F473522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 364 | 1324 | 213 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8002784119|8002784710 |
| Length | 253 |
| Sequence | RQRRGQGRSQPVVAPVPDPAETPDAARPVAAAGERARAGERTAIHVLVVDDHPVVRSGLVGMLASQPDLRVVGTAADGHEAVARAGELRPDVVLMDLRMPRLDGVAAIERITAAGPDVAVLVLTTYDGDADIVRAVAAGAAGYLLKDAPLETLAEAVRAVARGETVLAPPVAARLASRLRAPDPVTLTRRETEVLAAVARGRTNAEIGRELFIGEATVKTHLLRVFAKLQVDDRTHAVTAALERGLLPPITPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 182 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 183 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 184 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 212 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 213 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 214 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 215 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 218 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 219 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 222 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 223 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 287 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 333 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 334 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 335 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 341 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 342 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 343 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 344 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 345 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 346 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 347 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 348 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 349 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 350 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 351 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 352 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 353 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 354 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 355 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 356 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 357 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 358 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 359 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 360 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 361 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 362 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 363 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 364 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.62 |
| Metatranscriptomes | 0.76 |
| Isolates | 3.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.96 |
| Nodule | 1.06 |
| Rhizoplane | 7.25 |
| Rhizosphere | 85.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10038865 | 3300001990 | Bacteria | 1464 |
| 2 | JGI24751J29686_10015166 | 3300002459 | Bacteria | 1590 |
| 3 | JGI25160J50197_1008780 | 3300003354 | Bacteria | 3818 |
| 4 | JGI25160J50197_1017210 | 3300003354 | Bacteria | 2299 |
| 5 | JGI25160J50197_1033197 | 3300003354 | Bacteria | 1301 |
| 6 | Ga0070658_10062274 | 3300005327 | Bacteria | 3040 |
| 7 | Ga0070658_10777474 | 3300005327 | Bacteria | 832 |
| 8 | Ga0070683_100001738 | 3300005329 | Bacteria | 16950 |
| 9 | Ga0070683_100004489 | 3300005329 | Bacteria | 11509 |
| 10 | Ga0070683_100163218 | 3300005329 | Bacteria | 2114 |
| 11 | Ga0070683_100228139 | 3300005329 | Bacteria | 1770 |
| 12 | Ga0070683_100683171 | 3300005329 | Bacteria | 983 |
| 13 | Ga0070670_100042340 | 3300005331 | Bacteria | 3914 |
| 14 | Ga0068869_100003397 | 3300005334 | Bacteria | 9721 |
| 15 | Ga0070680_100003706 | 3300005336 | Bacteria | 11416 |
| 16 | Ga0070682_100001094 | 3300005337 | Bacteria | 15563 |
| 17 | Ga0070682_100018782 | 3300005337 | Bacteria | 4048 |
| 18 | Ga0070682_100153233 | 3300005337 | Bacteria | 1584 |
| 19 | Ga0070682_100311607 | 3300005337 | Bacteria | 1159 |
| 20 | Ga0068868_100001681 | 3300005338 | Bacteria | 15126 |
| 21 | Ga0068868_100058962 | 3300005338 | Bacteria | 3035 |
| 22 | Ga0068868_100356984 | 3300005338 | Bacteria | 1253 |
| 23 | Ga0070660_100008931 | 3300005339 | Bacteria | 7029 |
| 24 | Ga0070660_100012443 | 3300005339 | Bacteria | 6076 |
| 25 | Ga0070660_100116385 | 3300005339 | Bacteria | 2132 |
| 26 | Ga0070660_100299761 | 3300005339 | Bacteria | 1318 |
| 27 | Ga0070660_100806141 | 3300005339 | Bacteria | 790 |
| 28 | Ga0070689_100003919 | 3300005340 | Bacteria | 9978 |
| 29 | Ga0070691_10005630 | 3300005341 | Bacteria | 5707 |
| 30 | Ga0070661_100010988 | 3300005344 | Bacteria | 6310 |
| 31 | Ga0070661_100027442 | 3300005344 | Bacteria | 4100 |
| 32 | Ga0070661_100139768 | 3300005344 | Bacteria | 1824 |
| 33 | Ga0070692_10024328 | 3300005345 | Bacteria | 2975 |
| 34 | Ga0070668_100265376 | 3300005347 | Bacteria | 1429 |
| 35 | Ga0070668_100674367 | 3300005347 | Bacteria | 910 |
| 36 | Ga0070675_100002108 | 3300005354 | Bacteria | 14706 |
| 37 | Ga0070675_100040060 | 3300005354 | Bacteria | 3824 |
| 38 | Ga0070673_100768440 | 3300005364 | Bacteria | 888 |
| 39 | Ga0070659_100015785 | 3300005366 | Bacteria | 5661 |
| 40 | Ga0070659_100034579 | 3300005366 | Bacteria | 3931 |
| 41 | Ga0070659_100311482 | 3300005366 | Bacteria | 1315 |
| 42 | Ga0070667_100034753 | 3300005367 | Bacteria | 4220 |
| 43 | Ga0070709_10034950 | 3300005434 | Bacteria | 3052 |
| 44 | Ga0070714_100070945 | 3300005435 | Bacteria | 3012 |
| 45 | Ga0070714_100134385 | 3300005435 | Bacteria | 2213 |
| 46 | Ga0070713_100007764 | 3300005436 | Bacteria | 7556 |
| 47 | Ga0070710_10095728 | 3300005437 | Bacteria | 1759 |
| 48 | Ga0070711_100117227 | 3300005439 | Bacteria | 1963 |
| 49 | Ga0070705_100224777 | 3300005440 | Bacteria | 1302 |
| 50 | Ga0070700_100008843 | 3300005441 | Bacteria | 5502 |
| 51 | Ga0070700_100037211 | 3300005441 | Bacteria | 2958 |
| 52 | Ga0070694_100795112 | 3300005444 | Bacteria | 775 |
| 53 | Ga0070663_100006816 | 3300005455 | Bacteria | 6907 |
| 54 | Ga0070663_100022066 | 3300005455 | Bacteria | 4248 |
| 55 | Ga0070663_100036176 | 3300005455 | Bacteria | 3430 |
| 56 | Ga0070678_100002551 | 3300005456 | Bacteria | 9995 |
| 57 | Ga0070678_100058943 | 3300005456 | Bacteria | 2820 |
| 58 | Ga0070678_100537889 | 3300005456 | Bacteria | 1036 |
| 59 | Ga0070662_100041582 | 3300005457 | Bacteria | 3280 |
| 60 | Ga0070681_10047279 | 3300005458 | Bacteria | 4301 |
| 61 | Ga0068867_100128987 | 3300005459 | Bacteria | 1963 |
| 62 | Ga0068867_100149537 | 3300005459 | Bacteria | 1833 |
| 63 | Ga0070685_10370265 | 3300005466 | Bacteria | 984 |
| 64 | Ga0070707_100187762 | 3300005468 | Bacteria | 2015 |
| 65 | Ga0070679_100110878 | 3300005530 | Bacteria | 2730 |
| 66 | Ga0070679_100199567 | 3300005530 | Bacteria | 1967 |
| 67 | Ga0070679_100605689 | 3300005530 | Bacteria | 1039 |
| 68 | Ga0070684_100000511 | 3300005535 | Bacteria | 26664 |
| 69 | Ga0070684_100002222 | 3300005535 | Bacteria | 14315 |
| 70 | Ga0070684_100010931 | 3300005535 | Bacteria | 7214 |
| 71 | Ga0070684_100068030 | 3300005535 | Bacteria | 3130 |
| 72 | Ga0070684_100216087 | 3300005535 | Bacteria | 1748 |
| 73 | Ga0068853_100078231 | 3300005539 | Bacteria | 2890 |
| 74 | Ga0068853_100079086 | 3300005539 | Bacteria | 2875 |
| 75 | Ga0070696_100002372 | 3300005546 | Bacteria | 12454 |
| 76 | Ga0070693_100107368 | 3300005547 | Bacteria | 1711 |
| 77 | Ga0070665_100004127 | 3300005548 | Bacteria | 15284 |
| 78 | Ga0070665_100410690 | 3300005548 | Bacteria | 1362 |
| 79 | Ga0068855_100038737 | 3300005563 | Bacteria | 5663 |
| 80 | Ga0068855_100337476 | 3300005563 | Bacteria | 1662 |
| 81 | Ga0070664_100000640 | 3300005564 | Bacteria | 26835 |
| 82 | Ga0070664_100018286 | 3300005564 | Bacteria | 5754 |
| 83 | Ga0070664_100117237 | 3300005564 | Bacteria | 2329 |
| 84 | Ga0070664_100161203 | 3300005564 | Bacteria | 1984 |
| 85 | Ga0070664_100239831 | 3300005564 | Bacteria | 1627 |
| 86 | Ga0068857_100042238 | 3300005577 | Bacteria | 4044 |
| 87 | Ga0068857_100060824 | 3300005577 | Bacteria | 3355 |
| 88 | Ga0068857_100062510 | 3300005577 | Bacteria | 3310 |
