F473522

General Info

Members Datasets Scaffolds Average Seq Length
662 364 1324 213

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8002784119|8002784710
Length 253
Sequence RQRRGQGRSQPVVAPVPDPAETPDAARPVAAAGERARAGERTAIHVLVVDDHPVVRSGLVGMLASQPDLRVVGTAADGHEAVARAGELRPDVVLMDLRMPRLDGVAAIERITAAGPDVAVLVLTTYDGDADIVRAVAAGAAGYLLKDAPLETLAEAVRAVARGETVLAPPVAARLASRLRAPDPVTLTRRETEVLAAVARGRTNAEIGRELFIGEATVKTHLLRVFAKLQVDDRTHAVTAALERGLLPPITPA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
184 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
214 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
222 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
223 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
333 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
334 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
335 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
341 8002784119 Frankia sp. AgB1.9 Isolate Nodule
342 2508501039 Frankia saprophytica CN3 Isolate Nodule
343 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
344 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
345 2643221679 Angustibacter sp. Root456 Isolate Unclassified
346 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
347 2687453737 Frankia sp. BMG5.36 Isolate Nodule
348 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
349 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
350 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
351 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
352 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
353 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
354 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
355 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
356 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
357 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
358 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
359 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
360 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
361 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
362 8002775197 Frankia nepalensis CN7 Isolate Nodule
363 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
364 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.62
Metatranscriptomes 0.76
Isolates 3.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 1.06
Rhizoplane 7.25
Rhizosphere 85.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10038865 3300001990 Bacteria 1464
2 JGI24751J29686_10015166 3300002459 Bacteria 1590
3 JGI25160J50197_1008780 3300003354 Bacteria 3818
4 JGI25160J50197_1017210 3300003354 Bacteria 2299
5 JGI25160J50197_1033197 3300003354 Bacteria 1301
6 Ga0070658_10062274 3300005327 Bacteria 3040
7 Ga0070658_10777474 3300005327 Bacteria 832
8 Ga0070683_100001738 3300005329 Bacteria 16950
9 Ga0070683_100004489 3300005329 Bacteria 11509
10 Ga0070683_100163218 3300005329 Bacteria 2114
11 Ga0070683_100228139 3300005329 Bacteria 1770
12 Ga0070683_100683171 3300005329 Bacteria 983
13 Ga0070670_100042340 3300005331 Bacteria 3914
14 Ga0068869_100003397 3300005334 Bacteria 9721
15 Ga0070680_100003706 3300005336 Bacteria 11416
16 Ga0070682_100001094 3300005337 Bacteria 15563
17 Ga0070682_100018782 3300005337 Bacteria 4048
18 Ga0070682_100153233 3300005337 Bacteria 1584
19 Ga0070682_100311607 3300005337 Bacteria 1159
20 Ga0068868_100001681 3300005338 Bacteria 15126
21 Ga0068868_100058962 3300005338 Bacteria 3035
22 Ga0068868_100356984 3300005338 Bacteria 1253
23 Ga0070660_100008931 3300005339 Bacteria 7029
24 Ga0070660_100012443 3300005339 Bacteria 6076
25 Ga0070660_100116385 3300005339 Bacteria 2132
26 Ga0070660_100299761 3300005339 Bacteria 1318
27 Ga0070660_100806141 3300005339 Bacteria 790
28 Ga0070689_100003919 3300005340 Bacteria 9978
29 Ga0070691_10005630 3300005341 Bacteria 5707
30 Ga0070661_100010988 3300005344 Bacteria 6310
31 Ga0070661_100027442 3300005344 Bacteria 4100
32 Ga0070661_100139768 3300005344 Bacteria 1824
33 Ga0070692_10024328 3300005345 Bacteria 2975
34 Ga0070668_100265376 3300005347 Bacteria 1429
35 Ga0070668_100674367 3300005347 Bacteria 910
36 Ga0070675_100002108 3300005354 Bacteria 14706
37 Ga0070675_100040060 3300005354 Bacteria 3824
38 Ga0070673_100768440 3300005364 Bacteria 888
39 Ga0070659_100015785 3300005366 Bacteria 5661
40 Ga0070659_100034579 3300005366 Bacteria 3931
41 Ga0070659_100311482 3300005366 Bacteria 1315
42 Ga0070667_100034753 3300005367 Bacteria 4220
43 Ga0070709_10034950 3300005434 Bacteria 3052
44 Ga0070714_100070945 3300005435 Bacteria 3012
45 Ga0070714_100134385 3300005435 Bacteria 2213
46 Ga0070713_100007764 3300005436 Bacteria 7556
47 Ga0070710_10095728 3300005437 Bacteria 1759
48 Ga0070711_100117227 3300005439 Bacteria 1963
49 Ga0070705_100224777 3300005440 Bacteria 1302
50 Ga0070700_100008843 3300005441 Bacteria 5502
51 Ga0070700_100037211 3300005441 Bacteria 2958
52 Ga0070694_100795112 3300005444 Bacteria 775
53 Ga0070663_100006816 3300005455 Bacteria 6907
54 Ga0070663_100022066 3300005455 Bacteria 4248
55 Ga0070663_100036176 3300005455 Bacteria 3430
56 Ga0070678_100002551 3300005456 Bacteria 9995
57 Ga0070678_100058943 3300005456 Bacteria 2820
58 Ga0070678_100537889 3300005456 Bacteria 1036
59 Ga0070662_100041582 3300005457 Bacteria 3280
60 Ga0070681_10047279 3300005458 Bacteria 4301
61 Ga0068867_100128987 3300005459 Bacteria 1963
62 Ga0068867_100149537 3300005459 Bacteria 1833
63 Ga0070685_10370265 3300005466 Bacteria 984
64 Ga0070707_100187762 3300005468 Bacteria 2015
65 Ga0070679_100110878 3300005530 Bacteria 2730
66 Ga0070679_100199567 3300005530 Bacteria 1967
67 Ga0070679_100605689 3300005530 Bacteria 1039
68 Ga0070684_100000511 3300005535 Bacteria 26664
69 Ga0070684_100002222 3300005535 Bacteria 14315
