bacteria 1877
466 Ga0495635_0395642 3300046663 Bacteria 918
467 Ga0495657_0053029 3300046675 Bacteria 2715
468 Ga0495657_0055510 3300046675 Bacteria 2641
469 Ga0495657_0068713 3300046675 Bacteria 2320
470 Ga0495657_0134596 3300046675 Bacteria 1545
471 Ga0495657_0139952 3300046675 Bacteria 1509
472 Ga0495657_0283496 3300046675 Bacteria 991
473 Ga0495599_0000009 3300046678 Bacteria 217299
474 Ga0495599_0008788 3300046678 Bacteria 6147
475 Ga0495599_0040906 3300046678 Bacteria 2910
476 Ga0495623_0000039 3300046679 Bacteria 80360
477 Ga0495623_0278295 3300046679 Bacteria 932
478 Ga0495646_0135294 3300046680 Bacteria 1383
479 Ga0495658_0048287 3300046683 Bacteria 2399
480 Ga0495658_0197922 3300046683 Bacteria 1251
481 Ga0495613_0186969 3300046689 Bacteria 1465
482 Ga0495624_0007741 3300046690 Bacteria 7535
483 Ga0495624_0023332 3300046690 Bacteria 4081
484 Ga0495624_0176625 3300046690 Bacteria 1302
485 Ga0495589_0049015 3300046794 Bacteria 2090
486 Ga0495600_0029214 3300046809 Bacteria 3569
487 Ga0495600_0127598 3300046809 Bacteria 1654
488 Ga0495600_0189449 3300046809 Bacteria 1323
489 Ga0495600_0543175 3300046809 Bacteria 711
490 Ga0495581_0003524 3300047315 Bacteria 8978
491 Ga0495604_0000847 3300047317 Bacteria 25539
492 Ga0495604_0181229 3300047317 Bacteria 1473
493 Ga0495604_0189087 3300047317 Bacteria 1436
494 Ga0495636_0309901 3300047318 Bacteria 740
495 Ga0495674_0012370 3300047319 Bacteria 8039
496 Ga0495674_0018066 3300047319 Bacteria 6564
497 Ga0495674_0087433 3300047319 Bacteria 2667
498 Ga0495674_0091756 3300047319 Bacteria 2594
499 Ga0495674_0289421 3300047319 Bacteria 1340
500 Ga0495674_0834111 3300047319 Bacteria 715
501 Ga0495674_1153340 3300047319 Bacteria 588
502 Ga0495676_0019590 3300047321 Bacteria 5949
503 Ga0495676_0044097 3300047321 Bacteria 3644
504 Ga0495676_0098224 3300047321 Bacteria 2173
505 Ga0495680_0003362 3300047322 Bacteria 15797
506 Ga0495680_0009330 3300047322 Bacteria 8838
507 Ga0495680_0046273 3300047322 Bacteria 3431
508 Ga0495680_0102466 3300047322 Bacteria 2131
509 Ga0495680_0210767 3300047322 Bacteria 1391
510 Ga0495680_0288440 3300047322 Bacteria 1155
511 Ga0495675_0000137 3300047444 Bacteria 50947
512 Ga0495675_0220882 3300047444 Bacteria 1147
513 Ga0495675_0286259 3300047444 Unclassified 982
514 Ga0495677_0081275 3300047445 Bacteria 1215
515 Ga0495684_0022569 3300047471 Bacteria 4839
516 Ga0495684_0025357 3300047471 Bacteria 4558
517 Ga0495684_0026959 3300047471 Bacteria 4415
518 Ga0495684_0043100 3300047471 Bacteria 3455
519 Ga0495684_0118618 3300047471 Bacteria 1994
520 Ga0495684_0120812 3300047471 Bacteria 1973
521 Ga0495684_0191735 3300047471 Bacteria 1511
522 Ga0495684_0227029 3300047471 Bacteria 1367
523 Ga0495684_0552623 3300047471 Bacteria 784
524 Ga0495593_0001553 3300047673 Bacteria 13534
525 Ga0495593_0022548 3300047673 Bacteria 3507
526 Ga0495602_0003800 3300048088 Bacteria 15695
527 Ga0495602_0108840 3300048088 Bacteria 2256
528 Ga0495602_0215065 3300048088 Bacteria 1455
529 Ga0495602_0297614 3300048088 Bacteria 1182
530 Ga0496100_0034608 3300048903 Bacteria 3171
531 Ga0496101_0473622 3300048904 Bacteria 989
532 Ga0496101_0941789 3300048904 Bacteria 680
533 Ga0496102_0008326 3300048905 Bacteria 8882
534 Ga0496102_0117360 3300048905 Bacteria 2483
535 Ga0496103_0002930 3300048906 Bacteria 10569
536 Ga0496103_0017357 3300048906 Bacteria 4307
537 Ga0496103_0467888 3300048906 Bacteria 808
538 Ga0496104_0000796 3300048907 Bacteria 27065
539 Ga0496104_0068003 3300048907 Bacteria 3384
540 Ga0496104_0075320 3300048907 Bacteria 3213
541 Ga0496104_0129120 3300048907 Bacteria 2427
542 Ga0496104_0144537 3300048907 Bacteria 2284
543 Ga0496104_0307670 3300048907 Bacteria 1497
544 Ga0496105_0005625 3300048908 Bacteria 9533
545 Ga0496105_0010287 3300048908 Bacteria 7354
546 Ga0496105_0041730 3300048908 Bacteria 3781
547 Ga0496105_0095477 3300048908 Bacteria 2455
548 Ga0496105_0279102 3300048908 Bacteria 1347
549 Ga0496105_0391469 3300048908 Bacteria 1104
550 Ga0496106_0001399 3300048909 Bacteria 18089
551 Ga0496106_0033733 3300048909 Bacteria 3820
552 Ga0496107_0000426 3300048910 Bacteria 22865
553 Ga0496107_0155947 3300048910 Bacteria 1690
554 Ga0496108_0117528 3300048911 Bacteria 2278
555 Ga0496108_0174487 3300048911 Bacteria 1860
556 Ga0496108_0211983 3300048911 Bacteria 1682
557 Ga0496109_0002033 3300048912 Bacteria 16781
558 Ga0496109_0060856 3300048912 Bacteria 3451
559 Ga0496109_0073103 3300048912 Bacteria 3150
560 Ga0496109_0246097 3300048912 Bacteria 1683
561 Ga0496109_0571545 3300048912 Bacteria 1066
562 Ga0496110_0035511 3300048913 Bacteria 4325
563 Ga0496110_0426511 3300048913 Bacteria 1209
564 Ga0496110_0546554 3300048913 Bacteria 1053