| 89 | Ga0068857_100199804 | 3300005577 | Bacteria | 1822 |
| 90 | Ga0068854_100019008 | 3300005578 | Bacteria | 4622 |
| 91 | Ga0068854_100071902 | 3300005578 | Bacteria | 2532 |
| 92 | Ga0068856_100010898 | 3300005614 | Bacteria | 8824 |
| 93 | Ga0068856_100015263 | 3300005614 | Bacteria | 7421 |
| 94 | Ga0068856_100016808 | 3300005614 | Bacteria | 7089 |
| 95 | Ga0068856_100159210 | 3300005614 | Bacteria | 2268 |
| 96 | Ga0068856_100220939 | 3300005614 | Bacteria | 1910 |
| 97 | Ga0070702_100001410 | 3300005615 | Bacteria | 9817 |
| 98 | Ga0070702_100006155 | 3300005615 | Bacteria | 5658 |
| 99 | Ga0070702_100121899 | 3300005615 | Bacteria | 1634 |
| 100 | Ga0068852_100007588 | 3300005616 | Bacteria | 7930 |
| 101 | Ga0068852_100034602 | 3300005616 | Bacteria | 4205 |
| 102 | Ga0068852_100066764 | 3300005616 | Bacteria | 3142 |
| 103 | Ga0068852_100757746 | 3300005616 | Bacteria | 983 |
| 104 | Ga0068859_100000197 | 3300005617 | Bacteria | 58973 |
| 105 | Ga0068859_100057833 | 3300005617 | Bacteria | 3906 |
| 106 | Ga0068859_100600100 | 3300005617 | Bacteria | 1194 |
| 107 | Ga0068864_100011626 | 3300005618 | Bacteria | 7269 |
| 108 | Ga0068864_100519414 | 3300005618 | Bacteria | 1148 |
| 109 | Ga0068861_100829180 | 3300005719 | Bacteria | 870 |
| 110 | Ga0068851_10056523 | 3300005834 | Bacteria | 2002 |
| 111 | Ga0068870_10002431 | 3300005840 | Bacteria | 7751 |
| 112 | Ga0068863_100005938 | 3300005841 | Bacteria | 11975 |
| 113 | Ga0068863_100114011 | 3300005841 | Bacteria | 2575 |
| 114 | Ga0068858_100077004 | 3300005842 | Bacteria | 3098 |
| 115 | Ga0068858_100911117 | 3300005842 | Bacteria | 860 |
| 116 | Ga0068860_100051241 | 3300005843 | Bacteria | 3928 |
| 117 | Ga0068860_100523335 | 3300005843 | Bacteria | 1186 |
| 118 | Ga0068862_100000297 | 3300005844 | Bacteria | 54476 |
| 119 | Ga0081455_10002158 | 3300005937 | Bacteria | 23486 |
| 120 | Ga0081455_10010049 | 3300005937 | Bacteria | 9661 |
| 121 | Ga0081455_10016539 | 3300005937 | Bacteria | 7117 |
| 122 | Ga0081455_10064765 | 3300005937 | Bacteria | 3059 |
| 123 | Ga0081455_10159266 | 3300005937 | Bacteria | 1732 |
| 124 | Ga0081455_10385110 | 3300005937 | Bacteria | 978 |
| 125 | Ga0081539_10012271 | 3300005985 | Bacteria | 6637 |
| 126 | Ga0081539_10019168 | 3300005985 | Bacteria | 4695 |
| 127 | Ga0070717_10337119 | 3300006028 | Bacteria | 1346 |
| 128 | Ga0075363_100159145 | 3300006048 | Bacteria | 1278 |
| 129 | Ga0070712_100237298 | 3300006175 | Bacteria | 1451 |
| 130 | Ga0070712_100306480 | 3300006175 | Bacteria | 1287 |
| 131 | Ga0070712_100579964 | 3300006175 | Bacteria | 947 |
| 132 | Ga0068871_100307983 | 3300006358 | Bacteria | 1392 |
| 133 | Ga0068871_100422753 | 3300006358 | Bacteria | 1190 |
| 134 | Ga0075428_100000105 | 3300006844 | Bacteria | 70978 |
| 135 | Ga0075430_100046796 | 3300006846 | Bacteria | 3653 |
| 136 | Ga0075431_100187747 | 3300006847 | Bacteria | 2119 |
| 137 | Ga0075431_100478972 | 3300006847 | Bacteria | 1238 |
| 138 | Ga0075431_100593843 | 3300006847 | Bacteria | 1092 |
| 139 | Ga0075433_10003466 | 3300006852 | Bacteria | 12177 |
| 140 | Ga0075434_100004744 | 3300006871 | Bacteria | 12296 |
| 141 | Ga0075429_100216773 | 3300006880 | Bacteria | 1677 |
| 142 | Ga0068865_100024849 | 3300006881 | Bacteria | 3935 |
| 143 | Ga0075436_100002226 | 3300006914 | Bacteria | 13397 |
| 144 | Ga0097620_100000197 | 3300006931 | Bacteria | 58973 |
| 145 | Ga0097620_100057833 | 3300006931 | Bacteria | 3906 |
| 146 | Ga0097620_100600169 | 3300006931 | Bacteria | 1194 |
| 147 | Ga0099826_10172025 | 3300006948 | Bacteria | 1215 |
| 148 | Ga0075435_100005988 | 3300007076 | Bacteria | 8557 |
| 149 | Ga0105240_10175291 | 3300009093 | Bacteria | 2535 |
| 150 | Ga0111539_10000437 | 3300009094 | Bacteria | 52636 |
| 151 | Ga0111539_10063537 | 3300009094 | Bacteria | 4368 |
| 152 | Ga0105245_10000733 | 3300009098 | Bacteria | 29565 |
| 153 | Ga0105245_10063226 | 3300009098 | Bacteria | 3341 |
| 154 | Ga0105245_10066228 | 3300009098 | Bacteria | 3269 |
| 155 | Ga0105245_10337587 | 3300009098 | Bacteria | 1489 |
| 156 | Ga0105245_10340943 | 3300009098 | Bacteria | 1482 |
| 157 | Ga0105245_10400164 | 3300009098 | Bacteria | 1372 |
| 158 | Ga0105245_10575946 | 3300009098 | Bacteria | 1150 |
| 159 | Ga0105247_10118521 | 3300009101 | Bacteria | 1712 |
| 160 | Ga0114129_10136255 | 3300009147 | Bacteria | 3369 |
| 161 | Ga0114129_11152001 | 3300009147 | Bacteria | 968 |
| 162 | Ga0114129_11805338 | 3300009147 | Bacteria | 744 |
| 163 | Ga0105243_10091071 | 3300009148 | Bacteria | 2511 |
| 164 | Ga0105243_10107937 | 3300009148 | Bacteria | 2323 |
| 165 | Ga0105243_10124326 | 3300009148 | Bacteria | 2180 |
| 166 | Ga0105243_10185041 | 3300009148 | Bacteria | 1815 |
| 167 | Ga0105243_10534713 | 3300009148 | Bacteria | 1117 |
| 168 | Ga0105241_10002283 | 3300009174 | Bacteria | 14411 |
| 169 | Ga0105248_10000035 | 3300009177 | Bacteria | 187578 |
| 170 | Ga0105248_10547651 | 3300009177 | Bacteria | 1305 |
| 171 | Ga0105237_10085375 | 3300009545 | Bacteria | 3146 |
| 172 | Ga0105238_10055000 | 3300009551 | Bacteria | 3996 |
| 173 | Ga0105249_10005312 | 3300009553 | Bacteria | 11120 |
| 174 | Ga0105249_10015419 | 3300009553 | Bacteria | 6763 |
| 175 | Ga0105249_10103789 | 3300009553 | Bacteria | 2678 |
| 176 | Ga0105239_10008499 | 3300010375 | Bacteria | 11672 |
| 177 | Ga0105239_10270085 | 3300010375 | Bacteria | 1913 |
| 178 | Ga0105246_10000885 | 3300011119 | Bacteria | 17178 |
| 179 | Ga0105246_10006167 | 3300011119 | Bacteria | 7318 |
| 180 | Ga0105246_10175139 | 3300011119 | Bacteria | 1647 |
| 181 | Ga0157373_10014822 | 3300013100 | Bacteria | 5710 |
| 182 | Ga0157371_10006408 | 3300013102 | Bacteria | 9721 |
| 183 | Ga0157370_10042656 | 3300013104 | Bacteria | 4370 |
| 184 | Ga0157370_10368056 | 3300013104 | Bacteria | 1324 |
| 185 | Ga0157370_10417784 | 3300013104 | Bacteria | 1234 |
| 186 | Ga0157370_10634672 | 3300013104 | Bacteria | 977 |
| 187 | Ga0157369_10032721 | 3300013105 | Bacteria | 5715 |
| 188 | Ga0157369_10067130 | 3300013105 | Bacteria | 3857 |
| 189 | Ga0157369_10070947 | 3300013105 | Bacteria | 3741 |
| 190 | Ga0157369_10178740 | 3300013105 | Bacteria | 2233 |
| 191 | Ga0157369_10181758 | 3300013105 | Bacteria | 2213 |
| 192 | Ga0157369_10200340 | 3300013105 | Bacteria | 2096 |
| 193 | Ga0157374_10039998 | 3300013296 | Bacteria | 4317 |
| 194 | Ga0163162_10005345 | 3300013306 | Bacteria | 12396 |
| 195 | Ga0163162_10253034 | 3300013306 | Bacteria | 1893 |
| 196 | Ga0163162_10298903 | 3300013306 | Bacteria | 1742 |
| 197 | Ga0163162_10755226 | 3300013306 | Bacteria | 1092 |
| 198 | Ga0157372_10010635 | 3300013307 | Bacteria | 9791 |
| 199 | Ga0157372_10056102 | 3300013307 | Bacteria | 4402 |
| 200 | Ga0157375_10074544 | 3300013308 | Bacteria | 3415 |
| 201 | Ga0157375_10784867 | 3300013308 | Bacteria | 1102 |
| 202 | Ga0163163_10002844 | 3300014325 | Bacteria | 14636 |
| 203 | Ga0163163_10007533 | 3300014325 | Bacteria | 9611 |
| 204 | Ga0163163_10178782 | 3300014325 | Bacteria | 2169 |
| 205 | Ga0163163_10257480 | 3300014325 | Bacteria | 1796 |
| 206 | Ga0163163_10260348 | 3300014325 | Bacteria | 1785 |
| 207 | Ga0163163_10482268 | 3300014325 | Bacteria | 1301 |
| 208 | Ga0157380_10540447 | 3300014326 | Bacteria | 1141 |
| 209 | Ga0157380_11394080 | 3300014326 | Bacteria | 751 |
| 210 | Ga0157377_10003289 | 3300014745 | Bacteria | 7295 |
| 211 | Ga0157377_10038236 | 3300014745 | Bacteria | 2648 |
| 212 | Ga0157377_10388339 | 3300014745 | Bacteria | 947 |
| 213 | Ga0157379_10040880 | 3300014968 | Bacteria | 4139 |
| 214 | Ga0157379_10181742 | 3300014968 | Bacteria | 1900 |
| 215 | Ga0182007_10000669 | 3300015262 | Bacteria | 19672 |
| 216 | Ga0206354_11474104 | 3300020081 | Bacteria | 2215 |
| 217 | Ga0206354_11514635 | 3300020081 | Bacteria | 1909 |
| 218 | Ga0206353_10019210 | 3300020082 | Bacteria | 3074 |
| 219 | Ga0206353_11238337 | 3300020082 | Bacteria | 2162 |
| 220 | Ga0206353_11412544 | 3300020082 | Bacteria | 1013 |
| 221 | Ga0207426_1001409 | 3300025302 | Bacteria | 20144 |
| 222 | Ga0207426_1008328 | 3300025302 | Bacteria | 4206 |
| 223 | Ga0207426_1011006 | 3300025302 | Bacteria | 3474 |
| 224 | Ga0207656_10068512 | 3300025321 | Bacteria | 1572 |