70 Ga0070684_100010931 3300005535 Bacteria 7214
71 Ga0070684_100068030 3300005535 Bacteria 3130
72 Ga0070684_100216087 3300005535 Bacteria 1748
73 Ga0068853_100078231 3300005539 Bacteria 2890
74 Ga0068853_100079086 3300005539 Bacteria 2875
75 Ga0070696_100002372 3300005546 Bacteria 12454
76 Ga0070693_100107368 3300005547 Bacteria 1711
77 Ga0070665_100004127 3300005548 Bacteria 15284
78 Ga0070665_100410690 3300005548 Bacteria 1362
79 Ga0068855_100038737 3300005563 Bacteria 5663
80 Ga0068855_100337476 3300005563 Bacteria 1662
81 Ga0070664_100000640 3300005564 Bacteria 26835
82 Ga0070664_100018286 3300005564 Bacteria 5754
83 Ga0070664_100117237 3300005564 Bacteria 2329
84 Ga0070664_100161203 3300005564 Bacteria 1984
85 Ga0070664_100239831 3300005564 Bacteria 1627
86 Ga0068857_100042238 3300005577 Bacteria 4044
87 Ga0068857_100060824 3300005577 Bacteria 3355
88 Ga0068857_100062510 3300005577 Bacteria 3310
89 Ga0068857_100199804 3300005577 Bacteria 1822
90 Ga0068854_100019008 3300005578 Bacteria 4622
91 Ga0068854_100071902 3300005578 Bacteria 2532
92 Ga0068856_100010898 3300005614 Bacteria 8824
93 Ga0068856_100015263 3300005614 Bacteria 7421
94 Ga0068856_100016808 3300005614 Bacteria 7089
95 Ga0068856_100159210 3300005614 Bacteria 2268
96 Ga0068856_100220939 3300005614 Bacteria 1910
97 Ga0070702_100001410 3300005615 Bacteria 9817
98 Ga0070702_100006155 3300005615 Bacteria 5658
99 Ga0070702_100121899 3300005615 Bacteria 1634
100 Ga0068852_100007588 3300005616 Bacteria 7930
101 Ga0068852_100034602 3300005616 Bacteria 4205
102 Ga0068852_100066764 3300005616 Bacteria 3142
103 Ga0068852_100757746 3300005616 Bacteria 983
104 Ga0068859_100000197 3300005617 Bacteria 58973
105 Ga0068859_100057833 3300005617 Bacteria 3906
106 Ga0068859_100600100 3300005617 Bacteria 1194
107 Ga0068864_100011626 3300005618 Bacteria 7269
108 Ga0068864_100519414 3300005618 Bacteria 1148
109 Ga0068861_100829180 3300005719 Bacteria 870
110 Ga0068851_10056523 3300005834 Bacteria 2002
111 Ga0068870_10002431 3300005840 Bacteria 7751
112 Ga0068863_100005938 3300005841 Bacteria 11975
113 Ga0068863_100114011 3300005841 Bacteria 2575
114 Ga0068858_100077004 3300005842 Bacteria 3098
115 Ga0068858_100911117 3300005842 Bacteria 860
116 Ga0068860_100051241 3300005843 Bacteria 3928
117 Ga0068860_100523335 3300005843 Bacteria 1186
118 Ga0068862_100000297 3300005844 Bacteria 54476
119 Ga0081455_10002158 3300005937 Bacteria 23486
120 Ga0081455_10010049 3300005937 Bacteria 9661
121 Ga0081455_10016539 3300005937 Bacteria 7117
122 Ga0081455_10064765 3300005937 Bacteria 3059
123 Ga0081455_10159266 3300005937 Bacteria 1732
124 Ga0081455_10385110 3300005937 Bacteria 978
125 Ga0081539_10012271 3300005985 Bacteria 6637
126 Ga0081539_10019168 3300005985 Bacteria 4695
127 Ga0070717_10337119 3300006028 Bacteria 1346
128 Ga0075363_100159145 3300006048 Bacteria 1278
129 Ga0070712_100237298 3300006175 Bacteria 1451
130 Ga0070712_100306480 3300006175 Bacteria 1287
131 Ga0070712_100579964 3300006175 Bacteria 947
132 Ga0068871_100307983 3300006358 Bacteria 1392
133 Ga0068871_100422753 3300006358 Bacteria 1190
134 Ga0075428_100000105 3300006844 Bacteria 70978
135 Ga0075430_100046796 3300006846 Bacteria 3653
136 Ga0075431_100187747 3300006847 Bacteria 2119
137 Ga0075431_100478972 3300006847 Bacteria 1238
138 Ga0075431_100593843 3300006847 Bacteria 1092
139 Ga0075433_10003466 3300006852 Bacteria 12177
140 Ga0075434_100004744 3300006871 Bacteria 12296
141 Ga0075429_100216773 3300006880 Bacteria 1677
142 Ga0068865_100024849 3300006881 Bacteria 3935
143 Ga0075436_100002226 3300006914 Bacteria 13397
144 Ga0097620_100000197 3300006931 Bacteria 58973
145 Ga0097620_100057833 3300006931 Bacteria 3906
146 Ga0097620_100600169 3300006931 Bacteria 1194
147 Ga0099826_10172025 3300006948 Bacteria 1215
148 Ga0075435_100005988 3300007076 Bacteria 8557
149 Ga0105240_10175291 3300009093 Bacteria 2535
150 Ga0111539_10000437 3300009094 Bacteria 52636
151 Ga0111539_10063537 3300009094 Bacteria 4368
152 Ga0105245_10000733 3300009098 Bacteria 29565
153 Ga0105245_10063226 3300009098 Bacteria 3341
154 Ga0105245_10066228 3300009098 Bacteria 3269
155 Ga0105245_10337587 3300009098 Bacteria 1489
156 Ga0105245_10340943 3300009098 Bacteria 1482
157 Ga0105245_10400164 3300009098 Bacteria 1372
158 Ga0105245_10575946 3300009098 Bacteria 1150
159 Ga0105247_10118521 3300009101 Bacteria 1712
160 Ga0114129_10136255 3300009147 Bacteria 3369
161 Ga0114129_11152001 3300009147 Bacteria 968
162 Ga0114129_11805338 3300009147 Bacteria 744
163 Ga0105243_10091071 3300009148 Bacteria 2511
164 Ga0105243_10107937 3300009148 Bacteria 2323
165 Ga0105243_10124326 3300009148 Bacteria 2180
166 Ga0105243_10185041 3300009148 Bacteria 1815
167 Ga0105243_10534713 3300009148 Bacteria 1117
168 Ga0105241_10002283 3300009174 Bacteria 14411
169 Ga0105248_10000035 3300009177 Bacteria 187578
170 Ga0105248_10547651 3300009177 Bacteria 1305
171 Ga0105237_10085375 3300009545 Bacteria 3146
172 Ga0105238_10055000 3300009551 Bacteria 3996
173 Ga0105249_10005312 3300009553 Bacteria 11120
174 Ga0105249_10015419 3300009553 Bacteria 6763
175 Ga0105249_10103789 3300009553 Bacteria 2678
176 Ga0105239_10008499 3300010375 Bacteria 11672
177 Ga0105239_10270085 3300010375 Bacteria 1913
178 Ga0105246_10000885 3300011119 Bacteria 17178
179 Ga0105246_10006167 3300011119 Bacteria 7318
180 Ga0105246_10175139 3300011119 Bacteria 1647
181 Ga0157373_10014822 3300013100 Bacteria 5710
182 Ga0157371_10006408 3300013102 Bacteria 9721
183 Ga0157370_10042656 3300013104 Bacteria 4370
184 Ga0157370_10368056 3300013104 Bacteria 1324
185 Ga0157370_10417784 3300013104 Bacteria 1234
186 Ga0157370_10634672 3300013104 Bacteria 977
187 Ga0157369_10032721 3300013105 Bacteria 5715