565 Ga0496111_0030439 3300048914 Bacteria 3837
566 Ga0496111_0212220 3300048914 Bacteria 1438
567 Ga0496111_0388930 3300048914 Bacteria 1031
568 Ga0496111_0403470 3300048914 Bacteria 1010
569 Ga0496112_0013153 3300048915 Bacteria 7636
570 Ga0496112_0013970 3300048915 Bacteria 7432
571 Ga0496112_0123433 3300048915 Bacteria 2561
572 Ga0496112_0294886 3300048915 Bacteria 1567
573 Ga0496112_0335662 3300048915 Bacteria 1455
574 Ga0496112_0406787 3300048915 Bacteria 1300
575 Ga0496112_1254974 3300048915 Bacteria 657
576 Ga0496112_1547786 3300048915 Bacteria 577
577 Ga0496113_0102392 3300048916 Bacteria 2220
578 Ga0496113_0194434 3300048916 Bacteria 1611
579 Ga0496113_0236430 3300048916 Bacteria 1457
580 Ga0496113_1148244 3300048916 Bacteria 608
581 Ga0496114_0051067 3300048917 Bacteria 3442
582 Ga0496114_0068794 3300048917 Bacteria 2973
583 Ga0496114_0243469 3300048917 Bacteria 1582
584 Ga0496115_0003499 3300048918 Bacteria 11289
585 Ga0496115_0206057 3300048918 Bacteria 1624
586 Ga0496115_0221175 3300048918 Bacteria 1562
587 Ga0496115_0809884 3300048918 Bacteria 728
588 Ga0501031_0001066 3300049568 Bacteria 16641
589 Ga0501032_0005293 3300049569 Bacteria 9596
590 Ga0501033_0002948 3300049570 Bacteria 14221
591 Ga0501034_0073663 3300049571 Bacteria 3424
592 Ga0501036_0000227 3300049572 Bacteria 37896
593 Ga0501037_0000071 3300049573 Bacteria 94548
594 Ga0501038_0002331 3300049574 Bacteria 17683
595 Ga0501039_0000817 3300049575 Bacteria 22459
596 Ga0501040_0000444 3300049576 Bacteria 24601
597 Ga0501040_0621670 3300049576 Bacteria 780
598 Ga0501041_0000836 3300049577 Bacteria 16532
599 Ga0501042_0000314 3300049578 Bacteria 24226
600 Ga0501042_0427123 3300049578 Bacteria 960
601 Ga0501043_0000898 3300049579 Bacteria 26388
602 Ga0501046_0000158 3300049580 Bacteria 70218
603 Ga0501046_0270674 3300049580 Bacteria 1246
604 Ga0501047_0004798 3300049581 Bacteria 12724
605 Ga0501048_0002270 3300049582 Bacteria 14668
606 Ga0501067_0128965 3300049583 Bacteria 1407
607 Ga0501067_0396748 3300049583 Bacteria 769
608 Ga0501068_0000071 3300049584 Bacteria 40485
609 Ga0501069_0005870 3300049585 Bacteria 6396
610 Ga0501069_0026069 3300049585 Bacteria 3200
611 Ga0501070_0003160 3300049586 Bacteria 14326
612 Ga0501070_0384456 3300049586 Bacteria 1137
613 Ga0501071_0087510 3300049587 Bacteria 2285
614 Ga0501071_0109694 3300049587 Bacteria 2039
615 Ga0501072_0005409 3300049588 Bacteria 9723
616 Ga0501072_0937709 3300049588 Bacteria 676
617 Ga0501073_0181751 3300049589 Bacteria 1455
618 Ga0501074_0000343 3300049590 Bacteria 27140
619 Ga0501075_0005968 3300049591 Bacteria 8338
620 Ga0501076_0000241 3300049592 Bacteria 33566
621 Ga0501077_0003562 3300049593 Bacteria 9358
622 Ga0501077_0287967 3300049593 Bacteria 1046
623 Ga0501079_0001771 3300049741 Bacteria 15406
624 Ga0501080_0000443 3300049742 Bacteria 32155
625 Ga0501081_0019765 3300049743 Bacteria 4487
626 Ga0501083_0003766 3300049744 Bacteria 10645
627 Ga0501035_0000856 3300049822 Bacteria 32437
628 Ga0501044_0041027 3300049823 Bacteria 4818
629 Ga0501045_0008611 3300049824 Bacteria 7110
630 Ga0501045_0452089 3300049824 Bacteria 955
631 nmdc:mga05p37_735541_c1 3300050507 Bacteria 1090
632 nmdc:mga06r32_1207448_c1 3300050510 Bacteria 702
633 nmdc:mga08y16_16438_c1 3300050511 Bacteria 7781
634 nmdc:mga0n895_731111_c1 3300050512 Bacteria 984
635 nmdc:mga0n895_7837_c1 3300050512 Bacteria 9206
636 nmdc:mga0n895_92559_c1 3300050512 Bacteria 3026
637 nmdc:mga0rr50_88365_c1 3300050513 Bacteria 2407
638 nmdc:mga08x19_100416_c1 3300050514 Bacteria 1919
639 Ga0495601_0000659 3300053077 Bacteria 18407
640 Ga0495601_0031959 3300053077 Bacteria 3274
641 Ga0495601_0063206 3300053077 Bacteria 2353
642 Ga0495601_0119269 3300053077 Bacteria 1712
643 Ga0495601_0663415 3300053077 Bacteria 667
644 Ga0495595_0002860 3300053084 Bacteria 6804
645 Ga0495595_0040232 3300053084 Bacteria 2136
646 Ga0495595_0062812 3300053084 Bacteria 1742
647 Ga0495595_0076177 3300053084 Bacteria 1592
648 Ga0495595_0166210 3300053084 Bacteria 1090
649 Ga0495619_0001721 3300053085 Bacteria 14524
650 Ga0495619_0024348 3300053085 Bacteria 3882
651 Ga0495619_0028120 3300053085 Bacteria 3625
652 Ga0495619_0057818 3300053085 Bacteria 2573
653 Ga0495619_0240886 3300053085 Bacteria 1253
654 Ga0501084_0000072 3300054114 Bacteria 75958
655 Ga0501084_0377334 3300054114 Bacteria 1198
656 Ga0590075_022267 3300059424 Bacteria 1585
657 Ga0501082_0000605 3300060353 Bacteria 31641
658 Ga0501082_0584063 3300060353 Bacteria 977
659 Ga0466962_0004904 3300061719 Bacteria 6436
660 Ga0466962_0013058 3300061719 Bacteria 3995
661 Ga0466962_0017064 3300061719 Bacteria 3498
662 Ga0466962_0120943 3300061719 Bacteria 1263
663 Ga0530510_0003067 3300061734 Bacteria 11472