| 225 | Ga0207710_10078548 | 3300025900 | Bacteria | 1527 |
| 226 | Ga0207688_10001800 | 3300025901 | Bacteria | 11401 |
| 227 | Ga0207688_10002104 | 3300025901 | Bacteria | 10706 |
| 228 | Ga0207680_10028762 | 3300025903 | Bacteria | 3114 |
| 229 | Ga0207647_10037746 | 3300025904 | Bacteria | 3060 |
| 230 | Ga0207699_10414306 | 3300025906 | Bacteria | 961 |
| 231 | Ga0207643_10000204 | 3300025908 | Bacteria | 41257 |
| 232 | Ga0207643_10135488 | 3300025908 | Bacteria | 1468 |
| 233 | Ga0207705_10005372 | 3300025909 | Bacteria | 9580 |
| 234 | Ga0207705_10048350 | 3300025909 | Bacteria | 3060 |
| 235 | Ga0207654_10008897 | 3300025911 | Bacteria | 5092 |
| 236 | Ga0207707_10011023 | 3300025912 | Bacteria | 7864 |
| 237 | Ga0207707_10338851 | 3300025912 | Bacteria | 1297 |
| 238 | Ga0207695_10309131 | 3300025913 | Bacteria | 1471 |
| 239 | Ga0207693_10092552 | 3300025915 | Bacteria | 2369 |
| 240 | Ga0207693_10101714 | 3300025915 | Bacteria | 2254 |
| 241 | Ga0207663_10008959 | 3300025916 | Bacteria | 5265 |
| 242 | Ga0207660_10008053 | 3300025917 | Bacteria | 6817 |
| 243 | Ga0207662_10178533 | 3300025918 | Bacteria | 1365 |
| 244 | Ga0207662_10285770 | 3300025918 | Bacteria | 1093 |
| 245 | Ga0207657_10009523 | 3300025919 | Bacteria | 9755 |
| 246 | Ga0207657_10057306 | 3300025919 | Bacteria | 3357 |
| 247 | Ga0207657_10183580 | 3300025919 | Bacteria | 1690 |
| 248 | Ga0207657_10555594 | 3300025919 | Bacteria | 897 |
| 249 | Ga0207649_10009766 | 3300025920 | Bacteria | 5256 |
| 250 | Ga0207649_10010945 | 3300025920 | Bacteria | 4989 |
| 251 | Ga0207649_10109648 | 3300025920 | Bacteria | 1842 |
| 252 | Ga0207652_10009474 | 3300025921 | Bacteria | 7829 |
| 253 | Ga0207652_10178509 | 3300025921 | Bacteria | 1907 |
| 254 | Ga0207652_10388493 | 3300025921 | Bacteria | 1259 |
| 255 | Ga0207652_10427579 | 3300025921 | Bacteria | 1194 |
| 256 | Ga0207652_10542619 | 3300025921 | Bacteria | 1045 |
| 257 | Ga0207646_10126493 | 3300025922 | Bacteria | 2298 |
| 258 | Ga0207681_10253871 | 3300025923 | Bacteria | 1374 |
| 259 | Ga0207694_10029050 | 3300025924 | Bacteria | 4217 |
| 260 | Ga0207694_10222597 | 3300025924 | Bacteria | 1540 |
| 261 | Ga0207650_10000859 | 3300025925 | Bacteria | 23092 |
| 262 | Ga0207659_10023225 | 3300025926 | Bacteria | 4136 |
| 263 | Ga0207659_10225948 | 3300025926 | Bacteria | 1507 |
| 264 | Ga0207687_10026156 | 3300025927 | Bacteria | 3907 |
| 265 | Ga0207687_10040796 | 3300025927 | Bacteria | 3184 |
| 266 | Ga0207687_10252263 | 3300025927 | Bacteria | 1403 |
| 267 | Ga0207687_10331138 | 3300025927 | Bacteria | 1235 |
| 268 | Ga0207700_10111470 | 3300025928 | Bacteria | 2202 |
| 269 | Ga0207664_10276637 | 3300025929 | Bacteria | 1472 |
| 270 | Ga0207644_10004724 | 3300025931 | Bacteria | 8850 |
| 271 | Ga0207644_10135285 | 3300025931 | Bacteria | 1892 |
| 272 | Ga0207690_10090817 | 3300025932 | Bacteria | 2157 |
| 273 | Ga0207690_10285634 | 3300025932 | Bacteria | 1286 |
| 274 | Ga0207706_10053763 | 3300025933 | Bacteria | 3554 |
| 275 | Ga0207706_10161540 | 3300025933 | Bacteria | 1969 |
| 276 | Ga0207686_10139794 | 3300025934 | Bacteria | 1672 |
| 277 | Ga0207686_10356219 | 3300025934 | Bacteria | 1103 |
| 278 | Ga0207709_10093249 | 3300025935 | Bacteria | 1974 |
| 279 | Ga0207709_10378050 | 3300025935 | Bacteria | 1077 |
| 280 | Ga0207670_10010858 | 3300025936 | Bacteria | 5256 |
| 281 | Ga0207704_10012901 | 3300025938 | Bacteria | 4163 |
| 282 | Ga0207665_10096253 | 3300025939 | Bacteria | 2059 |
| 283 | Ga0207691_10047895 | 3300025940 | Bacteria | 3920 |
| 284 | Ga0207691_10279790 | 3300025940 | Bacteria | 1436 |
| 285 | Ga0207711_10000444 | 3300025941 | Bacteria | 43144 |
| 286 | Ga0207711_10408556 | 3300025941 | Bacteria | 1262 |
| 287 | Ga0207689_10000223 | 3300025942 | Bacteria | 50338 |
| 288 | Ga0207689_10024781 | 3300025942 | Bacteria | 5030 |
| 289 | Ga0207689_10112825 | 3300025942 | Bacteria | 2234 |
| 290 | Ga0207661_10001364 | 3300025944 | Bacteria | 16377 |
| 291 | Ga0207661_10022564 | 3300025944 | Bacteria | 4743 |
| 292 | Ga0207661_10098042 | 3300025944 | Bacteria | 2455 |
| 293 | Ga0207661_10315375 | 3300025944 | Bacteria | 1404 |
| 294 | Ga0207661_10971253 | 3300025944 | Bacteria | 782 |
| 295 | Ga0207679_10011410 | 3300025945 | Bacteria | 5754 |
| 296 | Ga0207679_10145582 | 3300025945 | Bacteria | 1921 |
| 297 | Ga0207679_10237872 | 3300025945 | Bacteria | 1541 |
| 298 | Ga0207679_10398424 | 3300025945 | Bacteria | 1210 |
| 299 | Ga0207651_10701839 | 3300025960 | Bacteria | 891 |
| 300 | Ga0207712_10003154 | 3300025961 | Bacteria | 10516 |
| 301 | Ga0207712_10466811 | 3300025961 | Bacteria | 1073 |
| 302 | Ga0207668_10488451 | 3300025972 | Bacteria | 1057 |
| 303 | Ga0207640_10011341 | 3300025981 | Bacteria | 5045 |
| 304 | Ga0207677_10055446 | 3300026023 | Bacteria | 2710 |
| 305 | Ga0207677_10218333 | 3300026023 | Bacteria | 1527 |
| 306 | Ga0207677_10560875 | 3300026023 | Bacteria | 997 |
| 307 | Ga0207703_10020493 | 3300026035 | Bacteria | 5170 |
| 308 | Ga0207703_10025884 | 3300026035 | Bacteria | 4616 |
| 309 | Ga0207703_10526780 | 3300026035 | Bacteria | 1112 |
| 310 | Ga0207639_10025701 | 3300026041 | Bacteria | 4272 |
| 311 | Ga0207678_10000183 | 3300026067 | Bacteria | 53634 |
| 312 | Ga0207678_10010292 | 3300026067 | Bacteria | 8209 |
| 313 | Ga0207678_10121349 | 3300026067 | Bacteria | 2230 |
| 314 | Ga0207678_10474362 | 3300026067 | Bacteria | 1089 |
| 315 | Ga0207708_10010862 | 3300026075 | Bacteria | 6773 |
| 316 | Ga0207708_10022607 | 3300026075 | Bacteria | 4748 |
| 317 | Ga0207702_10003008 | 3300026078 | Bacteria | 15672 |
| 318 | Ga0207702_10004779 | 3300026078 | Bacteria | 11940 |
| 319 | Ga0207702_10114398 | 3300026078 | Bacteria | 2404 |
| 320 | Ga0207702_10131774 | 3300026078 | Bacteria | 2250 |
| 321 | Ga0207641_10005837 | 3300026088 | Bacteria | 10449 |
| 322 | Ga0207641_10108153 | 3300026088 | Bacteria | 2461 |
| 323 | Ga0207641_10164364 | 3300026088 | Bacteria | 2020 |
| 324 | Ga0207648_10194967 | 3300026089 | Bacteria | 1796 |
| 325 | Ga0207676_10001332 | 3300026095 | Bacteria | 18376 |
| 326 | Ga0207676_10103084 | 3300026095 | Bacteria | 2370 |
| 327 | Ga0207674_10076730 | 3300026116 | Bacteria | 3349 |
| 328 | Ga0207674_10207274 | 3300026116 | Bacteria | 1910 |
| 329 | Ga0207674_10229951 | 3300026116 | Bacteria | 1802 |
| 330 | Ga0207675_101440182 | 3300026118 | Bacteria | 710 |
| 331 | Ga0207683_10015673 | 3300026121 | Bacteria | 6451 |
| 332 | Ga0207683_10117027 | 3300026121 | Bacteria | 2390 |
| 333 | Ga0207683_10223875 | 3300026121 | Bacteria | 1714 |
| 334 | Ga0207698_10001923 | 3300026142 | Bacteria | 12178 |
| 335 | Ga0207698_10012628 | 3300026142 | Bacteria | 5534 |
| 336 | Ga0207698_10041224 | 3300026142 | Bacteria | 3438 |
| 337 | Ga0207698_10130391 | 3300026142 | Bacteria | 2147 |
| 338 | Ga0207698_11202025 | 3300026142 | Bacteria | 772 |
| 339 | Ga0207428_10015565 | 3300027907 | Bacteria | 6574 |
| 340 | Ga0268266_10289008 | 3300028379 | Bacteria | 1526 |
| 341 | Ga0268266_10412809 | 3300028379 | Bacteria | 1278 |
| 342 | Ga0268265_10000301 | 3300028380 | Bacteria | 55125 |
| 343 | Ga0268265_10488421 | 3300028380 | Bacteria | 1158 |
| 344 | Ga0268264_10098267 | 3300028381 | Bacteria | 2538 |
| 345 | Ga0268264_10134021 | 3300028381 | Bacteria | 2200 |
| 346 | Ga0268264_10520301 | 3300028381 | Bacteria | 1163 |
| 347 | Ga0265337_1077605 | 3300028556 | Bacteria | 910 |
| 348 | Ga0265319_1000869 | 3300028563 | Bacteria | 19204 |
| 349 | Ga0265334_10001482 | 3300028573 | Bacteria | 11317 |
| 350 | Ga0265334_10036211 | 3300028573 | Bacteria | 1949 |
| 351 | Ga0265318_10018639 | 3300028577 | Bacteria | 2827 |
| 352 | Ga0265336_10029582 | 3300028666 | Bacteria | 1709 |
| 353 | Ga0265338_10037065 | 3300028800 | Bacteria | 4649 |
| 354 | Ga0265330_10021595 | 3300031235 | Bacteria | 2935 |
| 355 | Ga0265332_10045393 | 3300031238 | Bacteria | 1894 |
| 356 | Ga0265328_10158010 | 3300031239 | Bacteria | 854 |
| 357 | Ga0265329_10026740 | 3300031242 | Bacteria | 1899 |
| 358 | Ga0265340_10050812 | 3300031247 | Bacteria | 2009 |
| 359 | Ga0265339_10302973 | 3300031249 | Bacteria | 761 |
| 360 | Ga0265327_10020666 | 3300031251 | Bacteria | 4001 |
| 361 | Ga0307513_10007380 | 3300031456 | Bacteria | 14267 |