188 Ga0157369_10067130 3300013105 Bacteria 3857
189 Ga0157369_10070947 3300013105 Bacteria 3741
190 Ga0157369_10178740 3300013105 Bacteria 2233
191 Ga0157369_10181758 3300013105 Bacteria 2213
192 Ga0157369_10200340 3300013105 Bacteria 2096
193 Ga0157374_10039998 3300013296 Bacteria 4317
194 Ga0163162_10005345 3300013306 Bacteria 12396
195 Ga0163162_10253034 3300013306 Bacteria 1893
196 Ga0163162_10298903 3300013306 Bacteria 1742
197 Ga0163162_10755226 3300013306 Bacteria 1092
198 Ga0157372_10010635 3300013307 Bacteria 9791
199 Ga0157372_10056102 3300013307 Bacteria 4402
200 Ga0157375_10074544 3300013308 Bacteria 3415
201 Ga0157375_10784867 3300013308 Bacteria 1102
202 Ga0163163_10002844 3300014325 Bacteria 14636
203 Ga0163163_10007533 3300014325 Bacteria 9611
204 Ga0163163_10178782 3300014325 Bacteria 2169
205 Ga0163163_10257480 3300014325 Bacteria 1796
206 Ga0163163_10260348 3300014325 Bacteria 1785
207 Ga0163163_10482268 3300014325 Bacteria 1301
208 Ga0157380_10540447 3300014326 Bacteria 1141
209 Ga0157380_11394080 3300014326 Bacteria 751
210 Ga0157377_10003289 3300014745 Bacteria 7295
211 Ga0157377_10038236 3300014745 Bacteria 2648
212 Ga0157377_10388339 3300014745 Bacteria 947
213 Ga0157379_10040880 3300014968 Bacteria 4139
214 Ga0157379_10181742 3300014968 Bacteria 1900
215 Ga0182007_10000669 3300015262 Bacteria 19672
216 Ga0206354_11474104 3300020081 Bacteria 2215
217 Ga0206354_11514635 3300020081 Bacteria 1909
218 Ga0206353_10019210 3300020082 Bacteria 3074
219 Ga0206353_11238337 3300020082 Bacteria 2162
220 Ga0206353_11412544 3300020082 Bacteria 1013
221 Ga0207426_1001409 3300025302 Bacteria 20144
222 Ga0207426_1008328 3300025302 Bacteria 4206
223 Ga0207426_1011006 3300025302 Bacteria 3474
224 Ga0207656_10068512 3300025321 Bacteria 1572
225 Ga0207710_10078548 3300025900 Bacteria 1527
226 Ga0207688_10001800 3300025901 Bacteria 11401
227 Ga0207688_10002104 3300025901 Bacteria 10706
228 Ga0207680_10028762 3300025903 Bacteria 3114
229 Ga0207647_10037746 3300025904 Bacteria 3060
230 Ga0207699_10414306 3300025906 Bacteria 961
231 Ga0207643_10000204 3300025908 Bacteria 41257
232 Ga0207643_10135488 3300025908 Bacteria 1468
233 Ga0207705_10005372 3300025909 Bacteria 9580
234 Ga0207705_10048350 3300025909 Bacteria 3060
235 Ga0207654_10008897 3300025911 Bacteria 5092
236 Ga0207707_10011023 3300025912 Bacteria 7864
237 Ga0207707_10338851 3300025912 Bacteria 1297
238 Ga0207695_10309131 3300025913 Bacteria 1471
239 Ga0207693_10092552 3300025915 Bacteria 2369
240 Ga0207693_10101714 3300025915 Bacteria 2254
241 Ga0207663_10008959 3300025916 Bacteria 5265
242 Ga0207660_10008053 3300025917 Bacteria 6817
243 Ga0207662_10178533 3300025918 Bacteria 1365
244 Ga0207662_10285770 3300025918 Bacteria 1093
245 Ga0207657_10009523 3300025919 Bacteria 9755
246 Ga0207657_10057306 3300025919 Bacteria 3357
247 Ga0207657_10183580 3300025919 Bacteria 1690
248 Ga0207657_10555594 3300025919 Bacteria 897
249 Ga0207649_10009766 3300025920 Bacteria 5256
250 Ga0207649_10010945 3300025920 Bacteria 4989
251 Ga0207649_10109648 3300025920 Bacteria 1842
252 Ga0207652_10009474 3300025921 Bacteria 7829
253 Ga0207652_10178509 3300025921 Bacteria 1907
254 Ga0207652_10388493 3300025921 Bacteria 1259
255 Ga0207652_10427579 3300025921 Bacteria 1194
256 Ga0207652_10542619 3300025921 Bacteria 1045
257 Ga0207646_10126493 3300025922 Bacteria 2298
258 Ga0207681_10253871 3300025923 Bacteria 1374
259 Ga0207694_10029050 3300025924 Bacteria 4217
260 Ga0207694_10222597 3300025924 Bacteria 1540
261 Ga0207650_10000859 3300025925 Bacteria 23092
262 Ga0207659_10023225 3300025926 Bacteria 4136
263 Ga0207659_10225948 3300025926 Bacteria 1507
264 Ga0207687_10026156 3300025927 Bacteria 3907
265 Ga0207687_10040796 3300025927 Bacteria 3184
266 Ga0207687_10252263 3300025927 Bacteria 1403
267 Ga0207687_10331138 3300025927 Bacteria 1235
268 Ga0207700_10111470 3300025928 Bacteria 2202
269 Ga0207664_10276637 3300025929 Bacteria 1472
270 Ga0207644_10004724 3300025931 Bacteria 8850
271 Ga0207644_10135285 3300025931 Bacteria 1892
272 Ga0207690_10090817 3300025932 Bacteria 2157
273 Ga0207690_10285634 3300025932 Bacteria 1286
274 Ga0207706_10053763 3300025933 Bacteria 3554
275 Ga0207706_10161540 3300025933 Bacteria 1969
276 Ga0207686_10139794 3300025934 Bacteria 1672
277 Ga0207686_10356219 3300025934 Bacteria 1103
278 Ga0207709_10093249 3300025935 Bacteria 1974
279 Ga0207709_10378050 3300025935 Bacteria 1077
280 Ga0207670_10010858 3300025936 Bacteria 5256
281 Ga0207704_10012901 3300025938 Bacteria 4163
282 Ga0207665_10096253 3300025939 Bacteria 2059
283 Ga0207691_10047895 3300025940 Bacteria 3920
284 Ga0207691_10279790 3300025940 Bacteria 1436
285 Ga0207711_10000444 3300025941 Bacteria 43144
286 Ga0207711_10408556 3300025941 Bacteria 1262
287 Ga0207689_10000223 3300025942 Bacteria 50338
288 Ga0207689_10024781 3300025942 Bacteria 5030
289 Ga0207689_10112825 3300025942 Bacteria 2234
290 Ga0207661_10001364 3300025944 Bacteria 16377
291 Ga0207661_10022564 3300025944 Bacteria 4743
292 Ga0207661_10098042 3300025944 Bacteria 2455
293 Ga0207661_10315375 3300025944 Bacteria 1404
294 Ga0207661_10971253 3300025944 Bacteria 782
295 Ga0207679_10011410 3300025945 Bacteria 5754
296 Ga0207679_10145582 3300025945 Bacteria 1921
297 Ga0207679_10237872 3300025945 Bacteria 1541
298 Ga0207679_10398424 3300025945 Bacteria 1210
299 Ga0207651_10701839 3300025960 Bacteria 891
300 Ga0207712_10003154 3300025961 Bacteria 10516
301 Ga0207712_10466811 3300025961 Bacteria 1073
302 Ga0207668_10488451 3300025972 Bacteria 1057
303 Ga0207640_10011341 3300025981 Bacteria 5045
304 Ga0207677_10055446 3300026023 Bacteria 2710
305 Ga0207677_10218333 3300026023 Bacteria 1527
306 Ga0207677_10560875 3300026023 Bacteria 997