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100291142 Ga0070661_1002911422 129
2 3300035695 Ga0373927_0899408 Ga0373927_0899408_106_546 141
3 3300047317 Ga0495604_0181229 Ga0495604_0181229_38_478 141
4 3300048917 Ga0496114_0243469 Ga0496114_0243469_34_474 141
5 3300037418 Ga0395900_1010819 Ga0395900_1010819_44_481 143
6 3300013104 Ga0157370_10012715 Ga0157370_100127154 145
7 3300013105 Ga0157369_10006695 Ga0157369_100066955 145
8 3300037418 Ga0395900_1329613 Ga0395900_1329613_26_463 145
9 3300044712 Ga0453684_2213223 Ga0453684_2213223_81_536 145
10 3300045049 Ga0466959_0548526 Ga0466959_0548526_53_490 145
11 3300046463 Ga0495653_0942294 Ga0495653_0942294_44_490 145
12 3300046517 Ga0495630_0409248 Ga0495630_0409248_535_987 145
13 3300005329 Ga0070683_100039772 Ga0070683_1000397723 156
14 3300005336 Ga0070680_100009628 Ga0070680_1000096284 156
15 3300005337 Ga0070682_100157395 Ga0070682_1001573952 156
16 3300005339 Ga0070660_100007385 Ga0070660_1000073854 156
17 3300005366 Ga0070659_100099627 Ga0070659_1000996272 156
18 3300005458 Ga0070681_10041652 Ga0070681_100416523 156
19 3300005535 Ga0070684_100093517 Ga0070684_1000935172 156
20 3300005578 Ga0068854_100117615 Ga0068854_1001176153 156
21 3300005616 Ga0068852_100641285 Ga0068852_1006412852 156
22 3300013104 Ga0157370_10329264 Ga0157370_103292642 156
23 3300013307 Ga0157372_10339683 Ga0157372_103396832 156
24 3300014497 Ga0182008_10465486 Ga0182008_104654861 156
25 3300020082 Ga0206353_11846493 Ga0206353_118464933 156
26 3300025912 Ga0207707_10127723 Ga0207707_101277232 156
27 3300025917 Ga0207660_10476337 Ga0207660_104763372 156
28 3300025919 Ga0207657_10026306 Ga0207657_100263064 156
29 3300025932 Ga0207690_10167134 Ga0207690_101671342 156
30 3300025944 Ga0207661_10143845 Ga0207661_101438453 156
31 3300025981 Ga0207640_10120690 Ga0207640_101206903 156
32 3300044735 Ga0466968_0297829 Ga0466968_0297829_79_618 156
33 3300044842 Ga0466957_0072586 Ga0466957_0072586_910_1449 156
34 3300045976 Ga0466967_0040758 Ga0466967_0040758_3142_3681 156
35 3300045976 Ga0466967_0351114 Ga0466967_0351114_777_1316 156
36 3300006175 Ga0070712_100005908 Ga0070712_1000059083 157
37 3300048904 Ga0496101_0473622 Ga0496101_0473622_351_887 157
38 3300045976 Ga0466967_0191441 Ga0466967_0191441_1205_1744 160
39 3300005985 Ga0081539_10026584 Ga0081539_100265845 165
40 3300048907 Ga0496104_0144537 Ga0496104_0144537_417_935 165
41 3300009098 Ga0105245_10301976 Ga0105245_103019762 170
42 3300035692 Ga0373935_0053915 Ga0373935_0053915_827_1360 170
43 3300037466 Ga0395898_0458695 Ga0395898_0458695_210_728 170
44 3300038443 Ga0395901_0448327 Ga0395901_0448327_86_604 170
45 3300044693 Ga0466961_0081301 Ga0466961_0081301_779_1312 170
46 3300046517 Ga0495630_0053750 Ga0495630_0053750_978_1511 170
47 3300061719 Ga0466962_0120943 Ga0466962_0120943_622_1155 170
48 3300005327 Ga0070658_10013374 Ga0070658_100133746 172
49 3300005327 Ga0070658_10021338 Ga0070658_100213386 172
50 3300005329 Ga0070683_100041387 Ga0070683_1000413873 172
51 3300005336 Ga0070680_100139973 Ga0070680_1001399731 172
52 3300005337 Ga0070682_100633466 Ga0070682_1006334662 172
53 3300005339 Ga0070660_100016180 Ga0070660_1000161806 172
54 3300005339 Ga0070660_100150697 Ga0070660_1001506972 172
55 3300005340 Ga0070689_100864543 Ga0070689_1008645432 172
56 3300005344 Ga0070661_100033902 Ga0070661_1000339026 172
57 3300005366 Ga0070659_100034400 Ga0070659_1000344003 172
58 3300005366 Ga0070659_100260698 Ga0070659_1002606982 172
59 3300005434 Ga0070709_10054490 Ga0070709_100544904 172
60 3300005434 Ga0070709_10193813 Ga0070709_101938132 172
61 3300005434 Ga0070709_10218145 Ga0070709_102181452 172
62 3300005435 Ga0070714_100001136 Ga0070714_10000113612 172
63 3300005435 Ga0070714_100002733 Ga0070714_1000027332 172
64 3300005435 Ga0070714_100022837 Ga0070714_1000228375 172
65 3300005435 Ga0070714_100026293 Ga0070714_1000262935 172
66 3300005435 Ga0070714_100034163 Ga0070714_1000341633 172
67 3300005435 Ga0070714_100047538 Ga0070714_1000475383 172
68 3300005435 Ga0070714_100097099 Ga0070714_1000970992 172
69 3300005435 Ga0070714_100251352 Ga0070714_1002513522 172
70 3300005435 Ga0070714_100348500 Ga0070714_1003485002 172
71 3300005436 Ga0070713_100015877 Ga0070713_1000158772 172
72 3300005436 Ga0070713_100046101 Ga0070713_1000461014 172
73 3300005436 Ga0070713_100093949 Ga0070713_1000939494 172
74 3300005436 Ga0070713_100146367 Ga0070713_1001463671 172
75 3300005436 Ga0070713_101153324 Ga0070713_1011533241 172
76 3300005437 Ga0070710_10046578 Ga0070710_100465784 172
77 3300005439 Ga0070711_100075027 Ga0070711_1000750273 172
78 3300005439 Ga0070711_100083627 Ga0070711_1000836272 172
79 3300005444 Ga0070694_100212933 Ga0070694_1002129332 172
80 3300005445 Ga0070708_100414365 Ga0070708_1004143651 172
81 3300005445 Ga0070708_100656789 Ga0070708_1006567891 172
82 3300005445 Ga0070708_101250811 Ga0070708_1012508111 172
83 3300005458 Ga0070681_10125168 Ga0070681_101251684 172
84 3300005458 Ga0070681_10166640 Ga0070681_101666403 172
85 3300005466 Ga0070685_10687025 Ga0070685_106870252 172
86 3300005467 Ga0070706_100143947 Ga0070706_1001439472 172
87 3300005468 Ga0070707_100006214 Ga0070707_1000062146 172
88 3300005468 Ga0070707_100281342 Ga0070707_1002813422 172
89 3300005468 Ga0070707_100286163 Ga0070707_1002861632 172
90 3300005468 Ga0070707_100477723 Ga0070707_1004777232 172
91 3300005468 Ga0070707_100935765 Ga0070707_1009357651 172
92 3300005468 Ga0070707_101370338 Ga0070707_1013703381 172
93 3300005471 Ga0070698_100073048 Ga0070698_1000730486 172
94 3300005471 Ga0070698_100103583 Ga0070698_1001035832 172
95 3300005471 Ga0070698_100130968 Ga0070698_1001309684 172
96 3300005471 Ga0070698_100151186 Ga0070698_1001511862 172
97 3300005471 Ga0070698_100213818 Ga0070698_1002138183 172
98 3300005471 Ga0070698_100863997 Ga0070698_1008639971 172
99 3300005471 Ga0070698_101159593 Ga0070698_1011595931 172
100 3300005471 Ga0070698_101313427 Ga0070698_1013134271 172
101 3300005471 Ga0070698_101538846 Ga0070698_1015388461 172
102 3300005518 Ga0070699_100807374 Ga0070699_1008073741 172
103 3300005518 Ga0070699_100973024 Ga0070699_1009730242 172
104 3300005530 Ga0070679_100060118 Ga0070679_1000601182 172
105 3300005530 Ga0070679_101343321 Ga0070679_1013433211 172
106 3300005535 Ga0070684_100469733 Ga0070684_1004697332 172
107 3300005535 Ga0070684_100949999 Ga0070684_1009499991 172
108 3300005545 Ga0070695_100000837 Ga0070695_1000008376 172
109 3300005549 Ga0070704_100105578 Ga0070704_1001055783 172
110 3300005563 Ga0068855_100137311 Ga0068855_1001373114 172
111 3300005577 Ga0068857_100003516 Ga0068857_1000035166 172
112 3300005578 Ga0068854_101030974 Ga0068854_1010309742 172
113 3300005614 Ga0068856_100706034 Ga0068856_1007060342 172
114 3300005718 Ga0068866_10270113 Ga0068866_102701132 172
115 3300005842 Ga0068858_100535538 Ga0068858_1005355382 172
116 3300005937 Ga0081455_10052759 Ga0081455_100527594 172
117 3300005981 Ga0081538_10228953 Ga0081538_102289532 172
118 3300005985 Ga0081539_10004223 Ga0081539_1000422320 172
119 3300006028 Ga0070717_10003257 Ga0070717_1000325710 172
120 3300006028 Ga0070717_10049174 Ga0070717_100491745 172