| 362 | Ga0307509_10023226 | 3300031507 | Bacteria | 6971 |
| 363 | Ga0307408_100090116 | 3300031548 | Bacteria | 2313 |
| 364 | Ga0307408_100885508 | 3300031548 | Bacteria | 816 |
| 365 | Ga0265313_10015482 | 3300031595 | Bacteria | 4435 |
| 366 | Ga0307508_10042187 | 3300031616 | Bacteria | 4094 |
| 367 | Ga0307508_10048314 | 3300031616 | Bacteria | 3791 |
| 368 | Ga0307508_10155269 | 3300031616 | Bacteria | 1892 |
| 369 | Ga0307514_10201145 | 3300031649 | Bacteria | 1252 |
| 370 | Ga0316575_10005198 | 3300031665 | Bacteria | 4629 |
| 371 | Ga0316575_10025811 | 3300031665 | Bacteria | 2281 |
| 372 | Ga0316579_10032015 | 3300031691 | Bacteria | 2410 |
| 373 | Ga0265314_10045807 | 3300031711 | Bacteria | 3089 |
| 374 | Ga0316576_10215566 | 3300031727 | Bacteria | 1444 |
| 375 | Ga0316578_10016235 | 3300031728 | Bacteria | 4024 |
| 376 | Ga0316578_10030820 | 3300031728 | Bacteria | 3051 |
| 377 | Ga0307405_10030262 | 3300031731 | Bacteria | 3173 |
| 378 | Ga0307405_10047594 | 3300031731 | Bacteria | 2642 |
| 379 | Ga0307405_10739583 | 3300031731 | Bacteria | 818 |
| 380 | Ga0316577_10132981 | 3300031733 | Bacteria | 1400 |
| 381 | Ga0316577_10237542 | 3300031733 | Bacteria | 1030 |
| 382 | Ga0307413_10692907 | 3300031824 | Bacteria | 845 |
| 383 | Ga0307518_10207447 | 3300031838 | Bacteria | 1294 |
| 384 | Ga0307406_10185339 | 3300031901 | Bacteria | 1519 |
| 385 | Ga0307412_10242949 | 3300031911 | Bacteria | 1394 |
| 386 | Ga0307409_100101166 | 3300031995 | Bacteria | 2391 |
| 387 | Ga0307409_100111281 | 3300031995 | Bacteria | 2297 |
| 388 | Ga0307416_100236267 | 3300032002 | Bacteria | 1767 |
| 389 | Ga0307416_100322487 | 3300032002 | Bacteria | 1548 |
| 390 | Ga0307416_100518965 | 3300032002 | Bacteria | 1259 |
| 391 | Ga0307411_10309197 | 3300032005 | Bacteria | 1271 |
| 392 | Ga0307415_100150486 | 3300032126 | Bacteria | 1791 |
| 393 | Ga0307415_100181101 | 3300032126 | Bacteria | 1653 |
| 394 | Ga0307415_100190738 | 3300032126 | Bacteria | 1617 |
| 395 | Ga0307415_100213917 | 3300032126 | Bacteria | 1540 |
| 396 | Ga0307415_100397282 | 3300032126 | Bacteria | 1176 |
| 397 | Ga0316580_10007003 | 3300032139 | Bacteria | 3344 |
| 398 | Ga0316580_10035694 | 3300032139 | Bacteria | 1538 |
| 399 | Ga0307510_10228973 | 3300033180 | Bacteria | 1363 |
| 400 | Ga0316574_0182145 | 3300035398 | Bacteria | 1351 |
| 401 | Ga0373937_0250676 | 3300036401 | Bacteria | 1669 |
| 402 | Ga0373937_0361291 | 3300036401 | Bacteria | 1376 |
| 403 | Ga0373937_1021292 | 3300036401 | Bacteria | 776 |
| 404 | Ga0316582_0004770 | 3300036647 | Bacteria | 6909 |
| 405 | Ga0316584_0000754 | 3300036712 | Bacteria | 18048 |
| 406 | Ga0316584_0467398 | 3300036712 | Bacteria | 890 |
| 407 | Ga0395899_0003758 | 3300037312 | Bacteria | 11991 |
| 408 | Ga0395900_0014789 | 3300037418 | Bacteria | 7952 |
| 409 | Ga0395900_0810037 | 3300037418 | Bacteria | 864 |
| 410 | Ga0395898_0003264 | 3300037466 | Bacteria | 18227 |
| 411 | Ga0395905_0003244 | 3300037471 | Bacteria | 17494 |
| 412 | Ga0395901_0026146 | 3300038443 | Bacteria | 5992 |
| 413 | Ga0395901_0333250 | 3300038443 | Bacteria | 1568 |
| 414 | Ga0395901_0926295 | 3300038443 | Bacteria | 852 |
| 415 | Ga0395901_1369440 | 3300038443 | Bacteria | 667 |
| 416 | Ga0439436_0073267 | 3300041404 | Bacteria | 954 |
| 417 | Ga0451795_0975078 | 3300041456 | Bacteria | 1832 |
| 418 | Ga0451833_0404134 | 3300041491 | Bacteria | 1001 |
| 419 | Ga0451841_0720358 | 3300041498 | Bacteria | 1309 |
| 420 | Ga0451845_0268101 | 3300041501 | Bacteria | 723 |
| 421 | Ga0451849_0427955 | 3300041505 | Bacteria | 690 |
| 422 | Ga0451843_0735780 | 3300041509 | Bacteria | 1019 |
| 423 | Ga0451853_0250949 | 3300041512 | Bacteria | 1046 |
| 424 | Ga0439433_0017434 | 3300041999 | Bacteria | 1594 |
| 425 | Ga0439448_0031410 | 3300042005 | Bacteria | 1687 |
| 426 | Ga0439448_0056979 | 3300042005 | Bacteria | 1287 |
| 427 | Ga0439449_0024808 | 3300042007 | Bacteria | 2241 |
| 428 | Ga0439457_029288 | 3300042014 | Bacteria | 1220 |
| 429 | Ga0450920_026814 | 3300042122 | Bacteria | 1125 |
| 430 | Ga0450906_012081 | 3300042145 | Bacteria | 1605 |
| 431 | Ga0439459_0022915 | 3300042438 | Bacteria | 1212 |
| 432 | Ga0466969_0004220 | 3300044656 | Bacteria | 7631 |
| 433 | Ga0466965_0061780 | 3300044683 | Bacteria | 1873 |
| 434 | Ga0466966_0012858 | 3300044684 | Bacteria | 5543 |
| 435 | Ga0466961_0004911 | 3300044693 | Bacteria | 8409 |
| 436 | Ga0466963_0028916 | 3300044694 | Bacteria | 3563 |
| 437 | Ga0466963_0040368 | 3300044694 | Bacteria | 3059 |
| 438 | Ga0466963_0044901 | 3300044694 | Bacteria | 2909 |
| 439 | Ga0466964_0023676 | 3300044706 | Bacteria | 2388 |
| 440 | Ga0466957_0464348 | 3300044842 | Bacteria | 874 |
| 441 | Ga0466960_0001341 | 3300044901 | Bacteria | 8956 |
| 442 | Ga0466959_0038332 | 3300045049 | Bacteria | 3541 |
| 443 | Ga0451576_0000076 | 3300045051 | Bacteria | 245246 |
| 444 | Ga0451576_0002422 | 3300045051 | Bacteria | 27946 |
| 445 | Ga0466967_0001742 | 3300045976 | Bacteria | 12989 |
| 446 | Ga0466967_0003216 | 3300045976 | Bacteria | 10554 |
| 447 | Ga0466967_0052843 | 3300045976 | Bacteria | 3569 |
| 448 | Ga0466967_0082835 | 3300045976 | Bacteria | 2900 |
| 449 | Ga0466967_0105849 | 3300045976 | Bacteria | 2577 |
| 450 | Ga0466967_0218933 | 3300045976 | Bacteria | 1808 |
| 451 | Ga0466967_0866265 | 3300045976 | Bacteria | 898 |
| 452 | Ga0495629_0388019 | 3300046459 | Bacteria | 950 |
| 453 | Ga0495638_0208120 | 3300046460 | Bacteria | 1100 |
| 454 | Ga0495651_0099318 | 3300046462 | Bacteria | 2170 |
| 455 | Ga0495651_0394452 | 3300046462 | Bacteria | 905 |
| 456 | Ga0495653_0078213 | 3300046463 | Bacteria | 2453 |
| 457 | Ga0495662_0000420 | 3300046476 | Bacteria | 18983 |
| 458 | Ga0495664_0013692 | 3300046477 | Bacteria | 4601 |
| 459 | Ga0495585_0119408 | 3300046492 | Bacteria | 1396 |
| 460 | Ga0495608_0053898 | 3300046511 | Bacteria | 2659 |
| 461 | Ga0495608_0093218 | 3300046511 | Bacteria | 1946 |
| 462 | Ga0495630_0029824 | 3300046517 | Bacteria | 4055 |
| 463 | Ga0495663_0024980 | 3300046525 | Bacteria | 1740 |
| 464 | Ga0495666_0001355 | 3300046526 | Bacteria | 11875 |
| 465 | Ga0495652_0171586 | 3300046529 | Bacteria | 1673 |
| 466 | Ga0495640_0005802 | 3300046533 | Bacteria | 9807 |
| 467 | Ga0495586_0004276 | 3300046535 | Bacteria | 7635 |
| 468 | Ga0495587_0060687 | 3300046536 | Bacteria | 2216 |
| 469 | Ga0495598_0130893 | 3300046537 | Bacteria | 860 |
| 470 | Ga0495645_0057658 | 3300046543 | Bacteria | 2818 |
| 471 | Ga0495667_0047805 | 3300046559 | Bacteria | 2825 |
| 472 | Ga0495667_0085279 | 3300046559 | Bacteria | 2050 |
| 473 | Ga0495634_0052714 | 3300046642 | Bacteria | 2726 |
| 474 | Ga0495635_0150075 | 3300046663 | Bacteria | 1586 |
| 475 | Ga0495657_0039074 | 3300046675 | Bacteria | 3262 |
| 476 | Ga0495599_0035715 | 3300046678 | Bacteria | 3120 |
| 477 | Ga0495646_0012726 | 3300046680 | Bacteria | 5346 |
| 478 | Ga0495613_0014583 | 3300046689 | Bacteria | 5828 |
| 479 | Ga0495589_0172570 | 3300046794 | Bacteria | 1028 |
| 480 | Ga0495600_0027117 | 3300046809 | Bacteria | 3701 |
| 481 | Ga0495660_0245095 | 3300046810 | Bacteria | 834 |
| 482 | Ga0495581_0030691 | 3300047315 | Bacteria | 3113 |
| 483 | Ga0495604_0007195 | 3300047317 | Bacteria | 8815 |
| 484 | Ga0495674_0513275 | 3300047319 | Bacteria | 957 |
| 485 | Ga0495680_0382484 | 3300047322 | Bacteria | 975 |
| 486 | Ga0495675_0008943 | 3300047444 | Bacteria | 6225 |
| 487 | Ga0495675_0349557 | 3300047444 | Bacteria | 870 |
| 488 | Ga0495684_0213514 | 3300047471 | Bacteria | 1417 |
| 489 | Ga0495593_0010168 | 3300047673 | Bacteria | 5445 |
| 490 | Ga0495602_0069718 | 3300048088 | Bacteria | 3012 |
| 491 | Ga0496100_0004317 | 3300048903 | Bacteria | 7527 |
| 492 | Ga0496100_0032515 | 3300048903 | Bacteria | 3255 |
| 493 | Ga0496101_0004638 | 3300048904 | Bacteria | 8689 |
| 494 | Ga0496101_0006480 | 3300048904 | Bacteria | 7536 |
| 495 | Ga0496102_0001866 | 3300048905 | Bacteria | 18148 |
| 496 | Ga0496102_0050328 | 3300048905 | Bacteria | 3793 |
| 497 | Ga0496102_0303261 | 3300048905 | Bacteria | 1505 |
| 498 | Ga0496103_0252050 | 3300048906 | Bacteria | 1136 |
| 499 | Ga0496104_0005242 | 3300048907 | Bacteria | 11331 |
| 500 | Ga0496104_0006065 | 3300048907 | Bacteria | 10608 |