307 Ga0207703_10020493 3300026035 Bacteria 5170
308 Ga0207703_10025884 3300026035 Bacteria 4616
309 Ga0207703_10526780 3300026035 Bacteria 1112
310 Ga0207639_10025701 3300026041 Bacteria 4272
311 Ga0207678_10000183 3300026067 Bacteria 53634
312 Ga0207678_10010292 3300026067 Bacteria 8209
313 Ga0207678_10121349 3300026067 Bacteria 2230
314 Ga0207678_10474362 3300026067 Bacteria 1089
315 Ga0207708_10010862 3300026075 Bacteria 6773
316 Ga0207708_10022607 3300026075 Bacteria 4748
317 Ga0207702_10003008 3300026078 Bacteria 15672
318 Ga0207702_10004779 3300026078 Bacteria 11940
319 Ga0207702_10114398 3300026078 Bacteria 2404
320 Ga0207702_10131774 3300026078 Bacteria 2250
321 Ga0207641_10005837 3300026088 Bacteria 10449
322 Ga0207641_10108153 3300026088 Bacteria 2461
323 Ga0207641_10164364 3300026088 Bacteria 2020
324 Ga0207648_10194967 3300026089 Bacteria 1796
325 Ga0207676_10001332 3300026095 Bacteria 18376
326 Ga0207676_10103084 3300026095 Bacteria 2370
327 Ga0207674_10076730 3300026116 Bacteria 3349
328 Ga0207674_10207274 3300026116 Bacteria 1910
329 Ga0207674_10229951 3300026116 Bacteria 1802
330 Ga0207675_101440182 3300026118 Bacteria 710
331 Ga0207683_10015673 3300026121 Bacteria 6451
332 Ga0207683_10117027 3300026121 Bacteria 2390
333 Ga0207683_10223875 3300026121 Bacteria 1714
334 Ga0207698_10001923 3300026142 Bacteria 12178
335 Ga0207698_10012628 3300026142 Bacteria 5534
336 Ga0207698_10041224 3300026142 Bacteria 3438
337 Ga0207698_10130391 3300026142 Bacteria 2147
338 Ga0207698_11202025 3300026142 Bacteria 772
339 Ga0207428_10015565 3300027907 Bacteria 6574
340 Ga0268266_10289008 3300028379 Bacteria 1526
341 Ga0268266_10412809 3300028379 Bacteria 1278
342 Ga0268265_10000301 3300028380 Bacteria 55125
343 Ga0268265_10488421 3300028380 Bacteria 1158
344 Ga0268264_10098267 3300028381 Bacteria 2538
345 Ga0268264_10134021 3300028381 Bacteria 2200
346 Ga0268264_10520301 3300028381 Bacteria 1163
347 Ga0265337_1077605 3300028556 Bacteria 910
348 Ga0265319_1000869 3300028563 Bacteria 19204
349 Ga0265334_10001482 3300028573 Bacteria 11317
350 Ga0265334_10036211 3300028573 Bacteria 1949
351 Ga0265318_10018639 3300028577 Bacteria 2827
352 Ga0265336_10029582 3300028666 Bacteria 1709
353 Ga0265338_10037065 3300028800 Bacteria 4649
354 Ga0265330_10021595 3300031235 Bacteria 2935
355 Ga0265332_10045393 3300031238 Bacteria 1894
356 Ga0265328_10158010 3300031239 Bacteria 854
357 Ga0265329_10026740 3300031242 Bacteria 1899
358 Ga0265340_10050812 3300031247 Bacteria 2009
359 Ga0265339_10302973 3300031249 Bacteria 761
360 Ga0265327_10020666 3300031251 Bacteria 4001
361 Ga0307513_10007380 3300031456 Bacteria 14267
362 Ga0307509_10023226 3300031507 Bacteria 6971
363 Ga0307408_100090116 3300031548 Bacteria 2313
364 Ga0307408_100885508 3300031548 Bacteria 816
365 Ga0265313_10015482 3300031595 Bacteria 4435
366 Ga0307508_10042187 3300031616 Bacteria 4094
367 Ga0307508_10048314 3300031616 Bacteria 3791
368 Ga0307508_10155269 3300031616 Bacteria 1892
369 Ga0307514_10201145 3300031649 Bacteria 1252
370 Ga0316575_10005198 3300031665 Bacteria 4629
371 Ga0316575_10025811 3300031665 Bacteria 2281
372 Ga0316579_10032015 3300031691 Bacteria 2410
373 Ga0265314_10045807 3300031711 Bacteria 3089
374 Ga0316576_10215566 3300031727 Bacteria 1444
375 Ga0316578_10016235 3300031728 Bacteria 4024
376 Ga0316578_10030820 3300031728 Bacteria 3051
377 Ga0307405_10030262 3300031731 Bacteria 3173
378 Ga0307405_10047594 3300031731 Bacteria 2642
379 Ga0307405_10739583 3300031731 Bacteria 818
380 Ga0316577_10132981 3300031733 Bacteria 1400
381 Ga0316577_10237542 3300031733 Bacteria 1030
382 Ga0307413_10692907 3300031824 Bacteria 845
383 Ga0307518_10207447 3300031838 Bacteria 1294
384 Ga0307406_10185339 3300031901 Bacteria 1519
385 Ga0307412_10242949 3300031911 Bacteria 1394
386 Ga0307409_100101166 3300031995 Bacteria 2391
387 Ga0307409_100111281 3300031995 Bacteria 2297
388 Ga0307416_100236267 3300032002 Bacteria 1767
389 Ga0307416_100322487 3300032002 Bacteria 1548
390 Ga0307416_100518965 3300032002 Bacteria 1259
391 Ga0307411_10309197 3300032005 Bacteria 1271
392 Ga0307415_100150486 3300032126 Bacteria 1791
393 Ga0307415_100181101 3300032126 Bacteria 1653
394 Ga0307415_100190738 3300032126 Bacteria 1617
395 Ga0307415_100213917 3300032126 Bacteria 1540
396 Ga0307415_100397282 3300032126 Bacteria 1176
397 Ga0316580_10007003 3300032139 Bacteria 3344
398 Ga0316580_10035694 3300032139 Bacteria 1538
399 Ga0307510_10228973 3300033180 Bacteria 1363
400 Ga0316574_0182145 3300035398 Bacteria 1351
401 Ga0373937_0250676 3300036401 Bacteria 1669
402 Ga0373937_0361291 3300036401 Bacteria 1376
403 Ga0373937_1021292 3300036401 Bacteria 776
404 Ga0316582_0004770 3300036647 Bacteria 6909
405 Ga0316584_0000754 3300036712 Bacteria 18048
406 Ga0316584_0467398 3300036712 Bacteria 890
407 Ga0395899_0003758 3300037312 Bacteria 11991
408 Ga0395900_0014789 3300037418 Bacteria 7952
409 Ga0395900_0810037 3300037418 Bacteria 864
410 Ga0395898_0003264 3300037466 Bacteria 18227
411 Ga0395905_0003244 3300037471 Bacteria 17494
412 Ga0395901_0026146 3300038443 Bacteria 5992
413 Ga0395901_0333250 3300038443 Bacteria 1568
414 Ga0395901_0926295 3300038443 Bacteria 852
415 Ga0395901_1369440 3300038443 Bacteria 667
416 Ga0439436_0073267 3300041404 Bacteria 954
417 Ga0451795_0975078 3300041456 Bacteria 1832
418 Ga0451833_0404134 3300041491 Bacteria 1001
419 Ga0451841_0720358 3300041498 Bacteria 1309
420 Ga0451845_0268101 3300041501 Bacteria 723
421 Ga0451849_0427955 3300041505 Bacteria 690
422 Ga0451843_0735780 3300041509 Bacteria 1019
423 Ga0451853_0250949 3300041512 Bacteria 1046
424 Ga0439433_0017434 3300041999 Bacteria 1594
425 Ga0439448_0031410 3300042005 Bacteria 1687
426 Ga0439448_0056979 3300042005 Bacteria 1287