121 3300006028 Ga0070717_10052709 Ga0070717_100527092 172
122 3300006028 Ga0070717_10094099 Ga0070717_100940992 172
123 3300006028 Ga0070717_10118155 Ga0070717_101181553 172
124 3300006028 Ga0070717_10235391 Ga0070717_102353912 172
125 3300006028 Ga0070717_10440769 Ga0070717_104407692 172
126 3300006163 Ga0070715_10035614 Ga0070715_100356143 172
127 3300006173 Ga0070716_100023259 Ga0070716_1000232595 172
128 3300006173 Ga0070716_100058838 Ga0070716_1000588383 172
129 3300006173 Ga0070716_100131051 Ga0070716_1001310512 172
130 3300006173 Ga0070716_100272417 Ga0070716_1002724172 172
131 3300006173 Ga0070716_100763366 Ga0070716_1007633662 172
132 3300006175 Ga0070712_100084373 Ga0070712_1000843733 172
133 3300006175 Ga0070712_100135680 Ga0070712_1001356801 172
134 3300006175 Ga0070712_100248622 Ga0070712_1002486222 172
135 3300006175 Ga0070712_100822400 Ga0070712_1008224002 172
136 3300006844 Ga0075428_100752649 Ga0075428_1007526492 172
137 3300006852 Ga0075433_10805442 Ga0075433_108054422 172
138 3300006871 Ga0075434_100008573 Ga0075434_10000857310 172
139 3300006871 Ga0075434_100087644 Ga0075434_1000876443 172
140 3300006914 Ga0075436_100292172 Ga0075436_1002921722 172
141 3300007076 Ga0075435_100050921 Ga0075435_1000509212 172
142 3300009093 Ga0105240_10006843 Ga0105240_100068436 172
143 3300009093 Ga0105240_10056712 Ga0105240_100567126 172
144 3300009094 Ga0111539_10034378 Ga0111539_100343782 172
145 3300009094 Ga0111539_12048342 Ga0111539_120483421 172
146 3300009147 Ga0114129_11571449 Ga0114129_115714492 172
147 3300009176 Ga0105242_10660205 Ga0105242_106602052 172
148 3300009176 Ga0105242_10948365 Ga0105242_109483652 172
149 3300009177 Ga0105248_10550940 Ga0105248_105509403 172
150 3300009545 Ga0105237_10045015 Ga0105237_100450155 172
151 3300009551 Ga0105238_10194048 Ga0105238_101940483 172
152 3300009551 Ga0105238_11614995 Ga0105238_116149951 172
153 3300010375 Ga0105239_10276235 Ga0105239_102762354 172
154 3300011119 Ga0105246_10160502 Ga0105246_101605023 172
155 3300013100 Ga0157373_10151334 Ga0157373_101513342 172
156 3300013105 Ga0157369_10110889 Ga0157369_101108892 172
157 3300013105 Ga0157369_10208763 Ga0157369_102087634 172
158 3300013307 Ga0157372_10260460 Ga0157372_102604603 172
159 3300013307 Ga0157372_10931972 Ga0157372_109319722 172
160 3300014326 Ga0157380_11987019 Ga0157380_119870191 172
161 3300014497 Ga0182008_10042547 Ga0182008_100425474 172
162 3300014497 Ga0182008_10240388 Ga0182008_102403881 172
163 3300020069 Ga0197907_10281088 Ga0197907_102810883 172
164 3300020070 Ga0206356_10252104 Ga0206356_102521042 172
165 3300020070 Ga0206356_11592742 Ga0206356_115927423 172
166 3300020081 Ga0206354_11527074 Ga0206354_115270743 172
167 3300025898 Ga0207692_10054038 Ga0207692_100540382 172
168 3300025906 Ga0207699_10022264 Ga0207699_100222644 172
169 3300025906 Ga0207699_10254007 Ga0207699_102540072 172
170 3300025906 Ga0207699_10366390 Ga0207699_103663902 172
171 3300025909 Ga0207705_10027373 Ga0207705_100273732 172
172 3300025909 Ga0207705_10305657 Ga0207705_103056572 172
173 3300025910 Ga0207684_10336198 Ga0207684_103361982 172
174 3300025910 Ga0207684_10350231 Ga0207684_103502312 172
175 3300025912 Ga0207707_10027158 Ga0207707_100271584 172
176 3300025912 Ga0207707_10078401 Ga0207707_100784012 172
177 3300025912 Ga0207707_10222523 Ga0207707_102225232 172
178 3300025912 Ga0207707_10300755 Ga0207707_103007553 172
179 3300025913 Ga0207695_10015041 Ga0207695_1001504111 172
180 3300025914 Ga0207671_10190823 Ga0207671_101908232 172
181 3300025915 Ga0207693_10003767 Ga0207693_1000376715 172
182 3300025915 Ga0207693_10006329 Ga0207693_1000632910 172
183 3300025915 Ga0207693_10134215 Ga0207693_101342153 172
184 3300025915 Ga0207693_10321956 Ga0207693_103219562 172
185 3300025915 Ga0207693_10336880 Ga0207693_103368802 172
186 3300025915 Ga0207693_10471251 Ga0207693_104712512 172
187 3300025916 Ga0207663_10060745 Ga0207663_100607454 172
188 3300025917 Ga0207660_10130691 Ga0207660_101306913 172
189 3300025917 Ga0207660_10368621 Ga0207660_103686212 172
190 3300025919 Ga0207657_10001172 Ga0207657_1000117232 172
191 3300025919 Ga0207657_10015625 Ga0207657_100156258 172
192 3300025920 Ga0207649_10019214 Ga0207649_100192146 172
193 3300025921 Ga0207652_10036795 Ga0207652_100367952 172
194 3300025921 Ga0207652_10206122 Ga0207652_102061223 172
195 3300025921 Ga0207652_10340252 Ga0207652_103402522 172
196 3300025921 Ga0207652_10445981 Ga0207652_104459812 172
197 3300025922 Ga0207646_10000268 Ga0207646_1000026865 172
198 3300025922 Ga0207646_10319344 Ga0207646_103193442 172
199 3300025922 Ga0207646_10639599 Ga0207646_106395992 172
200 3300025922 Ga0207646_10906589 Ga0207646_109065891 172
201 3300025924 Ga0207694_10350218 Ga0207694_103502183 172
202 3300025927 Ga0207687_10206251 Ga0207687_102062513 172
203 3300025928 Ga0207700_10072094 Ga0207700_100720944 172
204 3300025928 Ga0207700_10073111 Ga0207700_100731112 172
205 3300025928 Ga0207700_10157989 Ga0207700_101579892 172
206 3300025929 Ga0207664_10061369 Ga0207664_100613692 172
207 3300025929 Ga0207664_10079909 Ga0207664_100799093 172
208 3300025929 Ga0207664_10080089 Ga0207664_100800892 172
209 3300025929 Ga0207664_10096964 Ga0207664_100969643 172
210 3300025929 Ga0207664_10127977 Ga0207664_101279772 172
211 3300025929 Ga0207664_10138740 Ga0207664_101387403 172
212 3300025929 Ga0207664_10352347 Ga0207664_103523471 172
213 3300025929 Ga0207664_10369386 Ga0207664_103693861 172
214 3300025929 Ga0207664_10374992 Ga0207664_103749922 172
215 3300025929 Ga0207664_10465682 Ga0207664_104656822 172
216 3300025929 Ga0207664_11269532 Ga0207664_112695321 172
217 3300025932 Ga0207690_10173067 Ga0207690_101730673 172
218 3300025932 Ga0207690_10237390 Ga0207690_102373901 172
219 3300025934 Ga0207686_10158992 Ga0207686_101589922 172
220 3300025934 Ga0207686_10902572 Ga0207686_109025722 172
221 3300025936 Ga0207670_10851369 Ga0207670_108513691 172
222 3300025939 Ga0207665_10002880 Ga0207665_100028805 172
223 3300025939 Ga0207665_10065656 Ga0207665_100656563 172
224 3300025944 Ga0207661_10161116 Ga0207661_101611162 172
225 3300025945 Ga0207679_10270882 Ga0207679_102708822 172
226 3300025949 Ga0207667_10133809 Ga0207667_101338093 172
227 3300026078 Ga0207702_10117913 Ga0207702_101179133 172
228 3300026116 Ga0207674_10004342 Ga0207674_100043422 172
229 3300026121 Ga0207683_10596407 Ga0207683_105964072 172
230 3300028558 Ga0265326_10034844 Ga0265326_100348442 172
231 3300028558 Ga0265326_10060100 Ga0265326_100601001 172
232 3300028563 Ga0265319_1001478 Ga0265319_100147813 172
233 3300028563 Ga0265319_1007290 Ga0265319_10072904 172
234 3300028573 Ga0265334_10000882 Ga0265334_100008825 172
235 3300028573 Ga0265334_10008358 Ga0265334_100083584 172
236 3300028573 Ga0265334_10031290 Ga0265334_100312902 172
237 3300028577 Ga0265318_10000530 Ga0265318_1000053015 172
238 3300028577 Ga0265318_10006013 Ga0265318_100060133 172
239 3300028653 Ga0265323_10059318 Ga0265323_100593182 172
240 3300028654 Ga0265322_10006239 Ga0265322_100062394 172
241 3300028666 Ga0265336_10020341 Ga0265336_100203414 172
242 3300028800 Ga0265338_10003899 Ga0265338_1000389913 172