| 501 | Ga0496104_0498295 | 3300048907 | Bacteria | 1129 |
| 502 | Ga0496105_0000691 | 3300048908 | Bacteria | 22703 |
| 503 | Ga0496106_0001744 | 3300048909 | Bacteria | 16241 |
| 504 | Ga0496106_0009294 | 3300048909 | Bacteria | 7264 |
| 505 | Ga0496106_0078480 | 3300048909 | Bacteria | 2534 |
| 506 | Ga0496107_0018115 | 3300048910 | Bacteria | 4955 |
| 507 | Ga0496107_0532513 | 3300048910 | Bacteria | 871 |
| 508 | Ga0496108_0007397 | 3300048911 | Bacteria | 8905 |
| 509 | Ga0496108_0025928 | 3300048911 | Bacteria | 4835 |
| 510 | Ga0496108_0026612 | 3300048911 | Bacteria | 4772 |
| 511 | Ga0496108_0055951 | 3300048911 | Bacteria | 3313 |
| 512 | Ga0496109_0016672 | 3300048912 | Bacteria | 6427 |
| 513 | Ga0496109_0079532 | 3300048912 | Bacteria | 3020 |
| 514 | Ga0496109_0152973 | 3300048912 | Bacteria | 2160 |
| 515 | Ga0496109_0305915 | 3300048912 | Bacteria | 1499 |
| 516 | Ga0496109_1123727 | 3300048912 | Bacteria | 723 |
| 517 | Ga0496110_0001017 | 3300048913 | Bacteria | 19745 |
| 518 | Ga0496110_0004404 | 3300048913 | Bacteria | 10907 |
| 519 | Ga0496110_0066287 | 3300048913 | Bacteria | 3193 |
| 520 | Ga0496110_0067958 | 3300048913 | Bacteria | 3154 |
| 521 | Ga0496110_0580267 | 3300048913 | Bacteria | 1018 |
| 522 | Ga0496110_0639154 | 3300048913 | Bacteria | 963 |
| 523 | Ga0496111_0002974 | 3300048914 | Bacteria | 10385 |
| 524 | Ga0496111_0004824 | 3300048914 | Bacteria | 8552 |
| 525 | Ga0496111_0042415 | 3300048914 | Bacteria | 3267 |
| 526 | Ga0496111_0062208 | 3300048914 | Bacteria | 2707 |
| 527 | Ga0496112_0011025 | 3300048915 | Bacteria | 8236 |
| 528 | Ga0496112_0613768 | 3300048915 | Bacteria | 1019 |
| 529 | Ga0496113_0003329 | 3300048916 | Bacteria | 9597 |
| 530 | Ga0496113_0311076 | 3300048916 | Bacteria | 1262 |
| 531 | Ga0496114_0007427 | 3300048917 | Bacteria | 8665 |
| 532 | Ga0496114_0023808 | 3300048917 | Bacteria | 4997 |
| 533 | Ga0496114_0099966 | 3300048917 | Bacteria | 2474 |
| 534 | Ga0496114_0364745 | 3300048917 | Bacteria | 1278 |
| 535 | Ga0496114_0938823 | 3300048917 | Bacteria | 747 |
| 536 | Ga0496115_0008496 | 3300048918 | Bacteria | 7594 |
| 537 | Ga0496115_0521249 | 3300048918 | Bacteria | 953 |
| 538 | Ga0496117_0000196 | 3300048920 | Bacteria | 119243 |
| 539 | Ga0496118_0009672 | 3300048921 | Bacteria | 9689 |
| 540 | Ga0496118_0052691 | 3300048921 | Bacteria | 3100 |
| 541 | Ga0496119_0300450 | 3300048922 | Bacteria | 792 |
| 542 | Ga0496125_0021486 | 3300048928 | Bacteria | 6020 |
| 543 | Ga0496125_0198231 | 3300048928 | Bacteria | 1318 |
| 544 | Ga0496126_0013614 | 3300048929 | Bacteria | 8259 |
| 545 | Ga0501031_0022979 | 3300049568 | Bacteria | 4066 |
| 546 | Ga0501031_0031342 | 3300049568 | Bacteria | 3468 |
| 547 | Ga0501031_0052825 | 3300049568 | Bacteria | 2647 |
| 548 | Ga0501032_0002947 | 3300049569 | Bacteria | 13233 |
| 549 | Ga0501033_0012459 | 3300049570 | Bacteria | 6491 |
| 550 | Ga0501033_0051321 | 3300049570 | Bacteria | 3057 |
| 551 | Ga0501034_0007966 | 3300049571 | Bacteria | 11247 |
| 552 | Ga0501034_0017873 | 3300049571 | Bacteria | 7272 |
| 553 | Ga0501034_0040119 | 3300049571 | Bacteria | 4740 |
| 554 | Ga0501036_0002052 | 3300049572 | Bacteria | 15697 |
| 555 | Ga0501036_0006933 | 3300049572 | Bacteria | 9213 |
| 556 | Ga0501036_0047742 | 3300049572 | Bacteria | 3625 |
| 557 | Ga0501036_0108796 | 3300049572 | Bacteria | 2343 |
| 558 | Ga0501037_0011477 | 3300049573 | Bacteria | 6524 |
| 559 | Ga0501037_0017390 | 3300049573 | Bacteria | 5295 |
| 560 | Ga0501038_0000434 | 3300049574 | Bacteria | 36402 |
| 561 | Ga0501038_0003312 | 3300049574 | Bacteria | 15024 |
| 562 | Ga0501038_0060954 | 3300049574 | Bacteria | 3227 |
| 563 | Ga0501039_0019189 | 3300049575 | Bacteria | 5247 |
| 564 | Ga0501039_0037998 | 3300049575 | Bacteria | 3718 |
| 565 | Ga0501039_0052374 | 3300049575 | Bacteria | 3158 |
| 566 | Ga0501040_0017116 | 3300049576 | Bacteria | 4810 |
| 567 | Ga0501040_0122687 | 3300049576 | Bacteria | 1824 |
| 568 | Ga0501041_0002785 | 3300049577 | Bacteria | 9978 |
| 569 | Ga0501041_0063573 | 3300049577 | Bacteria | 2260 |
| 570 | Ga0501042_0010500 | 3300049578 | Bacteria | 6213 |
| 571 | Ga0501042_0078817 | 3300049578 | Bacteria | 2359 |
| 572 | Ga0501043_0005510 | 3300049579 | Bacteria | 10224 |
| 573 | Ga0501043_0007822 | 3300049579 | Bacteria | 8452 |
| 574 | Ga0501046_0023435 | 3300049580 | Bacteria | 5079 |
| 575 | Ga0501046_0025659 | 3300049580 | Bacteria | 4821 |
| 576 | Ga0501047_0001256 | 3300049581 | Bacteria | 25098 |
| 577 | Ga0501047_0004783 | 3300049581 | Bacteria | 12741 |
| 578 | Ga0501048_0002768 | 3300049582 | Bacteria | 13383 |
| 579 | Ga0501048_0018787 | 3300049582 | Bacteria | 5081 |
| 580 | Ga0501048_0057645 | 3300049582 | Bacteria | 2754 |
| 581 | Ga0501067_0045851 | 3300049583 | Bacteria | 2427 |
| 582 | Ga0501068_0014571 | 3300049584 | Bacteria | 4498 |
| 583 | Ga0501070_0011622 | 3300049586 | Bacteria | 7433 |
| 584 | Ga0501070_0220057 | 3300049586 | Bacteria | 1557 |
| 585 | Ga0501071_0000487 | 3300049587 | Bacteria | 20080 |
| 586 | Ga0501071_0000789 | 3300049587 | Bacteria | 16884 |
| 587 | Ga0501072_0046670 | 3300049588 | Bacteria | 3410 |
| 588 | Ga0501072_0078471 | 3300049588 | Bacteria | 2614 |
| 589 | Ga0501072_0370988 | 3300049588 | Bacteria | 1136 |
| 590 | Ga0501073_0000735 | 3300049589 | Bacteria | 23193 |
| 591 | Ga0501073_0022240 | 3300049589 | Bacteria | 4569 |
| 592 | Ga0501074_0004579 | 3300049590 | Bacteria | 9903 |
| 593 | Ga0501074_0013350 | 3300049590 | Bacteria | 5974 |
| 594 | Ga0501075_0002267 | 3300049591 | Bacteria | 12745 |
| 595 | Ga0501075_0288541 | 3300049591 | Bacteria | 1250 |
| 596 | Ga0501076_0056489 | 3300049592 | Bacteria | 3116 |
| 597 | Ga0501076_0108554 | 3300049592 | Bacteria | 2241 |
| 598 | Ga0501077_0577915 | 3300049593 | Bacteria | 721 |
| 599 | Ga0501079_0016371 | 3300049741 | Bacteria | 5663 |
| 600 | Ga0501079_0076578 | 3300049741 | Bacteria | 2587 |
| 601 | Ga0501079_0518962 | 3300049741 | Bacteria | 937 |
| 602 | Ga0501080_0000231 | 3300049742 | Bacteria | 42074 |
| 603 | Ga0501080_0110464 | 3300049742 | Bacteria | 2548 |
| 604 | Ga0501081_0019752 | 3300049743 | Bacteria | 4490 |
| 605 | Ga0501083_0029334 | 3300049744 | Bacteria | 3785 |
| 606 | Ga0501083_0029891 | 3300049744 | Bacteria | 3744 |
| 607 | Ga0501035_0035789 | 3300049822 | Bacteria | 4504 |
| 608 | Ga0501044_0010836 | 3300049823 | Bacteria | 9889 |
| 609 | Ga0501044_0056224 | 3300049823 | Bacteria | 4039 |
| 610 | Ga0501044_0067600 | 3300049823 | Bacteria | 3641 |
| 611 | Ga0501044_0263296 | 3300049823 | Bacteria | 1662 |
| 612 | Ga0501045_0013787 | 3300049824 | Bacteria | 5714 |
| 613 | nmdc:mga09592_148400_c1 | 3300050508 | Bacteria | 2022 |
| 614 | nmdc:mga0qj67_139451_c1 | 3300050509 | Bacteria | 1965 |
| 615 | nmdc:mga06r32_251402_c1 | 3300050510 | Bacteria | 1755 |
| 616 | nmdc:mga06r32_514780_c1 | 3300050510 | Bacteria | 1173 |
| 617 | nmdc:mga06r32_549389_c1 | 3300050510 | Bacteria | 1129 |
| 618 | nmdc:mga06r32_718906_c1 | 3300050510 | Bacteria | 963 |
| 619 | nmdc:mga06r32_951170_c1 | 3300050510 | Bacteria | 813 |
| 620 | nmdc:mga08y16_15125_c1 | 3300050511 | Bacteria | 8111 |
| 621 | nmdc:mga08y16_275922_c1 | 3300050511 | Bacteria | 1735 |
| 622 | nmdc:mga0n895_6028_c1 | 3300050512 | Bacteria | 10217 |
| 623 | nmdc:mga0rr50_4916_c1 | 3300050513 | Bacteria | 7910 |
| 624 | nmdc:mga08x19_53389_c1 | 3300050514 | Bacteria | 2601 |
| 625 | nmdc:mga0a205_6088_c1 | 3300050515 | Bacteria | 10880 |
| 626 | Ga0495619_0145008 | 3300053085 | Bacteria | 1636 |
| 627 | Ga0500583_0148137 | 3300053092 | Bacteria | 1168 |
| 628 | Ga0500560_085999 | 3300053107 | Bacteria | 1048 |
| 629 | Ga0500593_178322 | 3300053117 | Bacteria | 792 |
| 630 | Ga0500573_0209636 | 3300053140 | Bacteria | 1029 |
| 631 | Ga0500616_0001051 | 3300053153 | Bacteria | 29163 |
| 632 | Ga0500620_039967 | 3300053155 | Bacteria | 1534 |
| 633 | Ga0501084_0009923 | 3300054114 | Bacteria | 7871 |
| 634 | Ga0501084_0063193 | 3300054114 | Bacteria | 3099 |
| 635 | Ga0501082_0023286 | 3300060353 | Bacteria | 5342 |
| 636 | Ga0501082_0029431 | 3300060353 | Bacteria | 4731 |
| 637 | Ga0501082_0492754 | 3300060353 | Bacteria | 1071 |
| 638 | Ga0530510_0041720 | 3300061734 | Bacteria | 3313 |
| 639 | 8002784710 | 8002784119 | Bacteria | 9788632 |