427 Ga0439449_0024808 3300042007 Bacteria 2241
428 Ga0439457_029288 3300042014 Bacteria 1220
429 Ga0450920_026814 3300042122 Bacteria 1125
430 Ga0450906_012081 3300042145 Bacteria 1605
431 Ga0439459_0022915 3300042438 Bacteria 1212
432 Ga0466969_0004220 3300044656 Bacteria 7631
433 Ga0466965_0061780 3300044683 Bacteria 1873
434 Ga0466966_0012858 3300044684 Bacteria 5543
435 Ga0466961_0004911 3300044693 Bacteria 8409
436 Ga0466963_0028916 3300044694 Bacteria 3563
437 Ga0466963_0040368 3300044694 Bacteria 3059
438 Ga0466963_0044901 3300044694 Bacteria 2909
439 Ga0466964_0023676 3300044706 Bacteria 2388
440 Ga0466957_0464348 3300044842 Bacteria 874
441 Ga0466960_0001341 3300044901 Bacteria 8956
442 Ga0466959_0038332 3300045049 Bacteria 3541
443 Ga0451576_0000076 3300045051 Bacteria 245246
444 Ga0451576_0002422 3300045051 Bacteria 27946
445 Ga0466967_0001742 3300045976 Bacteria 12989
446 Ga0466967_0003216 3300045976 Bacteria 10554
447 Ga0466967_0052843 3300045976 Bacteria 3569
448 Ga0466967_0082835 3300045976 Bacteria 2900
449 Ga0466967_0105849 3300045976 Bacteria 2577
450 Ga0466967_0218933 3300045976 Bacteria 1808
451 Ga0466967_0866265 3300045976 Bacteria 898
452 Ga0495629_0388019 3300046459 Bacteria 950
453 Ga0495638_0208120 3300046460 Bacteria 1100
454 Ga0495651_0099318 3300046462 Bacteria 2170
455 Ga0495651_0394452 3300046462 Bacteria 905
456 Ga0495653_0078213 3300046463 Bacteria 2453
457 Ga0495662_0000420 3300046476 Bacteria 18983
458 Ga0495664_0013692 3300046477 Bacteria 4601
459 Ga0495585_0119408 3300046492 Bacteria 1396
460 Ga0495608_0053898 3300046511 Bacteria 2659
461 Ga0495608_0093218 3300046511 Bacteria 1946
462 Ga0495630_0029824 3300046517 Bacteria 4055
463 Ga0495663_0024980 3300046525 Bacteria 1740
464 Ga0495666_0001355 3300046526 Bacteria 11875
465 Ga0495652_0171586 3300046529 Bacteria 1673
466 Ga0495640_0005802 3300046533 Bacteria 9807
467 Ga0495586_0004276 3300046535 Bacteria 7635
468 Ga0495587_0060687 3300046536 Bacteria 2216
469 Ga0495598_0130893 3300046537 Bacteria 860
470 Ga0495645_0057658 3300046543 Bacteria 2818
471 Ga0495667_0047805 3300046559 Bacteria 2825
472 Ga0495667_0085279 3300046559 Bacteria 2050
473 Ga0495634_0052714 3300046642 Bacteria 2726
474 Ga0495635_0150075 3300046663 Bacteria 1586
475 Ga0495657_0039074 3300046675 Bacteria 3262
476 Ga0495599_0035715 3300046678 Bacteria 3120
477 Ga0495646_0012726 3300046680 Bacteria 5346
478 Ga0495613_0014583 3300046689 Bacteria 5828
479 Ga0495589_0172570 3300046794 Bacteria 1028
480 Ga0495600_0027117 3300046809 Bacteria 3701
481 Ga0495660_0245095 3300046810 Bacteria 834
482 Ga0495581_0030691 3300047315 Bacteria 3113
483 Ga0495604_0007195 3300047317 Bacteria 8815
484 Ga0495674_0513275 3300047319 Bacteria 957
485 Ga0495680_0382484 3300047322 Bacteria 975
486 Ga0495675_0008943 3300047444 Bacteria 6225
487 Ga0495675_0349557 3300047444 Bacteria 870
488 Ga0495684_0213514 3300047471 Bacteria 1417
489 Ga0495593_0010168 3300047673 Bacteria 5445
490 Ga0495602_0069718 3300048088 Bacteria 3012
491 Ga0496100_0004317 3300048903 Bacteria 7527
492 Ga0496100_0032515 3300048903 Bacteria 3255
493 Ga0496101_0004638 3300048904 Bacteria 8689
494 Ga0496101_0006480 3300048904 Bacteria 7536
495 Ga0496102_0001866 3300048905 Bacteria 18148
496 Ga0496102_0050328 3300048905 Bacteria 3793
497 Ga0496102_0303261 3300048905 Bacteria 1505
498 Ga0496103_0252050 3300048906 Bacteria 1136
499 Ga0496104_0005242 3300048907 Bacteria 11331
500 Ga0496104_0006065 3300048907 Bacteria 10608
501 Ga0496104_0498295 3300048907 Bacteria 1129
502 Ga0496105_0000691 3300048908 Bacteria 22703
503 Ga0496106_0001744 3300048909 Bacteria 16241
504 Ga0496106_0009294 3300048909 Bacteria 7264
505 Ga0496106_0078480 3300048909 Bacteria 2534
506 Ga0496107_0018115 3300048910 Bacteria 4955
507 Ga0496107_0532513 3300048910 Bacteria 871
508 Ga0496108_0007397 3300048911 Bacteria 8905
509 Ga0496108_0025928 3300048911 Bacteria 4835
510 Ga0496108_0026612 3300048911 Bacteria 4772
511 Ga0496108_0055951 3300048911 Bacteria 3313
512 Ga0496109_0016672 3300048912 Bacteria 6427
513 Ga0496109_0079532 3300048912 Bacteria 3020
514 Ga0496109_0152973 3300048912 Bacteria 2160
515 Ga0496109_0305915 3300048912 Bacteria 1499
516 Ga0496109_1123727 3300048912 Bacteria 723
517 Ga0496110_0001017 3300048913 Bacteria 19745
518 Ga0496110_0004404 3300048913 Bacteria 10907
519 Ga0496110_0066287 3300048913 Bacteria 3193
520 Ga0496110_0067958 3300048913 Bacteria 3154
521 Ga0496110_0580267 3300048913 Bacteria 1018
522 Ga0496110_0639154 3300048913 Bacteria 963
523 Ga0496111_0002974 3300048914 Bacteria 10385
524 Ga0496111_0004824 3300048914 Bacteria 8552
525 Ga0496111_0042415 3300048914 Bacteria 3267
526 Ga0496111_0062208 3300048914 Bacteria 2707
527 Ga0496112_0011025 3300048915 Bacteria 8236
528 Ga0496112_0613768 3300048915 Bacteria 1019
529 Ga0496113_0003329 3300048916 Bacteria 9597
530 Ga0496113_0311076 3300048916 Bacteria 1262
531 Ga0496114_0007427 3300048917 Bacteria 8665
532 Ga0496114_0023808 3300048917 Bacteria 4997
533 Ga0496114_0099966 3300048917 Bacteria 2474
534 Ga0496114_0364745 3300048917 Bacteria 1278
535 Ga0496114_0938823 3300048917 Bacteria 747
536 Ga0496115_0008496 3300048918 Bacteria 7594
537 Ga0496115_0521249 3300048918 Bacteria 953
538 Ga0496117_0000196 3300048920 Bacteria 119243
539 Ga0496118_0009672 3300048921 Bacteria 9689
540 Ga0496118_0052691 3300048921 Bacteria 3100
541 Ga0496119_0300450 3300048922 Bacteria 792
542 Ga0496125_0021486 3300048928 Bacteria 6020
543 Ga0496125_0198231 3300048928 Bacteria 1318
544 Ga0496126_0013614 3300048929 Bacteria 8259
545 Ga0501031_0022979 3300049568 Bacteria 4066
546 Ga0501031_0031342 3300049568 Bacteria 3468
547 Ga0501031_0052825 3300049568 Bacteria 2647
548 Ga0501032_0002947 3300049569 Bacteria 13233