243 3300028800 Ga0265338_10029121 Ga0265338_100291217 172
244 3300028800 Ga0265338_10035929 Ga0265338_100359294 172
245 3300028800 Ga0265338_10036613 Ga0265338_100366137 172
246 3300029957 Ga0265324_10021048 Ga0265324_100210483 172
247 3300029957 Ga0265324_10028859 Ga0265324_100288593 172
248 3300029957 Ga0265324_10086061 Ga0265324_100860612 172
249 3300031235 Ga0265330_10000639 Ga0265330_1000063927 172
250 3300031235 Ga0265330_10059201 Ga0265330_100592012 172
251 3300031235 Ga0265330_10088280 Ga0265330_100882803 172
252 3300031238 Ga0265332_10011930 Ga0265332_100119305 172
253 3300031238 Ga0265332_10146939 Ga0265332_101469392 172
254 3300031239 Ga0265328_10000260 Ga0265328_1000026016 172
255 3300031240 Ga0265320_10005160 Ga0265320_1000516010 172
256 3300031240 Ga0265320_10009679 Ga0265320_100096797 172
257 3300031241 Ga0265325_10005799 Ga0265325_100057995 172
258 3300031241 Ga0265325_10052415 Ga0265325_100524151 172
259 3300031242 Ga0265329_10000312 Ga0265329_1000031224 172
260 3300031242 Ga0265329_10013860 Ga0265329_100138604 172
261 3300031247 Ga0265340_10003471 Ga0265340_100034714 172
262 3300031249 Ga0265339_10004250 Ga0265339_100042509 172
263 3300031249 Ga0265339_10046850 Ga0265339_100468502 172
264 3300031250 Ga0265331_10006045 Ga0265331_100060454 172
265 3300031250 Ga0265331_10133259 Ga0265331_101332592 172
266 3300031251 Ga0265327_10002384 Ga0265327_100023843 172
267 3300031251 Ga0265327_10025465 Ga0265327_100254655 172
268 3300031344 Ga0265316_10017452 Ga0265316_100174527 172
269 3300031344 Ga0265316_10055780 Ga0265316_100557802 172
270 3300031344 Ga0265316_10100171 Ga0265316_101001713 172
271 3300031344 Ga0265316_10525086 Ga0265316_105250861 172
272 3300031595 Ga0265313_10006320 Ga0265313_100063208 172
273 3300031595 Ga0265313_10027719 Ga0265313_100277194 172
274 3300031595 Ga0265313_10069176 Ga0265313_100691762 172
275 3300031595 Ga0265313_10165789 Ga0265313_101657892 172
276 3300031711 Ga0265314_10004081 Ga0265314_1000408114 172
277 3300031711 Ga0265314_10021281 Ga0265314_100212817 172
278 3300031712 Ga0265342_10003116 Ga0265342_100031165 172
279 3300032002 Ga0307416_100077943 Ga0307416_1000779433 172
280 3300035091 Ga0373951_0042916 Ga0373951_0042916_115_657 172
281 3300035116 Ga0373945_0181461 Ga0373945_0181461_254_793 172
282 3300035117 Ga0373953_0129231 Ga0373953_0129231_494_1036 172
283 3300035119 Ga0373956_0060210 Ga0373956_0060210_160_699 172
284 3300035120 Ga0373957_0062019 Ga0373957_0062019_312_902 172
285 3300035170 Ga0373943_0006289 Ga0373943_0006289_265_804 172
286 3300035171 Ga0373946_0009153 Ga0373946_0009153_1724_2263 172
287 3300035172 Ga0373955_0277595 Ga0373955_0277595_429_971 172
288 3300035207 Ga0373942_0170404 Ga0373942_0170404_106_648 172
289 3300035241 Ga0373961_0045467 Ga0373961_0045467_387_929 172
290 3300035410 Ga0373924_0119261 Ga0373924_0119261_560_1099 172
291 3300035691 Ga0373931_0258338 Ga0373931_0258338_94_636 172
292 3300035692 Ga0373935_0008028 Ga0373935_0008028_2386_2925 172
293 3300035692 Ga0373935_0018888 Ga0373935_0018888_2652_3194 172
294 3300035692 Ga0373935_0344407 Ga0373935_0344407_305_844 172
295 3300035725 Ga0373947_0000125 Ga0373947_0000125_13294_13833 172
296 3300036401 Ga0373937_0001655 Ga0373937_0001655_16995_17534 172
297 3300036401 Ga0373937_0325306 Ga0373937_0325306_446_973 172
298 3300036401 Ga0373937_0553643 Ga0373937_0553643_38_565 172
299 3300037068 Ga0373925_0011706 Ga0373925_0011706_4617_5156 172
300 3300037312 Ga0395899_0072843 Ga0395899_0072843_1897_2433 172
301 3300037418 Ga0395900_0032016 Ga0395900_0032016_4786_5337 172
302 3300037418 Ga0395900_0064558 Ga0395900_0064558_587_1117 172
303 3300037418 Ga0395900_0615956 Ga0395900_0615956_154_675 172
304 3300037418 Ga0395900_0911724 Ga0395900_0911724_205_741 172
305 3300037466 Ga0395898_0043986 Ga0395898_0043986_303_833 172
306 3300037466 Ga0395898_0061347 Ga0395898_0061347_17_544 172
307 3300037466 Ga0395898_0217522 Ga0395898_0217522_1173_1709 172
308 3300037466 Ga0395898_0333920 Ga0395898_0333920_681_1199 172
309 3300037466 Ga0395898_0832588 Ga0395898_0832588_122_652 172
310 3300037466 Ga0395898_0946234 Ga0395898_0946234_86_628 172
311 3300037471 Ga0395905_0097411 Ga0395905_0097411_1104_1640 172
312 3300037471 Ga0395905_0106195 Ga0395905_0106195_755_1285 172
313 3300037471 Ga0395905_0157076 Ga0395905_0157076_494_1024 172
314 3300037471 Ga0395905_0189059 Ga0395905_0189059_1048_1599 172
315 3300038443 Ga0395901_0139498 Ga0395901_0139498_37_576 172
316 3300038443 Ga0395901_0177641 Ga0395901_0177641_1405_1935 172
317 3300038443 Ga0395901_0250201 Ga0395901_0250201_779_1315 172
318 3300038443 Ga0395901_0259428 Ga0395901_0259428_170_691 172
319 3300038443 Ga0395901_0260035 Ga0395901_0260035_722_1264 172
320 3300038443 Ga0395901_0271353 Ga0395901_0271353_704_1234 172
321 3300038443 Ga0395901_0706984 Ga0395901_0706984_62_592 172
322 3300038443 Ga0395901_0907139 Ga0395901_0907139_276_815 172
323 3300038443 Ga0395901_0915770 Ga0395901_0915770_57_584 172
324 3300038443 Ga0395901_1070703 Ga0395901_1070703_195_713 172
325 3300039438 Ga0436360_1019093 Ga0436360_1019093_1044_1583 172
326 3300042005 Ga0439448_0022099 Ga0439448_0022099_850_1377 172
327 3300042005 Ga0439448_0123607 Ga0439448_0123607_303_845 172
328 3300042438 Ga0439459_0132816 Ga0439459_0132816_61_597 172
329 3300042876 Ga0451577_0730390 Ga0451577_0730390_308_841 172
330 3300044656 Ga0466969_0176351 Ga0466969_0176351_158_697 172
331 3300044656 Ga0466969_0350520 Ga0466969_0350520_45_587 172
332 3300044658 Ga0466972_0075876 Ga0466972_0075876_403_930 172
333 3300044683 Ga0466965_0170179 Ga0466965_0170179_224_766 172
334 3300044684 Ga0466966_0005863 Ga0466966_0005863_1030_1572 172
335 3300044693 Ga0466961_0013026 Ga0466961_0013026_26_571 172
336 3300044693 Ga0466961_0063795 Ga0466961_0063795_1723_2265 172
337 3300044693 Ga0466961_0235262 Ga0466961_0235262_213_824 172
338 3300044694 Ga0466963_0000135 Ga0466963_0000135_26542_27084 172
339 3300044694 Ga0466963_0000185 Ga0466963_0000185_15664_16275 172
340 3300044694 Ga0466963_0003099 Ga0466963_0003099_3189_3794 172
341 3300044694 Ga0466963_0004811 Ga0466963_0004811_4794_5336 172
342 3300044694 Ga0466963_0011793 Ga0466963_0011793_1510_2049 172
343 3300044694 Ga0466963_0073659 Ga0466963_0073659_819_1358 172
344 3300044694 Ga0466963_0150423 Ga0466963_0150423_639_1181 172
345 3300044694 Ga0466963_0160835 Ga0466963_0160835_949_1476 172
346 3300044694 Ga0466963_0308276 Ga0466963_0308276_118_660 172
347 3300044706 Ga0466964_0000686 Ga0466964_0000686_4776_5381 172
348 3300044706 Ga0466964_0018299 Ga0466964_0018299_1340_1879 172
349 3300044706 Ga0466964_0088461 Ga0466964_0088461_726_1253 172
350 3300044719 Ga0466971_0016469 Ga0466971_0016469_83_625 172
351 3300044719 Ga0466971_0164405 Ga0466971_0164405_397_939 172
352 3300044719 Ga0466971_0237229 Ga0466971_0237229_154_693 172
353 3300044719 Ga0466971_0421935 Ga0466971_0421935_12_557 172
354 3300044735 Ga0466968_0030786 Ga0466968_0030786_1099_1626 172
355 3300044735 Ga0466968_0035090 Ga0466968_0035090_169_780 172
356 3300044735 Ga0466968_0381984 Ga0466968_0381984_130_672 172
357 3300044842 Ga0466957_0001309 Ga0466957_0001309_9673_10284 172