| 640 | 2508670731 | 2508501039 | Bacteria | 9978592 |
| 641 | 2644019276 | 2643221601 | Bacteria | 7493239 |
| 642 | 2644174184 | 2643221631 | Bacteria | 8168043 |
| 643 | 2644445688 | 2643221679 | Bacteria | 3839507 |
| 644 | 2676201239 | 2675902999 | Bacteria | 9438463 |
| 645 | 2689960535 | 2687453737 | Bacteria | 11203906 |
| 646 | 2729906698 | 2728369276 | Bacteria | 5610032 |
| 647 | 2731908637 | 2731639228 | Bacteria | 4187555 |
| 648 | 2774845815 | 2773857921 | Bacteria | 9435764 |
| 649 | 2785374244 | 2784746768 | Bacteria | 10036182 |
| 650 | 2816424708 | 2816332119 | Bacteria | 8120218 |
| 651 | 2819743770 | 2818991472 | Bacteria | 10089953 |
| 652 | 2837272348 | 2837268691 | Bacteria | 7850704 |
| 653 | 2861524329 | 2861520306 | Bacteria | 8348283 |
| 654 | 2868091901 | 2868088558 | Bacteria | 7609351 |
| 655 | 2873321041 | 2873314349 | Bacteria | 8512634 |
| 656 | 2897563848 | 2897561785 | Bacteria | 3256946 |
| 657 | 2946073198 | 2946072368 | Bacteria | 8999607 |
| 658 | 2997453438 | 2997451912 | Bacteria | 8492419 |
| 659 | 3006492119 | 3006486233 | Bacteria | 8157040 |
| 660 | 8002781564 | 8002775197 | Bacteria | 10728764 |
| 661 | 8025485818 | 8025478263 | Bacteria | 8209203 |
| 662 | 8056667095 | 8056667051 | Bacteria | 6953971 |
| 663 | JGI24737J22298_10038865 | |||
| 664 | JGI24751J29686_10015166 | |||
| 665 | JGI25160J50197_1008780 | |||
| 666 | JGI25160J50197_1017210 | |||
| 667 | JGI25160J50197_1033197 | |||
| 668 | Ga0070658_10062274 | |||
| 669 | Ga0070658_10777474 | |||
| 670 | Ga0070683_100001738 | |||
| 671 | Ga0070683_100004489 | |||
| 672 | Ga0070683_100163218 | |||
| 673 | Ga0070683_100228139 | |||
| 674 | Ga0070683_100683171 | |||
| 675 | Ga0070670_100042340 | |||
| 676 | Ga0068869_100003397 | |||
| 677 | Ga0070680_100003706 | |||
| 678 | Ga0070682_100001094 | |||
| 679 | Ga0070682_100018782 | |||
| 680 | Ga0070682_100153233 | |||
| 681 | Ga0070682_100311607 | |||
| 682 | Ga0068868_100001681 | |||
| 683 | Ga0068868_100058962 | |||
| 684 | Ga0068868_100356984 | |||
| 685 | Ga0070660_100008931 | |||
| 686 | Ga0070660_100012443 | |||
| 687 | Ga0070660_100116385 | |||
| 688 | Ga0070660_100299761 | |||
| 689 | Ga0070660_100806141 | |||
| 690 | Ga0070689_100003919 | |||
| 691 | Ga0070691_10005630 | |||
| 692 | Ga0070661_100010988 | |||
| 693 | Ga0070661_100027442 | |||
| 694 | Ga0070661_100139768 | |||
| 695 | Ga0070692_10024328 | |||
| 696 | Ga0070668_100265376 | |||
| 697 | Ga0070668_100674367 | |||
| 698 | Ga0070675_100002108 | |||
| 699 | Ga0070675_100040060 | |||
| 700 | Ga0070673_100768440 | |||
| 701 | Ga0070659_100015785 | |||
| 702 | Ga0070659_100034579 | |||
| 703 | Ga0070659_100311482 | |||
| 704 | Ga0070667_100034753 | |||
| 705 | Ga0070709_10034950 | |||
| 706 | Ga0070714_100070945 | |||
| 707 | Ga0070714_100134385 | |||
| 708 | Ga0070713_100007764 | |||
| 709 | Ga0070710_10095728 | |||
| 710 | Ga0070711_100117227 | |||
| 711 | Ga0070705_100224777 | |||
| 712 | Ga0070700_100008843 | |||
| 713 | Ga0070700_100037211 | |||
| 714 | Ga0070694_100795112 | |||
| 715 | Ga0070663_100006816 | |||
| 716 | Ga0070663_100022066 | |||
| 717 | Ga0070663_100036176 | |||
| 718 | Ga0070678_100002551 | |||
| 719 | Ga0070678_100058943 | |||
| 720 | Ga0070678_100537889 | |||
| 721 | Ga0070662_100041582 | |||
| 722 | Ga0070681_10047279 | |||
| 723 | Ga0068867_100128987 | |||
| 724 | Ga0068867_100149537 | |||
| 725 | Ga0070685_10370265 | |||
| 726 | Ga0070707_100187762 | |||
| 727 | Ga0070679_100110878 | |||
| 728 | Ga0070679_100199567 | |||
| 729 | Ga0070679_100605689 | |||
| 730 | Ga0070684_100000511 | |||
| 731 | Ga0070684_100002222 | |||
| 732 | Ga0070684_100010931 | |||
| 733 | Ga0070684_100068030 | |||
| 734 | Ga0070684_100216087 | |||
| 735 | Ga0068853_100078231 | |||
| 736 | Ga0068853_100079086 | |||
| 737 | Ga0070696_100002372 | |||
| 738 | Ga0070693_100107368 | |||
| 739 | Ga0070665_100004127 | |||
| 740 | Ga0070665_100410690 | |||
| 741 | Ga0068855_100038737 | |||
| 742 | Ga0068855_100337476 | |||
| 743 | Ga0070664_100000640 | |||
| 744 | Ga0070664_100018286 | |||
| 745 | Ga0070664_100117237 | |||
| 746 | Ga0070664_100161203 | |||
| 747 | Ga0070664_100239831 | |||
| 748 | Ga0068857_100042238 | |||
| 749 | Ga0068857_100060824 | |||
| 750 | Ga0068857_100062510 | |||
| 751 | Ga0068857_100199804 | |||
| 752 | Ga0068854_100019008 | |||
| 753 | Ga0068854_100071902 | |||
| 754 | Ga0068856_100010898 | |||
| 755 | Ga0068856_100015263 | |||
| 756 | Ga0068856_100016808 | |||
| 757 | Ga0068856_100159210 | |||
| 758 | Ga0068856_100220939 | |||
| 759 | Ga0070702_100001410 | |||
| 760 | Ga0070702_100006155 | |||
| 761 | Ga0070702_100121899 | |||
| 762 | Ga0068852_100007588 | |||
| 763 | Ga0068852_100034602 | |||
| 764 | Ga0068852_100066764 | |||
| 765 | Ga0068852_100757746 | |||
| 766 | Ga0068859_100000197 | |||
| 767 | Ga0068859_100057833 | |||
| 768 | Ga0068859_100600100 | |||
| 769 | Ga0068864_100011626 | |||
| 770 | Ga0068864_100519414 | |||
| 771 | Ga0068861_100829180 | |||
| 772 | Ga0068851_10056523 | |||
| 773 | Ga0068870_10002431 | |||
| 774 | Ga0068863_100005938 | |||
| 775 | Ga0068863_100114011 | |||
| 776 | Ga0068858_100077004 | |||
| 777 | Ga0068858_100911117 | |||
| 778 | Ga0068860_100051241 | |||
| 779 | Ga0068860_100523335 | |||
| 780 | Ga0068862_100000297 | |||
| 781 | Ga0081455_10002158 | |||
| 782 | Ga0081455_10010049 | |||
| 783 | Ga0081455_10016539 | |||
| 784 | Ga0081455_10064765 | |||
| 785 | Ga0081455_10159266 | |||
| 786 | Ga0081455_10385110 | |||
| 787 | Ga0081539_10012271 | |||
| 788 | Ga0081539_10019168 | |||
| 789 | Ga0070717_10337119 | |||
| 790 | Ga0075363_100159145 | |||
| 791 | Ga0070712_100237298 | |||
| 792 | Ga0070712_100306480 | |||
| 793 | Ga0070712_100579964 | |||
| 794 | Ga0068871_100307983 | |||
| 795 | Ga0068871_100422753 | |||
| 796 | Ga0075428_100000105 | |||
| 797 | Ga0075430_100046796 | |||
| 798 | Ga0075431_100187747 | |||
| 799 | Ga0075431_100478972 | |||
| 800 | Ga0075431_100593843 | |||
| 801 | Ga0075433_10003466 | |||
| 802 | Ga0075434_100004744 | |||
| 803 | Ga0075429_100216773 | |||
| 804 | Ga0068865_100024849 | |||
| 805 | Ga0075436_100002226 | |||
| 806 | Ga0097620_100000197 | |||
| 807 | Ga0097620_100057833 | |||
| 808 | Ga0097620_100600169 | |||
| 809 | Ga0099826_10172025 | |||
| 810 | Ga0075435_100005988 | |||
| 811 | Ga0105240_10175291 | |||
| 812 | Ga0111539_10000437 | |||
| 813 | Ga0111539_10063537 | |||
| 814 | Ga0105245_10000733 | |||
| 815 | Ga0105245_10063226 | |||
| 816 | Ga0105245_10066228 | |||
| 817 | Ga0105245_10337587 | |||
| 818 | Ga0105245_10340943 | |||
| 819 | Ga0105245_10400164 | |||
| 820 | Ga0105245_10575946 | |||
| 821 | Ga0105247_10118521 | |||
| 822 | Ga0114129_10136255 | |||
| 823 | Ga0114129_11152001 | |||
| 824 | Ga0114129_11805338 | |||
| 825 | Ga0105243_10091071 | |||
| 826 | Ga0105243_10107937 | |||
| 827 | Ga0105243_10124326 | |||
| 828 | Ga0105243_10185041 | |||
| 829 | Ga0105243_10534713 | |||
| 830 | Ga0105241_10002283 | |||
| 831 | Ga0105248_10000035 | |||
| 832 | Ga0105248_10547651 | |||
| 833 | Ga0105237_10085375 | |||
| 834 | Ga0105238_10055000 | |||
| 835 | Ga0105249_10005312 | |||
| 836 | Ga0105249_10015419 | |||
| 837 | Ga0105249_10103789 | |||
| 838 | Ga0105239_10008499 | |||
| 839 | Ga0105239_10270085 | |||
| 840 | Ga0105246_10000885 | |||
| 841 | Ga0105246_10006167 | |||
| 842 | Ga0105246_10175139 | |||
| 843 | Ga0157373_10014822 | |||
| 844 | Ga0157371_10006408 | |||
| 845 | Ga0157370_10042656 | |||
| 846 | Ga0157370_10368056 | |||
| 847 | Ga0157370_10417784 | |||
| 848 | Ga0157370_10634672 | |||
| 849 | Ga0157369_10032721 | |||
| 850 | Ga0157369_10067130 | |||
| 851 | Ga0157369_10070947 | |||
| 852 | Ga0157369_10178740 | |||
| 853 | Ga0157369_10181758 | |||
| 854 | Ga0157369_10200340 | |||
| 855 | Ga0157374_10039998 | |||
| 856 | Ga0163162_10005345 | |||
| 857 | Ga0163162_10253034 | |||
| 858 | Ga0163162_10298903 | |||
| 859 | Ga0163162_10755226 | |||
| 860 | Ga0157372_10010635 | |||
| 861 | Ga0157372_10056102 | |||
| 862 | Ga0157375_10074544 | |||
| 863 | Ga0157375_10784867 | |||
| 864 | Ga0163163_10002844 | |||
| 865 | Ga0163163_10007533 | |||
| 866 | Ga0163163_10178782 | |||
| 867 | Ga0163163_10257480 | |||
| 868 | Ga0163163_10260348 | |||