549 Ga0501033_0012459 3300049570 Bacteria 6491
550 Ga0501033_0051321 3300049570 Bacteria 3057
551 Ga0501034_0007966 3300049571 Bacteria 11247
552 Ga0501034_0017873 3300049571 Bacteria 7272
553 Ga0501034_0040119 3300049571 Bacteria 4740
554 Ga0501036_0002052 3300049572 Bacteria 15697
555 Ga0501036_0006933 3300049572 Bacteria 9213
556 Ga0501036_0047742 3300049572 Bacteria 3625
557 Ga0501036_0108796 3300049572 Bacteria 2343
558 Ga0501037_0011477 3300049573 Bacteria 6524
559 Ga0501037_0017390 3300049573 Bacteria 5295
560 Ga0501038_0000434 3300049574 Bacteria 36402
561 Ga0501038_0003312 3300049574 Bacteria 15024
562 Ga0501038_0060954 3300049574 Bacteria 3227
563 Ga0501039_0019189 3300049575 Bacteria 5247
564 Ga0501039_0037998 3300049575 Bacteria 3718
565 Ga0501039_0052374 3300049575 Bacteria 3158
566 Ga0501040_0017116 3300049576 Bacteria 4810
567 Ga0501040_0122687 3300049576 Bacteria 1824
568 Ga0501041_0002785 3300049577 Bacteria 9978
569 Ga0501041_0063573 3300049577 Bacteria 2260
570 Ga0501042_0010500 3300049578 Bacteria 6213
571 Ga0501042_0078817 3300049578 Bacteria 2359
572 Ga0501043_0005510 3300049579 Bacteria 10224
573 Ga0501043_0007822 3300049579 Bacteria 8452
574 Ga0501046_0023435 3300049580 Bacteria 5079
575 Ga0501046_0025659 3300049580 Bacteria 4821
576 Ga0501047_0001256 3300049581 Bacteria 25098
577 Ga0501047_0004783 3300049581 Bacteria 12741
578 Ga0501048_0002768 3300049582 Bacteria 13383
579 Ga0501048_0018787 3300049582 Bacteria 5081
580 Ga0501048_0057645 3300049582 Bacteria 2754
581 Ga0501067_0045851 3300049583 Bacteria 2427
582 Ga0501068_0014571 3300049584 Bacteria 4498
583 Ga0501070_0011622 3300049586 Bacteria 7433
584 Ga0501070_0220057 3300049586 Bacteria 1557
585 Ga0501071_0000487 3300049587 Bacteria 20080
586 Ga0501071_0000789 3300049587 Bacteria 16884
587 Ga0501072_0046670 3300049588 Bacteria 3410
588 Ga0501072_0078471 3300049588 Bacteria 2614
589 Ga0501072_0370988 3300049588 Bacteria 1136
590 Ga0501073_0000735 3300049589 Bacteria 23193
591 Ga0501073_0022240 3300049589 Bacteria 4569
592 Ga0501074_0004579 3300049590 Bacteria 9903
593 Ga0501074_0013350 3300049590 Bacteria 5974
594 Ga0501075_0002267 3300049591 Bacteria 12745
595 Ga0501075_0288541 3300049591 Bacteria 1250
596 Ga0501076_0056489 3300049592 Bacteria 3116
597 Ga0501076_0108554 3300049592 Bacteria 2241
598 Ga0501077_0577915 3300049593 Bacteria 721
599 Ga0501079_0016371 3300049741 Bacteria 5663
600 Ga0501079_0076578 3300049741 Bacteria 2587
601 Ga0501079_0518962 3300049741 Bacteria 937
602 Ga0501080_0000231 3300049742 Bacteria 42074
603 Ga0501080_0110464 3300049742 Bacteria 2548
604 Ga0501081_0019752 3300049743 Bacteria 4490
605 Ga0501083_0029334 3300049744 Bacteria 3785
606 Ga0501083_0029891 3300049744 Bacteria 3744
607 Ga0501035_0035789 3300049822 Bacteria 4504
608 Ga0501044_0010836 3300049823 Bacteria 9889
609 Ga0501044_0056224 3300049823 Bacteria 4039
610 Ga0501044_0067600 3300049823 Bacteria 3641
611 Ga0501044_0263296 3300049823 Bacteria 1662
612 Ga0501045_0013787 3300049824 Bacteria 5714
613 nmdc:mga09592_148400_c1 3300050508 Bacteria 2022
614 nmdc:mga0qj67_139451_c1 3300050509 Bacteria 1965
615 nmdc:mga06r32_251402_c1 3300050510 Bacteria 1755
616 nmdc:mga06r32_514780_c1 3300050510 Bacteria 1173
617 nmdc:mga06r32_549389_c1 3300050510 Bacteria 1129
618 nmdc:mga06r32_718906_c1 3300050510 Bacteria 963
619 nmdc:mga06r32_951170_c1 3300050510 Bacteria 813
620 nmdc:mga08y16_15125_c1 3300050511 Bacteria 8111
621 nmdc:mga08y16_275922_c1 3300050511 Bacteria 1735
622 nmdc:mga0n895_6028_c1 3300050512 Bacteria 10217
623 nmdc:mga0rr50_4916_c1 3300050513 Bacteria 7910
624 nmdc:mga08x19_53389_c1 3300050514 Bacteria 2601
625 nmdc:mga0a205_6088_c1 3300050515 Bacteria 10880
626 Ga0495619_0145008 3300053085 Bacteria 1636
627 Ga0500583_0148137 3300053092 Bacteria 1168
628 Ga0500560_085999 3300053107 Bacteria 1048
629 Ga0500593_178322 3300053117 Bacteria 792
630 Ga0500573_0209636 3300053140 Bacteria 1029
631 Ga0500616_0001051 3300053153 Bacteria 29163
632 Ga0500620_039967 3300053155 Bacteria 1534
633 Ga0501084_0009923 3300054114 Bacteria 7871
634 Ga0501084_0063193 3300054114 Bacteria 3099
635 Ga0501082_0023286 3300060353 Bacteria 5342
636 Ga0501082_0029431 3300060353 Bacteria 4731
637 Ga0501082_0492754 3300060353 Bacteria 1071
638 Ga0530510_0041720 3300061734 Bacteria 3313
639 8002784710 8002784119 Bacteria 9788632
640 2508670731 2508501039 Bacteria 9978592
641 2644019276 2643221601 Bacteria 7493239
642 2644174184 2643221631 Bacteria 8168043
643 2644445688 2643221679 Bacteria 3839507
644 2676201239 2675902999 Bacteria 9438463
645 2689960535 2687453737 Bacteria 11203906
646 2729906698 2728369276 Bacteria 5610032
647 2731908637 2731639228 Bacteria 4187555
648 2774845815 2773857921 Bacteria 9435764
649 2785374244 2784746768 Bacteria 10036182
650 2816424708 2816332119 Bacteria 8120218
651 2819743770 2818991472 Bacteria 10089953
652 2837272348 2837268691 Bacteria 7850704
653 2861524329 2861520306 Bacteria 8348283
654 2868091901 2868088558 Bacteria 7609351
655 2873321041 2873314349 Bacteria 8512634
656 2897563848 2897561785 Bacteria 3256946
657 2946073198 2946072368 Bacteria 8999607
658 2997453438 2997451912 Bacteria 8492419
659 3006492119 3006486233 Bacteria 8157040
660 8002781564 8002775197 Bacteria 10728764
661 8025485818 8025478263 Bacteria 8209203
662 8056667095 8056667051 Bacteria 6953971
663 JGI24737J22298_10038865
664 JGI24751J29686_10015166
665 JGI25160J50197_1008780
666 JGI25160J50197_1017210
667 JGI25160J50197_1033197
668 Ga0070658_10062274
669 Ga0070658_10777474
670 Ga0070683_100001738
671 Ga0070683_100004489
672 Ga0070683_100163218
673 Ga0070683_100228139
674 Ga0070683_100683171
675 Ga0070670_100042340
676 Ga0068869_100003397
677 Ga0070680_100003706