358 3300044842 Ga0466957_0020997 Ga0466957_0020997_3254_3796 172
359 3300044842 Ga0466957_0084573 Ga0466957_0084573_772_1314 172
360 3300044842 Ga0466957_0183886 Ga0466957_0183886_319_924 172
361 3300044901 Ga0466960_0011201 Ga0466960_0011201_2835_3440 172
362 3300044901 Ga0466960_0058882 Ga0466960_0058882_856_1398 172
363 3300044901 Ga0466960_0570051 Ga0466960_0570051_73_612 172
364 3300045049 Ga0466959_0047124 Ga0466959_0047124_168_707 172
365 3300045049 Ga0466959_0049465 Ga0466959_0049465_1276_1818 172
366 3300045051 Ga0451576_0755111 Ga0451576_0755111_281_835 172
367 3300045836 Ga0466958_0001421 Ga0466958_0001421_6011_6622 172
368 3300045836 Ga0466958_0003530 Ga0466958_0003530_6350_6892 172
369 3300045836 Ga0466958_0004915 Ga0466958_0004915_2798_3340 172
370 3300045836 Ga0466958_0029122 Ga0466958_0029122_1769_2308 172
371 3300045836 Ga0466958_0292036 Ga0466958_0292036_74_616 172
372 3300045976 Ga0466967_0000086 Ga0466967_0000086_10469_10996 172
373 3300045976 Ga0466967_0000886 Ga0466967_0000886_677_1219 172
374 3300045976 Ga0466967_0001422 Ga0466967_0001422_6252_6779 172
375 3300045976 Ga0466967_0005702 Ga0466967_0005702_4301_4840 172
376 3300045976 Ga0466967_0008784 Ga0466967_0008784_6374_6985 172
377 3300045976 Ga0466967_0017765 Ga0466967_0017765_3168_3689 172
378 3300045976 Ga0466967_0020328 Ga0466967_0020328_2967_3506 172
379 3300045976 Ga0466967_0050843 Ga0466967_0050843_653_1195 172
380 3300045976 Ga0466967_0053200 Ga0466967_0053200_2034_2573 172
381 3300045976 Ga0466967_0071889 Ga0466967_0071889_689_1228 172
382 3300045976 Ga0466967_0130011 Ga0466967_0130011_1024_1566 172
383 3300045976 Ga0466967_0208334 Ga0466967_0208334_1093_1632 172
384 3300045976 Ga0466967_0253301 Ga0466967_0253301_221_760 172
385 3300045976 Ga0466967_0274366 Ga0466967_0274366_178_705 172
386 3300045976 Ga0466967_0370454 Ga0466967_0370454_793_1332 172
387 3300045976 Ga0466967_0441011 Ga0466967_0441011_181_786 172
388 3300046454 Ga0495592_0000125 Ga0495592_0000125_14880_15419 172
389 3300046454 Ga0495592_0023488 Ga0495592_0023488_1366_1905 172
390 3300046454 Ga0495592_0036718 Ga0495592_0036718_2938_3471 172
391 3300046454 Ga0495592_0081922 Ga0495592_0081922_609_1148 172
392 3300046454 Ga0495592_0144468 Ga0495592_0144468_125_652 172
393 3300046455 Ga0495603_0006179 Ga0495603_0006179_5565_6107 172
394 3300046455 Ga0495603_0231423 Ga0495603_0231423_391_930 172
395 3300046459 Ga0495629_0236715 Ga0495629_0236715_382_921 172
396 3300046461 Ga0495641_0007350 Ga0495641_0007350_142_681 172
397 3300046461 Ga0495641_0032945 Ga0495641_0032945_131_673 172
398 3300046461 Ga0495641_0071515 Ga0495641_0071515_77_616 172
399 3300046462 Ga0495651_0000011 Ga0495651_0000011_34539_35078 172
400 3300046462 Ga0495651_0010221 Ga0495651_0010221_1270_1809 172
401 3300046462 Ga0495651_0025885 Ga0495651_0025885_3713_4255 172
402 3300046463 Ga0495653_0001602 Ga0495653_0001602_429_968 172
403 3300046463 Ga0495653_0029523 Ga0495653_0029523_700_1239 172
404 3300046463 Ga0495653_0039472 Ga0495653_0039472_201_740 172
405 3300046463 Ga0495653_0078647 Ga0495653_0078647_1124_1714 172
406 3300046463 Ga0495653_0206618 Ga0495653_0206618_91_627 172
407 3300046463 Ga0495653_0212174 Ga0495653_0212174_297_830 172
408 3300046463 Ga0495653_0421727 Ga0495653_0421727_148_690 172
409 3300046473 Ga0495582_0001075 Ga0495582_0001075_12529_13068 172
410 3300046473 Ga0495582_0033633 Ga0495582_0033633_513_1055 172
411 3300046473 Ga0495582_0078084 Ga0495582_0078084_1020_1559 172
412 3300046475 Ga0495639_0007680 Ga0495639_0007680_4083_4622 172
413 3300046476 Ga0495662_0003247 Ga0495662_0003247_7117_7656 172
414 3300046477 Ga0495664_0009793 Ga0495664_0009793_4414_4953 172
415 3300046477 Ga0495664_0064092 Ga0495664_0064092_1218_1757 172
416 3300046492 Ga0495585_0262591 Ga0495585_0262591_90_629 172
417 3300046492 Ga0495585_0294166 Ga0495585_0294166_93_620 172
418 3300046499 Ga0495594_0244607 Ga0495594_0244607_330_872 172
419 3300046501 Ga0495607_0054542 Ga0495607_0054542_472_1011 172
420 3300046501 Ga0495607_0140028 Ga0495607_0140028_195_722 172
421 3300046511 Ga0495608_0001526 Ga0495608_0001526_3884_4423 172
422 3300046511 Ga0495608_0010696 Ga0495608_0010696_3484_4023 172
423 3300046511 Ga0495608_0147827 Ga0495608_0147827_100_639 172
424 3300046514 Ga0495618_0011398 Ga0495618_0011398_970_1509 172
425 3300046514 Ga0495618_0016806 Ga0495618_0016806_3630_4169 172
426 3300046514 Ga0495618_0226276 Ga0495618_0226276_457_990 172
427 3300046516 Ga0495628_0000024 Ga0495628_0000024_15174_15713 172
428 3300046516 Ga0495628_0216592 Ga0495628_0216592_76_609 172
429 3300046516 Ga0495628_0507432 Ga0495628_0507432_103_642 172
430 3300046517 Ga0495630_0002944 Ga0495630_0002944_560_1099 172
431 3300046517 Ga0495630_0076050 Ga0495630_0076050_1081_1620 172
432 3300046517 Ga0495630_0105391 Ga0495630_0105391_948_1481 172
433 3300046517 Ga0495630_0127066 Ga0495630_0127066_722_1258 172
434 3300046517 Ga0495630_0137973 Ga0495630_0137973_889_1428 172
435 3300046517 Ga0495630_0221807 Ga0495630_0221807_97_636 172
436 3300046517 Ga0495630_0369302 Ga0495630_0369302_35_568 172
437 3300046517 Ga0495630_0386076 Ga0495630_0386076_471_1004 172
438 3300046517 Ga0495630_0393993 Ga0495630_0393993_243_770 172
439 3300046523 Ga0495644_0004460 Ga0495644_0004460_2899_3438 172
440 3300046523 Ga0495644_0036888 Ga0495644_0036888_103_627 172
441 3300046526 Ga0495666_0001078 Ga0495666_0001078_12136_12675 172
442 3300046529 Ga0495652_0000299 Ga0495652_0000299_27166_27705 172
443 3300046529 Ga0495652_0052430 Ga0495652_0052430_1706_2245 172
444 3300046529 Ga0495652_0084313 Ga0495652_0084313_714_1253 172
445 3300046529 Ga0495652_0200141 Ga0495652_0200141_443_976 172
446 3300046529 Ga0495652_0295584 Ga0495652_0295584_371_913 172
447 3300046529 Ga0495652_0756143 Ga0495652_0756143_62_595 172
448 3300046531 Ga0495665_0009951 Ga0495665_0009951_393_932 172
449 3300046533 Ga0495640_0010056 Ga0495640_0010056_2054_2593 172
450 3300046533 Ga0495640_0566594 Ga0495640_0566594_109_651 172
451 3300046535 Ga0495586_0004633 Ga0495586_0004633_421_960 172
452 3300046536 Ga0495587_0003192 Ga0495587_0003192_3122_3661 172
453 3300046536 Ga0495587_0004974 Ga0495587_0004974_6939_7478 172
454 3300046536 Ga0495587_0290182 Ga0495587_0290182_114_641 172
455 3300046537 Ga0495598_0145912 Ga0495598_0145912_62_601 172
456 3300046538 Ga0495609_0086090 Ga0495609_0086090_556_1095 172
457 3300046543 Ga0495645_0000035 Ga0495645_0000035_53284_53823 172
458 3300046559 Ga0495667_0021742 Ga0495667_0021742_2897_3436 172
459 3300046559 Ga0495667_0064029 Ga0495667_0064029_1603_2139 172
460 3300046559 Ga0495667_0123072 Ga0495667_0123072_1092_1634 172
461 3300046559 Ga0495667_0139928 Ga0495667_0139928_429_962 172
462 3300046559 Ga0495667_0166418 Ga0495667_0166418_832_1371 172
463 3300046642 Ga0495634_0038985 Ga0495634_0038985_1521_2060 172
464 3300046642 Ga0495634_0059891 Ga0495634_0059891_712_1251 172
465 3300046642 Ga0495634_0096301 Ga0495634_0096301_1138_1677 172
466 3300046642 Ga0495634_0156077 Ga0495634_0156077_431_970 172
467 3300046663 Ga0495635_0027023 Ga0495635_0027023_809_1348 172
468 3300046663 Ga0495635_0054681 Ga0495635_0054681_1770_2309 172