| 869 | Ga0163163_10482268 | |||
| 870 | Ga0157380_10540447 | |||
| 871 | Ga0157380_11394080 | |||
| 872 | Ga0157377_10003289 | |||
| 873 | Ga0157377_10038236 | |||
| 874 | Ga0157377_10388339 | |||
| 875 | Ga0157379_10040880 | |||
| 876 | Ga0157379_10181742 | |||
| 877 | Ga0182007_10000669 | |||
| 878 | Ga0206354_11474104 | |||
| 879 | Ga0206354_11514635 | |||
| 880 | Ga0206353_10019210 | |||
| 881 | Ga0206353_11238337 | |||
| 882 | Ga0206353_11412544 | |||
| 883 | Ga0207426_1001409 | |||
| 884 | Ga0207426_1008328 | |||
| 885 | Ga0207426_1011006 | |||
| 886 | Ga0207656_10068512 | |||
| 887 | Ga0207710_10078548 | |||
| 888 | Ga0207688_10001800 | |||
| 889 | Ga0207688_10002104 | |||
| 890 | Ga0207680_10028762 | |||
| 891 | Ga0207647_10037746 | |||
| 892 | Ga0207699_10414306 | |||
| 893 | Ga0207643_10000204 | |||
| 894 | Ga0207643_10135488 | |||
| 895 | Ga0207705_10005372 | |||
| 896 | Ga0207705_10048350 | |||
| 897 | Ga0207654_10008897 | |||
| 898 | Ga0207707_10011023 | |||
| 899 | Ga0207707_10338851 | |||
| 900 | Ga0207695_10309131 | |||
| 901 | Ga0207693_10092552 | |||
| 902 | Ga0207693_10101714 | |||
| 903 | Ga0207663_10008959 | |||
| 904 | Ga0207660_10008053 | |||
| 905 | Ga0207662_10178533 | |||
| 906 | Ga0207662_10285770 | |||
| 907 | Ga0207657_10009523 | |||
| 908 | Ga0207657_10057306 | |||
| 909 | Ga0207657_10183580 | |||
| 910 | Ga0207657_10555594 | |||
| 911 | Ga0207649_10009766 | |||
| 912 | Ga0207649_10010945 | |||
| 913 | Ga0207649_10109648 | |||
| 914 | Ga0207652_10009474 | |||
| 915 | Ga0207652_10178509 | |||
| 916 | Ga0207652_10388493 | |||
| 917 | Ga0207652_10427579 | |||
| 918 | Ga0207652_10542619 | |||
| 919 | Ga0207646_10126493 | |||
| 920 | Ga0207681_10253871 | |||
| 921 | Ga0207694_10029050 | |||
| 922 | Ga0207694_10222597 | |||
| 923 | Ga0207650_10000859 | |||
| 924 | Ga0207659_10023225 | |||
| 925 | Ga0207659_10225948 | |||
| 926 | Ga0207687_10026156 | |||
| 927 | Ga0207687_10040796 | |||
| 928 | Ga0207687_10252263 | |||
| 929 | Ga0207687_10331138 | |||
| 930 | Ga0207700_10111470 | |||
| 931 | Ga0207664_10276637 | |||
| 932 | Ga0207644_10004724 | |||
| 933 | Ga0207644_10135285 | |||
| 934 | Ga0207690_10090817 | |||
| 935 | Ga0207690_10285634 | |||
| 936 | Ga0207706_10053763 | |||
| 937 | Ga0207706_10161540 | |||
| 938 | Ga0207686_10139794 | |||
| 939 | Ga0207686_10356219 | |||
| 940 | Ga0207709_10093249 | |||
| 941 | Ga0207709_10378050 | |||
| 942 | Ga0207670_10010858 | |||
| 943 | Ga0207704_10012901 | |||
| 944 | Ga0207665_10096253 | |||
| 945 | Ga0207691_10047895 | |||
| 946 | Ga0207691_10279790 | |||
| 947 | Ga0207711_10000444 | |||
| 948 | Ga0207711_10408556 | |||
| 949 | Ga0207689_10000223 | |||
| 950 | Ga0207689_10024781 | |||
| 951 | Ga0207689_10112825 | |||
| 952 | Ga0207661_10001364 | |||
| 953 | Ga0207661_10022564 | |||
| 954 | Ga0207661_10098042 | |||
| 955 | Ga0207661_10315375 | |||
| 956 | Ga0207661_10971253 | |||
| 957 | Ga0207679_10011410 | |||
| 958 | Ga0207679_10145582 | |||
| 959 | Ga0207679_10237872 | |||
| 960 | Ga0207679_10398424 | |||
| 961 | Ga0207651_10701839 | |||
| 962 | Ga0207712_10003154 | |||
| 963 | Ga0207712_10466811 | |||
| 964 | Ga0207668_10488451 | |||
| 965 | Ga0207640_10011341 | |||
| 966 | Ga0207677_10055446 | |||
| 967 | Ga0207677_10218333 | |||
| 968 | Ga0207677_10560875 | |||
| 969 | Ga0207703_10020493 | |||
| 970 | Ga0207703_10025884 | |||
| 971 | Ga0207703_10526780 | |||
| 972 | Ga0207639_10025701 | |||
| 973 | Ga0207678_10000183 | |||
| 974 | Ga0207678_10010292 | |||
| 975 | Ga0207678_10121349 | |||
| 976 | Ga0207678_10474362 | |||
| 977 | Ga0207708_10010862 | |||
| 978 | Ga0207708_10022607 | |||
| 979 | Ga0207702_10003008 | |||
| 980 | Ga0207702_10004779 | |||
| 981 | Ga0207702_10114398 | |||
| 982 | Ga0207702_10131774 | |||
| 983 | Ga0207641_10005837 | |||
| 984 | Ga0207641_10108153 | |||
| 985 | Ga0207641_10164364 | |||
| 986 | Ga0207648_10194967 | |||
| 987 | Ga0207676_10001332 | |||
| 988 | Ga0207676_10103084 | |||
| 989 | Ga0207674_10076730 | |||
| 990 | Ga0207674_10207274 | |||
| 991 | Ga0207674_10229951 | |||
| 992 | Ga0207675_101440182 | |||
| 993 | Ga0207683_10015673 | |||
| 994 | Ga0207683_10117027 | |||
| 995 | Ga0207683_10223875 | |||
| 996 | Ga0207698_10001923 | |||
| 997 | Ga0207698_10012628 | |||
| 998 | Ga0207698_10041224 | |||
| 999 | Ga0207698_10130391 | |||
| 1000 | Ga0207698_11202025 | |||
| 1001 | Ga0207428_10015565 | |||
| 1002 | Ga0268266_10289008 | |||
| 1003 | Ga0268266_10412809 | |||
| 1004 | Ga0268265_10000301 | |||
| 1005 | Ga0268265_10488421 | |||
| 1006 | Ga0268264_10098267 | |||
| 1007 | Ga0268264_10134021 | |||
| 1008 | Ga0268264_10520301 | |||
| 1009 | Ga0265337_1077605 | |||
| 1010 | Ga0265319_1000869 | |||
| 1011 | Ga0265334_10001482 | |||
| 1012 | Ga0265334_10036211 | |||
| 1013 | Ga0265318_10018639 | |||
| 1014 | Ga0265336_10029582 | |||
| 1015 | Ga0265338_10037065 | |||
| 1016 | Ga0265330_10021595 | |||
| 1017 | Ga0265332_10045393 | |||
| 1018 | Ga0265328_10158010 | |||
| 1019 | Ga0265329_10026740 | |||
| 1020 | Ga0265340_10050812 | |||
| 1021 | Ga0265339_10302973 | |||
| 1022 | Ga0265327_10020666 | |||
| 1023 | Ga0307513_10007380 | |||
| 1024 | Ga0307509_10023226 | |||
| 1025 | Ga0307408_100090116 | |||
| 1026 | Ga0307408_100885508 | |||
| 1027 | Ga0265313_10015482 | |||
| 1028 | Ga0307508_10042187 | |||
| 1029 | Ga0307508_10048314 | |||
| 1030 | Ga0307508_10155269 | |||
| 1031 | Ga0307514_10201145 | |||
| 1032 | Ga0316575_10005198 | |||
| 1033 | Ga0316575_10025811 | |||
| 1034 | Ga0316579_10032015 | |||
| 1035 | Ga0265314_10045807 | |||
| 1036 | Ga0316576_10215566 | |||
| 1037 | Ga0316578_10016235 | |||
| 1038 | Ga0316578_10030820 | |||
| 1039 | Ga0307405_10030262 | |||
| 1040 | Ga0307405_10047594 | |||
| 1041 | Ga0307405_10739583 | |||
| 1042 | Ga0316577_10132981 | |||
| 1043 | Ga0316577_10237542 | |||
| 1044 | Ga0307413_10692907 | |||
| 1045 | Ga0307518_10207447 | |||
| 1046 | Ga0307406_10185339 | |||
| 1047 | Ga0307412_10242949 | |||
| 1048 | Ga0307409_100101166 | |||
| 1049 | Ga0307409_100111281 | |||
| 1050 | Ga0307416_100236267 | |||
| 1051 | Ga0307416_100322487 | |||
| 1052 | Ga0307416_100518965 | |||
| 1053 | Ga0307411_10309197 | |||
| 1054 | Ga0307415_100150486 | |||
| 1055 | Ga0307415_100181101 | |||
| 1056 | Ga0307415_100190738 | |||
| 1057 | Ga0307415_100213917 | |||
| 1058 | Ga0307415_100397282 | |||
| 1059 | Ga0316580_10007003 | |||
| 1060 | Ga0316580_10035694 | |||
| 1061 | Ga0307510_10228973 | |||
| 1062 | Ga0316574_0182145 | |||
| 1063 | Ga0373937_0250676 | |||
| 1064 | Ga0373937_0361291 | |||
| 1065 | Ga0373937_1021292 | |||
| 1066 | Ga0316582_0004770 | |||
| 1067 | Ga0316584_0000754 | |||
| 1068 | Ga0316584_0467398 | |||
| 1069 | Ga0395899_0003758 | |||
| 1070 | Ga0395900_0014789 | |||
| 1071 | Ga0395900_0810037 | |||
| 1072 | Ga0395898_0003264 | |||
| 1073 | Ga0395905_0003244 | |||
| 1074 | Ga0395901_0026146 | |||
| 1075 | Ga0395901_0333250 | |||
| 1076 | Ga0395901_0926295 | |||
| 1077 | Ga0395901_1369440 | |||
| 1078 | Ga0439436_0073267 | |||
| 1079 | Ga0451795_0975078 | |||
| 1080 | Ga0451833_0404134 | |||
| 1081 | Ga0451841_0720358 | |||
| 1082 | Ga0451845_0268101 | |||
| 1083 | Ga0451849_0427955 | |||
| 1084 | Ga0451843_0735780 | |||
| 1085 | Ga0451853_0250949 | |||
| 1086 | Ga0439433_0017434 | |||
| 1087 | Ga0439448_0031410 | |||
| 1088 | Ga0439448_0056979 | |||
| 1089 | Ga0439449_0024808 | |||
| 1090 | Ga0439457_029288 | |||
| 1091 | Ga0450920_026814 | |||
| 1092 | Ga0450906_012081 | |||
| 1093 | Ga0439459_0022915 | |||
| 1094 | Ga0466969_0004220 | |||
| 1095 | Ga0466965_0061780 | |||
| 1096 | Ga0466966_0012858 | |||
| 1097 | Ga0466961_0004911 | |||
| 1098 | Ga0466963_0028916 | |||
| 1099 | Ga0466963_0040368 | |||
| 1100 | Ga0466963_0044901 | |||
| 1101 | Ga0466964_0023676 | |||
| 1102 | Ga0466957_0464348 | |||
| 1103 | Ga0466960_0001341 | |||
| 1104 | Ga0466959_0038332 | |||
| 1105 | Ga0451576_0000076 | |||
| 1106 | Ga0451576_0002422 | |||
| 1107 | Ga0466967_0001742 | |||
| 1108 | Ga0466967_0003216 | |||
| 1109 | Ga0466967_0052843 | |||
| 1110 | Ga0466967_0082835 | |||
| 1111 | Ga0466967_0105849 | |||
| 1112 | Ga0466967_0218933 | |||
| 1113 | Ga0466967_0866265 | |||
| 1114 | Ga0495629_0388019 | |||
| 1115 | Ga0495638_0208120 | |||