678 Ga0070682_100001094
679 Ga0070682_100018782
680 Ga0070682_100153233
681 Ga0070682_100311607
682 Ga0068868_100001681
683 Ga0068868_100058962
684 Ga0068868_100356984
685 Ga0070660_100008931
686 Ga0070660_100012443
687 Ga0070660_100116385
688 Ga0070660_100299761
689 Ga0070660_100806141
690 Ga0070689_100003919
691 Ga0070691_10005630
692 Ga0070661_100010988
693 Ga0070661_100027442
694 Ga0070661_100139768
695 Ga0070692_10024328
696 Ga0070668_100265376
697 Ga0070668_100674367
698 Ga0070675_100002108
699 Ga0070675_100040060
700 Ga0070673_100768440
701 Ga0070659_100015785
702 Ga0070659_100034579
703 Ga0070659_100311482
704 Ga0070667_100034753
705 Ga0070709_10034950
706 Ga0070714_100070945
707 Ga0070714_100134385
708 Ga0070713_100007764
709 Ga0070710_10095728
710 Ga0070711_100117227
711 Ga0070705_100224777
712 Ga0070700_100008843
713 Ga0070700_100037211
714 Ga0070694_100795112
715 Ga0070663_100006816
716 Ga0070663_100022066
717 Ga0070663_100036176
718 Ga0070678_100002551
719 Ga0070678_100058943
720 Ga0070678_100537889
721 Ga0070662_100041582
722 Ga0070681_10047279
723 Ga0068867_100128987
724 Ga0068867_100149537
725 Ga0070685_10370265
726 Ga0070707_100187762
727 Ga0070679_100110878
728 Ga0070679_100199567
729 Ga0070679_100605689
730 Ga0070684_100000511
731 Ga0070684_100002222
732 Ga0070684_100010931
733 Ga0070684_100068030
734 Ga0070684_100216087
735 Ga0068853_100078231
736 Ga0068853_100079086
737 Ga0070696_100002372
738 Ga0070693_100107368
739 Ga0070665_100004127
740 Ga0070665_100410690
741 Ga0068855_100038737
742 Ga0068855_100337476
743 Ga0070664_100000640
744 Ga0070664_100018286
745 Ga0070664_100117237
746 Ga0070664_100161203
747 Ga0070664_100239831
748 Ga0068857_100042238
749 Ga0068857_100060824
750 Ga0068857_100062510
751 Ga0068857_100199804
752 Ga0068854_100019008
753 Ga0068854_100071902
754 Ga0068856_100010898
755 Ga0068856_100015263
756 Ga0068856_100016808
757 Ga0068856_100159210
758 Ga0068856_100220939
759 Ga0070702_100001410
760 Ga0070702_100006155
761 Ga0070702_100121899
762 Ga0068852_100007588
763 Ga0068852_100034602
764 Ga0068852_100066764
765 Ga0068852_100757746
766 Ga0068859_100000197
767 Ga0068859_100057833
768 Ga0068859_100600100
769 Ga0068864_100011626
770 Ga0068864_100519414
771 Ga0068861_100829180
772 Ga0068851_10056523
773 Ga0068870_10002431
774 Ga0068863_100005938
775 Ga0068863_100114011
776 Ga0068858_100077004
777 Ga0068858_100911117
778 Ga0068860_100051241
779 Ga0068860_100523335
780 Ga0068862_100000297
781 Ga0081455_10002158
782 Ga0081455_10010049
783 Ga0081455_10016539
784 Ga0081455_10064765
785 Ga0081455_10159266
786 Ga0081455_10385110
787 Ga0081539_10012271
788 Ga0081539_10019168
789 Ga0070717_10337119
790 Ga0075363_100159145
791 Ga0070712_100237298
792 Ga0070712_100306480
793 Ga0070712_100579964
794 Ga0068871_100307983
795 Ga0068871_100422753
796 Ga0075428_100000105
797 Ga0075430_100046796
798 Ga0075431_100187747
799 Ga0075431_100478972
800 Ga0075431_100593843
801 Ga0075433_10003466
802 Ga0075434_100004744
803 Ga0075429_100216773
804 Ga0068865_100024849
805 Ga0075436_100002226
806 Ga0097620_100000197
807 Ga0097620_100057833
808 Ga0097620_100600169
809 Ga0099826_10172025
810 Ga0075435_100005988
811 Ga0105240_10175291
812 Ga0111539_10000437
813 Ga0111539_10063537
814 Ga0105245_10000733
815 Ga0105245_10063226
816 Ga0105245_10066228
817 Ga0105245_10337587
818 Ga0105245_10340943
819 Ga0105245_10400164
820 Ga0105245_10575946
821 Ga0105247_10118521
822 Ga0114129_10136255
823 Ga0114129_11152001
824 Ga0114129_11805338
825 Ga0105243_10091071
826 Ga0105243_10107937
827 Ga0105243_10124326
828 Ga0105243_10185041
829 Ga0105243_10534713
830 Ga0105241_10002283
831 Ga0105248_10000035
832 Ga0105248_10547651
833 Ga0105237_10085375
834 Ga0105238_10055000
835 Ga0105249_10005312
836 Ga0105249_10015419
837 Ga0105249_10103789
838 Ga0105239_10008499
839 Ga0105239_10270085
840 Ga0105246_10000885
841 Ga0105246_10006167
842 Ga0105246_10175139
843 Ga0157373_10014822
844 Ga0157371_10006408
845 Ga0157370_10042656
846 Ga0157370_10368056
847 Ga0157370_10417784
848 Ga0157370_10634672
849 Ga0157369_10032721
850 Ga0157369_10067130
851 Ga0157369_10070947
852 Ga0157369_10178740
853 Ga0157369_10181758
854 Ga0157369_10200340
855 Ga0157374_10039998
856 Ga0163162_10005345
857 Ga0163162_10253034
858 Ga0163162_10298903
859 Ga0163162_10755226
860 Ga0157372_10010635
861 Ga0157372_10056102
862 Ga0157375_10074544
863 Ga0157375_10784867
864 Ga0163163_10002844
865 Ga0163163_10007533
866 Ga0163163_10178782
867 Ga0163163_10257480
868 Ga0163163_10260348
869 Ga0163163_10482268
870 Ga0157380_10540447
871 Ga0157380_11394080
872 Ga0157377_10003289
873 Ga0157377_10038236
874 Ga0157377_10388339
875 Ga0157379_10040880
876 Ga0157379_10181742
877 Ga0182007_10000669
878 Ga0206354_11474104
879 Ga0206354_11514635
880 Ga0206353_10019210
881 Ga0206353_11238337
882 Ga0206353_11412544
883 Ga0207426_1001409
884 Ga0207426_1008328
885 Ga0207426_1011006
886 Ga0207656_10068512
887 Ga0207710_10078548
888 Ga0207688_10001800
889 Ga0207688_10002104
890 Ga0207680_10028762
891 Ga0207647_10037746
892 Ga0207699_10414306
893 Ga0207643_10000204
894 Ga0207643_10135488
895 Ga0207705_10005372
896 Ga0207705_10048350
897 Ga0207654_10008897
898 Ga0207707_10011023
899 Ga0207707_10338851
900 Ga0207695_10309131
901 Ga0207693_10092552
902 Ga0207693_10101714
903 Ga0207663_10008959
904 Ga0207660_10008053
905 Ga0207662_10178533
906 Ga0207662_10285770
907 Ga0207657_10009523
908 Ga0207657_10057306
909 Ga0207657_10183580
910 Ga0207657_10555594
911 Ga0207649_10009766
912 Ga0207649_10010945
913 Ga0207649_10109648
914 Ga0207652_10009474
915 Ga0207652_10178509
916 Ga0207652_10388493
917 Ga0207652_10427579
918 Ga0207652_10542619
919 Ga0207646_10126493
920 Ga0207681_10253871
921 Ga0207694_10029050