469 3300046663 Ga0495635_0086534 Ga0495635_0086534_412_951 172
470 3300046663 Ga0495635_0110600 Ga0495635_0110600_605_1138 172
471 3300046663 Ga0495635_0395642 Ga0495635_0395642_115_648 172
472 3300046675 Ga0495657_0053029 Ga0495657_0053029_357_896 172
473 3300046675 Ga0495657_0055510 Ga0495657_0055510_1872_2411 172
474 3300046675 Ga0495657_0068713 Ga0495657_0068713_465_1007 172
475 3300046675 Ga0495657_0134596 Ga0495657_0134596_301_843 172
476 3300046675 Ga0495657_0139952 Ga0495657_0139952_750_1283 172
477 3300046675 Ga0495657_0283496 Ga0495657_0283496_414_956 172
478 3300046678 Ga0495599_0000009 Ga0495599_0000009_64464_65003 172
479 3300046678 Ga0495599_0008788 Ga0495599_0008788_4027_4566 172
480 3300046678 Ga0495599_0040906 Ga0495599_0040906_603_1136 172
481 3300046679 Ga0495623_0000039 Ga0495623_0000039_79378_79917 172
482 3300046679 Ga0495623_0278295 Ga0495623_0278295_267_809 172
483 3300046680 Ga0495646_0135294 Ga0495646_0135294_157_696 172
484 3300046683 Ga0495658_0048287 Ga0495658_0048287_880_1419 172
485 3300046683 Ga0495658_0197922 Ga0495658_0197922_30_572 172
486 3300046689 Ga0495613_0186969 Ga0495613_0186969_101_640 172
487 3300046690 Ga0495624_0007741 Ga0495624_0007741_6337_6876 172
488 3300046690 Ga0495624_0023332 Ga0495624_0023332_647_1186 172
489 3300046690 Ga0495624_0176625 Ga0495624_0176625_494_1033 172
490 3300046794 Ga0495589_0049015 Ga0495589_0049015_711_1250 172
491 3300046809 Ga0495600_0029214 Ga0495600_0029214_1453_1992 172
492 3300046809 Ga0495600_0127598 Ga0495600_0127598_498_1031 172
493 3300046809 Ga0495600_0189449 Ga0495600_0189449_50_589 172
494 3300046809 Ga0495600_0543175 Ga0495600_0543175_121_654 172
495 3300047315 Ga0495581_0003524 Ga0495581_0003524_4083_4622 172
496 3300047317 Ga0495604_0000847 Ga0495604_0000847_21117_21656 172
497 3300047317 Ga0495604_0189087 Ga0495604_0189087_312_902 172
498 3300047318 Ga0495636_0309901 Ga0495636_0309901_203_730 172
499 3300047319 Ga0495674_0012370 Ga0495674_0012370_946_1485 172
500 3300047319 Ga0495674_0018066 Ga0495674_0018066_5466_6005 172
501 3300047319 Ga0495674_0087433 Ga0495674_0087433_2022_2561 172
502 3300047319 Ga0495674_0091756 Ga0495674_0091756_1130_1663 172
503 3300047319 Ga0495674_0289421 Ga0495674_0289421_45_572 172
504 3300047319 Ga0495674_0834111 Ga0495674_0834111_44_583 172
505 3300047319 Ga0495674_1153340 Ga0495674_1153340_29_562 172
506 3300047321 Ga0495676_0019590 Ga0495676_0019590_4414_4953 172
507 3300047321 Ga0495676_0044097 Ga0495676_0044097_2009_2548 172
508 3300047321 Ga0495676_0098224 Ga0495676_0098224_764_1303 172
509 3300047322 Ga0495680_0003362 Ga0495680_0003362_9737_10276 172
510 3300047322 Ga0495680_0009330 Ga0495680_0009330_6148_6687 172
511 3300047322 Ga0495680_0046273 Ga0495680_0046273_1875_2417 172
512 3300047322 Ga0495680_0102466 Ga0495680_0102466_1178_1717 172
513 3300047322 Ga0495680_0210767 Ga0495680_0210767_793_1326 172
514 3300047322 Ga0495680_0288440 Ga0495680_0288440_128_661 172
515 3300047444 Ga0495675_0000137 Ga0495675_0000137_49336_49875 172
516 3300047444 Ga0495675_0220882 Ga0495675_0220882_419_958 172
517 3300047444 Ga0495675_0286259 Ga0495675_0286259_413_955 172
518 3300047445 Ga0495677_0081275 Ga0495677_0081275_493_1032 172
519 3300047471 Ga0495684_0022569 Ga0495684_0022569_1122_1661 172
520 3300047471 Ga0495684_0025357 Ga0495684_0025357_1641_2180 172
521 3300047471 Ga0495684_0026959 Ga0495684_0026959_3002_3544 172
522 3300047471 Ga0495684_0043100 Ga0495684_0043100_1800_2339 172
523 3300047471 Ga0495684_0118618 Ga0495684_0118618_102_644 172
524 3300047471 Ga0495684_0120812 Ga0495684_0120812_421_960 172
525 3300047471 Ga0495684_0191735 Ga0495684_0191735_394_927 172
526 3300047471 Ga0495684_0227029 Ga0495684_0227029_694_1227 172
527 3300047471 Ga0495684_0552623 Ga0495684_0552623_35_568 172
528 3300047673 Ga0495593_0001553 Ga0495593_0001553_1081_1620 172
529 3300047673 Ga0495593_0022548 Ga0495593_0022548_11_547 172
530 3300048088 Ga0495602_0003800 Ga0495602_0003800_7286_7825 172
531 3300048088 Ga0495602_0108840 Ga0495602_0108840_468_1010 172
532 3300048088 Ga0495602_0215065 Ga0495602_0215065_857_1396 172
533 3300048088 Ga0495602_0297614 Ga0495602_0297614_345_884 172
534 3300048903 Ga0496100_0034608 Ga0496100_0034608_411_953 172
535 3300048904 Ga0496101_0941789 Ga0496101_0941789_143_670 172
536 3300048905 Ga0496102_0008326 Ga0496102_0008326_4499_5038 172
537 3300048905 Ga0496102_0117360 Ga0496102_0117360_251_793 172
538 3300048906 Ga0496103_0002930 Ga0496103_0002930_1240_1779 172
539 3300048906 Ga0496103_0017357 Ga0496103_0017357_3624_4166 172
540 3300048906 Ga0496103_0467888 Ga0496103_0467888_145_678 172
541 3300048907 Ga0496104_0000796 Ga0496104_0000796_24325_24858 172
542 3300048907 Ga0496104_0068003 Ga0496104_0068003_1370_1909 172
543 3300048907 Ga0496104_0075320 Ga0496104_0075320_475_1017 172
544 3300048907 Ga0496104_0129120 Ga0496104_0129120_1095_1634 172
545 3300048907 Ga0496104_0307670 Ga0496104_0307670_475_1014 172
546 3300048908 Ga0496105_0005625 Ga0496105_0005625_3881_4420 172
547 3300048908 Ga0496105_0010287 Ga0496105_0010287_2809_3342 172
548 3300048908 Ga0496105_0041730 Ga0496105_0041730_417_956 172
549 3300048908 Ga0496105_0095477 Ga0496105_0095477_1557_2099 172
550 3300048908 Ga0496105_0279102 Ga0496105_0279102_478_1017 172
551 3300048908 Ga0496105_0391469 Ga0496105_0391469_519_1058 172
552 3300048909 Ga0496106_0001399 Ga0496106_0001399_8554_9087 172
553 3300048909 Ga0496106_0033733 Ga0496106_0033733_1988_2530 172
554 3300048910 Ga0496107_0000426 Ga0496107_0000426_16089_16622 172
555 3300048910 Ga0496107_0155947 Ga0496107_0155947_980_1522 172
556 3300048911 Ga0496108_0117528 Ga0496108_0117528_568_1110 172
557 3300048911 Ga0496108_0174487 Ga0496108_0174487_1224_1763 172
558 3300048911 Ga0496108_0211983 Ga0496108_0211983_917_1450 172
559 3300048912 Ga0496109_0002033 Ga0496109_0002033_1183_1722 172
560 3300048912 Ga0496109_0060856 Ga0496109_0060856_2691_3230 172
561 3300048912 Ga0496109_0073103 Ga0496109_0073103_2305_2847 172
562 3300048912 Ga0496109_0246097 Ga0496109_0246097_484_1023 172
563 3300048912 Ga0496109_0571545 Ga0496109_0571545_421_960 172
564 3300048913 Ga0496110_0035511 Ga0496110_0035511_1735_2277 172
565 3300048913 Ga0496110_0426511 Ga0496110_0426511_77_616 172
566 3300048913 Ga0496110_0546554 Ga0496110_0546554_217_750 172
567 3300048914 Ga0496111_0030439 Ga0496111_0030439_2255_2797 172
568 3300048914 Ga0496111_0212220 Ga0496111_0212220_873_1412 172
569 3300048914 Ga0496111_0388930 Ga0496111_0388930_169_717 172
570 3300048914 Ga0496111_0403470 Ga0496111_0403470_50_577 172
571 3300048915 Ga0496112_0013153 Ga0496112_0013153_5610_6146 172
572 3300048915 Ga0496112_0013970 Ga0496112_0013970_721_1254 172
573 3300048915 Ga0496112_0123433 Ga0496112_0123433_444_977 172
574 3300048915 Ga0496112_0294886 Ga0496112_0294886_562_1101 172
575 3300048915 Ga0496112_0335662 Ga0496112_0335662_562_1098 172
576 3300048915 Ga0496112_0406787 Ga0496112_0406787_135_668 172
577 3300048915 Ga0496112_1254974 Ga0496112_1254974_93_626 172
578 3300048915 Ga0496112_1547786 Ga0496112_1547786_16_555 172
579 3300048916 Ga0496113_0102392 Ga0496113_0102392_792_1331 172