| 1116 | Ga0495651_0099318 | |||
| 1117 | Ga0495651_0394452 | |||
| 1118 | Ga0495653_0078213 | |||
| 1119 | Ga0495662_0000420 | |||
| 1120 | Ga0495664_0013692 | |||
| 1121 | Ga0495585_0119408 | |||
| 1122 | Ga0495608_0053898 | |||
| 1123 | Ga0495608_0093218 | |||
| 1124 | Ga0495630_0029824 | |||
| 1125 | Ga0495663_0024980 | |||
| 1126 | Ga0495666_0001355 | |||
| 1127 | Ga0495652_0171586 | |||
| 1128 | Ga0495640_0005802 | |||
| 1129 | Ga0495586_0004276 | |||
| 1130 | Ga0495587_0060687 | |||
| 1131 | Ga0495598_0130893 | |||
| 1132 | Ga0495645_0057658 | |||
| 1133 | Ga0495667_0047805 | |||
| 1134 | Ga0495667_0085279 | |||
| 1135 | Ga0495634_0052714 | |||
| 1136 | Ga0495635_0150075 | |||
| 1137 | Ga0495657_0039074 | |||
| 1138 | Ga0495599_0035715 | |||
| 1139 | Ga0495646_0012726 | |||
| 1140 | Ga0495613_0014583 | |||
| 1141 | Ga0495589_0172570 | |||
| 1142 | Ga0495600_0027117 | |||
| 1143 | Ga0495660_0245095 | |||
| 1144 | Ga0495581_0030691 | |||
| 1145 | Ga0495604_0007195 | |||
| 1146 | Ga0495674_0513275 | |||
| 1147 | Ga0495680_0382484 | |||
| 1148 | Ga0495675_0008943 | |||
| 1149 | Ga0495675_0349557 | |||
| 1150 | Ga0495684_0213514 | |||
| 1151 | Ga0495593_0010168 | |||
| 1152 | Ga0495602_0069718 | |||
| 1153 | Ga0496100_0004317 | |||
| 1154 | Ga0496100_0032515 | |||
| 1155 | Ga0496101_0004638 | |||
| 1156 | Ga0496101_0006480 | |||
| 1157 | Ga0496102_0001866 | |||
| 1158 | Ga0496102_0050328 | |||
| 1159 | Ga0496102_0303261 | |||
| 1160 | Ga0496103_0252050 | |||
| 1161 | Ga0496104_0005242 | |||
| 1162 | Ga0496104_0006065 | |||
| 1163 | Ga0496104_0498295 | |||
| 1164 | Ga0496105_0000691 | |||
| 1165 | Ga0496106_0001744 | |||
| 1166 | Ga0496106_0009294 | |||
| 1167 | Ga0496106_0078480 | |||
| 1168 | Ga0496107_0018115 | |||
| 1169 | Ga0496107_0532513 | |||
| 1170 | Ga0496108_0007397 | |||
| 1171 | Ga0496108_0025928 | |||
| 1172 | Ga0496108_0026612 | |||
| 1173 | Ga0496108_0055951 | |||
| 1174 | Ga0496109_0016672 | |||
| 1175 | Ga0496109_0079532 | |||
| 1176 | Ga0496109_0152973 | |||
| 1177 | Ga0496109_0305915 | |||
| 1178 | Ga0496109_1123727 | |||
| 1179 | Ga0496110_0001017 | |||
| 1180 | Ga0496110_0004404 | |||
| 1181 | Ga0496110_0066287 | |||
| 1182 | Ga0496110_0067958 | |||
| 1183 | Ga0496110_0580267 | |||
| 1184 | Ga0496110_0639154 | |||
| 1185 | Ga0496111_0002974 | |||
| 1186 | Ga0496111_0004824 | |||
| 1187 | Ga0496111_0042415 | |||
| 1188 | Ga0496111_0062208 | |||
| 1189 | Ga0496112_0011025 | |||
| 1190 | Ga0496112_0613768 | |||
| 1191 | Ga0496113_0003329 | |||
| 1192 | Ga0496113_0311076 | |||
| 1193 | Ga0496114_0007427 | |||
| 1194 | Ga0496114_0023808 | |||
| 1195 | Ga0496114_0099966 | |||
| 1196 | Ga0496114_0364745 | |||
| 1197 | Ga0496114_0938823 | |||
| 1198 | Ga0496115_0008496 | |||
| 1199 | Ga0496115_0521249 | |||
| 1200 | Ga0496117_0000196 | |||
| 1201 | Ga0496118_0009672 | |||
| 1202 | Ga0496118_0052691 | |||
| 1203 | Ga0496119_0300450 | |||
| 1204 | Ga0496125_0021486 | |||
| 1205 | Ga0496125_0198231 | |||
| 1206 | Ga0496126_0013614 | |||
| 1207 | Ga0501031_0022979 | |||
| 1208 | Ga0501031_0031342 | |||
| 1209 | Ga0501031_0052825 | |||
| 1210 | Ga0501032_0002947 | |||
| 1211 | Ga0501033_0012459 | |||
| 1212 | Ga0501033_0051321 | |||
| 1213 | Ga0501034_0007966 | |||
| 1214 | Ga0501034_0017873 | |||
| 1215 | Ga0501034_0040119 | |||
| 1216 | Ga0501036_0002052 | |||
| 1217 | Ga0501036_0006933 | |||
| 1218 | Ga0501036_0047742 | |||
| 1219 | Ga0501036_0108796 | |||
| 1220 | Ga0501037_0011477 | |||
| 1221 | Ga0501037_0017390 | |||
| 1222 | Ga0501038_0000434 | |||
| 1223 | Ga0501038_0003312 | |||
| 1224 | Ga0501038_0060954 | |||
| 1225 | Ga0501039_0019189 | |||
| 1226 | Ga0501039_0037998 | |||
| 1227 | Ga0501039_0052374 | |||
| 1228 | Ga0501040_0017116 | |||
| 1229 | Ga0501040_0122687 | |||
| 1230 | Ga0501041_0002785 | |||
| 1231 | Ga0501041_0063573 | |||
| 1232 | Ga0501042_0010500 | |||
| 1233 | Ga0501042_0078817 | |||
| 1234 | Ga0501043_0005510 | |||
| 1235 | Ga0501043_0007822 | |||
| 1236 | Ga0501046_0023435 | |||
| 1237 | Ga0501046_0025659 | |||
| 1238 | Ga0501047_0001256 | |||
| 1239 | Ga0501047_0004783 | |||
| 1240 | Ga0501048_0002768 | |||
| 1241 | Ga0501048_0018787 | |||
| 1242 | Ga0501048_0057645 | |||
| 1243 | Ga0501067_0045851 | |||
| 1244 | Ga0501068_0014571 | |||
| 1245 | Ga0501070_0011622 | |||
| 1246 | Ga0501070_0220057 | |||
| 1247 | Ga0501071_0000487 | |||
| 1248 | Ga0501071_0000789 | |||
| 1249 | Ga0501072_0046670 | |||
| 1250 | Ga0501072_0078471 | |||
| 1251 | Ga0501072_0370988 | |||
| 1252 | Ga0501073_0000735 | |||
| 1253 | Ga0501073_0022240 | |||
| 1254 | Ga0501074_0004579 | |||
| 1255 | Ga0501074_0013350 | |||
| 1256 | Ga0501075_0002267 | |||
| 1257 | Ga0501075_0288541 | |||
| 1258 | Ga0501076_0056489 | |||
| 1259 | Ga0501076_0108554 | |||
| 1260 | Ga0501077_0577915 | |||
| 1261 | Ga0501079_0016371 | |||
| 1262 | Ga0501079_0076578 | |||
| 1263 | Ga0501079_0518962 | |||
| 1264 | Ga0501080_0000231 | |||
| 1265 | Ga0501080_0110464 | |||
| 1266 | Ga0501081_0019752 | |||
| 1267 | Ga0501083_0029334 | |||
| 1268 | Ga0501083_0029891 | |||
| 1269 | Ga0501035_0035789 | |||
| 1270 | Ga0501044_0010836 | |||
| 1271 | Ga0501044_0056224 | |||
| 1272 | Ga0501044_0067600 | |||
| 1273 | Ga0501044_0263296 | |||
| 1274 | Ga0501045_0013787 | |||
| 1275 | nmdc:mga09592_148400_c1 | |||
| 1276 | nmdc:mga0qj67_139451_c1 | |||
| 1277 | nmdc:mga06r32_251402_c1 | |||
| 1278 | nmdc:mga06r32_514780_c1 | |||
| 1279 | nmdc:mga06r32_549389_c1 | |||
| 1280 | nmdc:mga06r32_718906_c1 | |||
| 1281 | nmdc:mga06r32_951170_c1 | |||
| 1282 | nmdc:mga08y16_15125_c1 | |||
| 1283 | nmdc:mga08y16_275922_c1 | |||
| 1284 | nmdc:mga0n895_6028_c1 | |||
| 1285 | nmdc:mga0rr50_4916_c1 | |||
| 1286 | nmdc:mga08x19_53389_c1 | |||
| 1287 | nmdc:mga0a205_6088_c1 | |||
| 1288 | Ga0495619_0145008 | |||
| 1289 | Ga0500583_0148137 | |||
| 1290 | Ga0500560_085999 | |||
| 1291 | Ga0500593_178322 | |||
| 1292 | Ga0500573_0209636 | |||
| 1293 | Ga0500616_0001051 | |||
| 1294 | Ga0500620_039967 | |||
| 1295 | Ga0501084_0009923 | |||
| 1296 | Ga0501084_0063193 | |||
| 1297 | Ga0501082_0023286 | |||
| 1298 | Ga0501082_0029431 | |||
| 1299 | Ga0501082_0492754 | |||
| 1300 | Ga0530510_0041720 | |||
| 1301 | 8002784710 | |||
| 1302 | 2508670731 | |||
| 1303 | 2644019276 | |||
| 1304 | 2644174184 | |||
| 1305 | 2644445688 | |||
| 1306 | 2676201239 | |||
| 1307 | 2689960535 | |||
| 1308 | 2729906698 | |||
| 1309 | 2731908637 | |||
| 1310 | 2774845815 | |||
| 1311 | 2785374244 | |||
| 1312 | 2816424708 | |||
| 1313 | 2819743770 | |||
| 1314 | 2837272348 | |||
| 1315 | 2861524329 | |||
| 1316 | 2868091901 | |||
| 1317 | 2873321041 | |||
| 1318 | 2897563848 | |||
| 1319 | 2946073198 | |||
| 1320 | 2997453438 | |||
| 1321 | 3006492119 | |||
| 1322 | 8002781564 | |||
| 1323 | 8025485818 | |||
| 1324 | 8056667095 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9878 | 158 | 218 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9877 | 158 | 218 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9832 | 158 | 218 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.979 | 158 | 217 |
| 4wul-assembly1.cif.gz_B | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9767 | 158 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9967 | 159 | 212 | 1.10.10.10 |
| 4if4C02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9697 | 158 | 219 | 1.10.10.10 |
| 4if4D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9682 | 159 | 219 | 1.10.10.10 |
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9663 | 157 | 212 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9651 | 157 | 209 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7XDC5-F1-model_v4 | Response regulator | 0.9671 | 1 | 138 |
GO:0000160
GO:0003677 |
| AF-A0A535F951-F1-model_v4 | Response regulator transcription factor | 0.9185 | 1 | 218 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A7X8SM34-F1-model_v4 | Response regulator transcription factor | 0.9156 | 7 | 223 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A3T1AZC1-F1-model_v4 | DNA-binding response regulator | 0.9046 | 1 | 218 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A366IML7-F1-model_v4 | LuxR family two component transcriptional regulator | 0.9038 | 1 | 219 |
GO:0000160
GO:0003677 GO:0006355 |