580 3300048916 Ga0496113_0194434 Ga0496113_0194434_894_1433 172
581 3300048916 Ga0496113_0236430 Ga0496113_0236430_39_581 172
582 3300048916 Ga0496113_1148244 Ga0496113_1148244_52_588 172
583 3300048917 Ga0496114_0051067 Ga0496114_0051067_2698_3240 172
584 3300048917 Ga0496114_0068794 Ga0496114_0068794_566_1105 172
585 3300048918 Ga0496115_0003499 Ga0496115_0003499_4598_5137 172
586 3300048918 Ga0496115_0206057 Ga0496115_0206057_70_609 172
587 3300048918 Ga0496115_0221175 Ga0496115_0221175_47_589 172
588 3300048918 Ga0496115_0809884 Ga0496115_0809884_60_599 172
589 3300049568 Ga0501031_0001066 Ga0501031_0001066_1448_1990 172
590 3300049569 Ga0501032_0005293 Ga0501032_0005293_7879_8421 172
591 3300049570 Ga0501033_0002948 Ga0501033_0002948_3297_3839 172
592 3300049571 Ga0501034_0073663 Ga0501034_0073663_2471_3013 172
593 3300049572 Ga0501036_0000227 Ga0501036_0000227_31406_31948 172
594 3300049573 Ga0501037_0000071 Ga0501037_0000071_90369_90911 172
595 3300049574 Ga0501038_0002331 Ga0501038_0002331_15496_16038 172
596 3300049575 Ga0501039_0000817 Ga0501039_0000817_13378_13920 172
597 3300049576 Ga0501040_0000444 Ga0501040_0000444_17964_18506 172
598 3300049576 Ga0501040_0621670 Ga0501040_0621670_176_715 172
599 3300049577 Ga0501041_0000836 Ga0501041_0000836_8178_8720 172
600 3300049578 Ga0501042_0000314 Ga0501042_0000314_8366_8908 172
601 3300049578 Ga0501042_0427123 Ga0501042_0427123_257_796 172
602 3300049579 Ga0501043_0000898 Ga0501043_0000898_2025_2567 172
603 3300049580 Ga0501046_0000158 Ga0501046_0000158_29490_30032 172
604 3300049580 Ga0501046_0270674 Ga0501046_0270674_651_1190 172
605 3300049581 Ga0501047_0004798 Ga0501047_0004798_3169_3711 172
606 3300049582 Ga0501048_0002270 Ga0501048_0002270_8178_8720 172
607 3300049583 Ga0501067_0128965 Ga0501067_0128965_741_1280 172
608 3300049583 Ga0501067_0396748 Ga0501067_0396748_138_665 172
609 3300049584 Ga0501068_0000071 Ga0501068_0000071_36593_37135 172
610 3300049585 Ga0501069_0005870 Ga0501069_0005870_963_1502 172
611 3300049585 Ga0501069_0026069 Ga0501069_0026069_2486_3028 172
612 3300049586 Ga0501070_0003160 Ga0501070_0003160_2540_3082 172
613 3300049586 Ga0501070_0384456 Ga0501070_0384456_399_938 172
614 3300049587 Ga0501071_0087510 Ga0501071_0087510_226_768 172
615 3300049587 Ga0501071_0109694 Ga0501071_0109694_861_1403 172
616 3300049588 Ga0501072_0005409 Ga0501072_0005409_2773_3315 172
617 3300049588 Ga0501072_0937709 Ga0501072_0937709_34_576 172
618 3300049589 Ga0501073_0181751 Ga0501073_0181751_898_1440 172
619 3300049590 Ga0501074_0000343 Ga0501074_0000343_14521_15063 172
620 3300049591 Ga0501075_0005968 Ga0501075_0005968_505_1047 172
621 3300049592 Ga0501076_0000241 Ga0501076_0000241_29494_30036 172
622 3300049593 Ga0501077_0003562 Ga0501077_0003562_8440_8982 172
623 3300049593 Ga0501077_0287967 Ga0501077_0287967_137_676 172
624 3300049741 Ga0501079_0001771 Ga0501079_0001771_12206_12748 172
625 3300049742 Ga0501080_0000443 Ga0501080_0000443_4524_5066 172
626 3300049743 Ga0501081_0019765 Ga0501081_0019765_614_1156 172
627 3300049744 Ga0501083_0003766 Ga0501083_0003766_6799_7341 172
628 3300049822 Ga0501035_0000856 Ga0501035_0000856_2101_2643 172
629 3300049823 Ga0501044_0041027 Ga0501044_0041027_677_1219 172
630 3300049824 Ga0501045_0008611 Ga0501045_0008611_5051_5593 172
631 3300049824 Ga0501045_0452089 Ga0501045_0452089_43_582 172
632 3300050507 nmdc:mga05p37_735541_c1 nmdc:mga05p37_735541_c1_516_1055 172
633 3300050510 nmdc:mga06r32_1207448_c1 nmdc:mga06r32_1207448_c1_105_638 172
634 3300050511 nmdc:mga08y16_16438_c1 nmdc:mga08y16_16438_c1_5706_6278 172
635 3300050512 nmdc:mga0n895_731111_c1 nmdc:mga0n895_731111_c1_321_854 172
636 3300050512 nmdc:mga0n895_7837_c1 nmdc:mga0n895_7837_c1_7286_7825 172
637 3300050512 nmdc:mga0n895_92559_c1 nmdc:mga0n895_92559_c1_136_672 172
638 3300050513 nmdc:mga0rr50_88365_c1 nmdc:mga0rr50_88365_c1_1150_1689 172
639 3300050514 nmdc:mga08x19_100416_c1 nmdc:mga08x19_100416_c1_385_924 172
640 3300053077 Ga0495601_0000659 Ga0495601_0000659_709_1248 172
641 3300053077 Ga0495601_0031959 Ga0495601_0031959_2463_2996 172
642 3300053077 Ga0495601_0063206 Ga0495601_0063206_1536_2069 172
643 3300053077 Ga0495601_0119269 Ga0495601_0119269_469_1008 172
644 3300053077 Ga0495601_0663415 Ga0495601_0663415_65_592 172
645 3300053084 Ga0495595_0002860 Ga0495595_0002860_4333_4872 172
646 3300053084 Ga0495595_0040232 Ga0495595_0040232_865_1407 172
647 3300053084 Ga0495595_0062812 Ga0495595_0062812_697_1236 172
648 3300053084 Ga0495595_0076177 Ga0495595_0076177_312_845 172
649 3300053084 Ga0495595_0166210 Ga0495595_0166210_435_1001 172
650 3300053085 Ga0495619_0001721 Ga0495619_0001721_1962_2501 172
651 3300053085 Ga0495619_0024348 Ga0495619_0024348_2352_2891 172
652 3300053085 Ga0495619_0028120 Ga0495619_0028120_2731_3264 172
653 3300053085 Ga0495619_0057818 Ga0495619_0057818_420_959 172
654 3300053085 Ga0495619_0240886 Ga0495619_0240886_47_589 172
655 3300054114 Ga0501084_0000072 Ga0501084_0000072_68125_68667 172
656 3300054114 Ga0501084_0377334 Ga0501084_0377334_429_968 172
657 3300059424 Ga0590075_022267 Ga0590075_022267_666_1208 172
658 3300060353 Ga0501082_0000605 Ga0501082_0000605_15673_16215 172
659 3300060353 Ga0501082_0584063 Ga0501082_0584063_312_851 172
660 3300061719 Ga0466962_0004904 Ga0466962_0004904_4097_4639 172
661 3300061719 Ga0466962_0013058 Ga0466962_0013058_1403_1945 172
662 3300061719 Ga0466962_0017064 Ga0466962_0017064_572_1183 172
663 3300061734 Ga0530510_0003067 Ga0530510_0003067_676_1218 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

3

178

0.92

PF05175

MTS

Methyltransferase small domain

34

173

0.82

PF13847

Methyltransf_31

Methyltransferase domain

40

181

0.81

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

32

150

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.9243 1 170
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.9209 1 171
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.9106 1 171
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.9089 1 170
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.9003 29 171
ID Description Score Start End Superfamily
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9179 1 170 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9047 37 102 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9025 1 170 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9012 25 171 3.40.50.150
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9003 1 172 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V9EHG4-F1-model_v4 RsmD family RNA methyltransferase 0.9903 33 172 GO:0008168
GO:0031167
AF-A0A538IHI6-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) 0.98 1 171 GO:0003676
GO:0052913
AF-A0A2V6IS55-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9695 1 102 GO:0008168
GO:0031167
AF-A0A538AEX8-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) 0.9694 1 171 GO:0003676
GO:0052913
AF-A0A538IHI6-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) 0.9688 1 171 GO:0003676
GO:0052913

Feature Viewer

pLDDT pTM Quality
94.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map