922 Ga0207694_10222597
923 Ga0207650_10000859
924 Ga0207659_10023225
925 Ga0207659_10225948
926 Ga0207687_10026156
927 Ga0207687_10040796
928 Ga0207687_10252263
929 Ga0207687_10331138
930 Ga0207700_10111470
931 Ga0207664_10276637
932 Ga0207644_10004724
933 Ga0207644_10135285
934 Ga0207690_10090817
935 Ga0207690_10285634
936 Ga0207706_10053763
937 Ga0207706_10161540
938 Ga0207686_10139794
939 Ga0207686_10356219
940 Ga0207709_10093249
941 Ga0207709_10378050
942 Ga0207670_10010858
943 Ga0207704_10012901
944 Ga0207665_10096253
945 Ga0207691_10047895
946 Ga0207691_10279790
947 Ga0207711_10000444
948 Ga0207711_10408556
949 Ga0207689_10000223
950 Ga0207689_10024781
951 Ga0207689_10112825
952 Ga0207661_10001364
953 Ga0207661_10022564
954 Ga0207661_10098042
955 Ga0207661_10315375
956 Ga0207661_10971253
957 Ga0207679_10011410
958 Ga0207679_10145582
959 Ga0207679_10237872
960 Ga0207679_10398424
961 Ga0207651_10701839
962 Ga0207712_10003154
963 Ga0207712_10466811
964 Ga0207668_10488451
965 Ga0207640_10011341
966 Ga0207677_10055446
967 Ga0207677_10218333
968 Ga0207677_10560875
969 Ga0207703_10020493
970 Ga0207703_10025884
971 Ga0207703_10526780
972 Ga0207639_10025701
973 Ga0207678_10000183
974 Ga0207678_10010292
975 Ga0207678_10121349
976 Ga0207678_10474362
977 Ga0207708_10010862
978 Ga0207708_10022607
979 Ga0207702_10003008
980 Ga0207702_10004779
981 Ga0207702_10114398
982 Ga0207702_10131774
983 Ga0207641_10005837
984 Ga0207641_10108153
985 Ga0207641_10164364
986 Ga0207648_10194967
987 Ga0207676_10001332
988 Ga0207676_10103084
989 Ga0207674_10076730
990 Ga0207674_10207274
991 Ga0207674_10229951
992 Ga0207675_101440182
993 Ga0207683_10015673
994 Ga0207683_10117027
995 Ga0207683_10223875
996 Ga0207698_10001923
997 Ga0207698_10012628
998 Ga0207698_10041224
999 Ga0207698_10130391
1000 Ga0207698_11202025
1001 Ga0207428_10015565
1002 Ga0268266_10289008
1003 Ga0268266_10412809
1004 Ga0268265_10000301
1005 Ga0268265_10488421
1006 Ga0268264_10098267
1007 Ga0268264_10134021
1008 Ga0268264_10520301
1009 Ga0265337_1077605
1010 Ga0265319_1000869
1011 Ga0265334_10001482
1012 Ga0265334_10036211
1013 Ga0265318_10018639
1014 Ga0265336_10029582
1015 Ga0265338_10037065
1016 Ga0265330_10021595
1017 Ga0265332_10045393
1018 Ga0265328_10158010
1019 Ga0265329_10026740
1020 Ga0265340_10050812
1021 Ga0265339_10302973
1022 Ga0265327_10020666
1023 Ga0307513_10007380
1024 Ga0307509_10023226
1025 Ga0307408_100090116
1026 Ga0307408_100885508
1027 Ga0265313_10015482
1028 Ga0307508_10042187
1029 Ga0307508_10048314
1030 Ga0307508_10155269
1031 Ga0307514_10201145
1032 Ga0316575_10005198
1033 Ga0316575_10025811
1034 Ga0316579_10032015
1035 Ga0265314_10045807
1036 Ga0316576_10215566
1037 Ga0316578_10016235
1038 Ga0316578_10030820
1039 Ga0307405_10030262
1040 Ga0307405_10047594
1041 Ga0307405_10739583
1042 Ga0316577_10132981
1043 Ga0316577_10237542
1044 Ga0307413_10692907
1045 Ga0307518_10207447
1046 Ga0307406_10185339
1047 Ga0307412_10242949
1048 Ga0307409_100101166
1049 Ga0307409_100111281
1050 Ga0307416_100236267
1051 Ga0307416_100322487
1052 Ga0307416_100518965
1053 Ga0307411_10309197
1054 Ga0307415_100150486
1055 Ga0307415_100181101
1056 Ga0307415_100190738
1057 Ga0307415_100213917
1058 Ga0307415_100397282
1059 Ga0316580_10007003
1060 Ga0316580_10035694
1061 Ga0307510_10228973
1062 Ga0316574_0182145
1063 Ga0373937_0250676
1064 Ga0373937_0361291
1065 Ga0373937_1021292
1066 Ga0316582_0004770
1067 Ga0316584_0000754
1068 Ga0316584_0467398
1069 Ga0395899_0003758
1070 Ga0395900_0014789
1071 Ga0395900_0810037
1072 Ga0395898_0003264
1073 Ga0395905_0003244
1074 Ga0395901_0026146
1075 Ga0395901_0333250
1076 Ga0395901_0926295
1077 Ga0395901_1369440
1078 Ga0439436_0073267
1079 Ga0451795_0975078
1080 Ga0451833_0404134
1081 Ga0451841_0720358
1082 Ga0451845_0268101
1083 Ga0451849_0427955
1084 Ga0451843_0735780
1085 Ga0451853_0250949
1086 Ga0439433_0017434
1087 Ga0439448_0031410
1088 Ga0439448_0056979
1089 Ga0439449_0024808
1090 Ga0439457_029288
1091 Ga0450920_026814
1092 Ga0450906_012081
1093 Ga0439459_0022915
1094 Ga0466969_0004220
1095 Ga0466965_0061780
1096 Ga0466966_0012858
1097 Ga0466961_0004911
1098 Ga0466963_0028916
1099 Ga0466963_0040368
1100 Ga0466963_0044901
1101 Ga0466964_0023676
1102 Ga0466957_0464348
1103 Ga0466960_0001341
1104 Ga0466959_0038332
1105 Ga0451576_0000076
1106 Ga0451576_0002422
1107 Ga0466967_0001742
1108 Ga0466967_0003216
1109 Ga0466967_0052843
1110 Ga0466967_0082835
1111 Ga0466967_0105849
1112 Ga0466967_0218933
1113 Ga0466967_0866265
1114 Ga0495629_0388019
1115 Ga0495638_0208120
1116 Ga0495651_0099318
1117 Ga0495651_0394452
1118 Ga0495653_0078213
1119 Ga0495662_0000420
1120 Ga0495664_0013692
1121 Ga0495585_0119408
1122 Ga0495608_0053898
1123 Ga0495608_0093218
1124 Ga0495630_0029824
1125 Ga0495663_0024980
1126 Ga0495666_0001355
1127 Ga0495652_0171586
1128 Ga0495640_0005802
1129 Ga0495586_0004276
1130 Ga0495587_0060687
1131 Ga0495598_0130893
1132 Ga0495645_0057658
1133 Ga0495667_0047805
1134 Ga0495667_0085279
1135 Ga0495634_0052714
1136 Ga0495635_0150075
1137 Ga0495657_0039074
1138 Ga0495599_0035715
1139 Ga0495646_0012726
1140 Ga0495613_0014583
1141 Ga0495589_0172570
1142 Ga0495600_0027117
1143 Ga0495660_0245095
1144 Ga0495581_0030691
1145 Ga0495604_0007195
1146 Ga0495674_0513275
1147 Ga0495680_0382484
1148 Ga0495675_0008943
1149 Ga0495675_0349557
1150 Ga0495684_0213514
1151 Ga0495593_0010168
1152 Ga0495602_0069718
1153 Ga0496100_0004317
1154 Ga0496100_0032515
1155 Ga0496101_0004638
1156 Ga0496101_0006480
1157 Ga0496102_0001866
1158 Ga0496102_0050328
1159 Ga0496102_0303261
1160 Ga0496103_0252050
1161 Ga0496104_0005242
1162 Ga0496104_0006065
1163 Ga0496104_0498295
1164 Ga0496105_0000691
1165 Ga0496106_0001744
1166 Ga0496106_0009294
1167 Ga0496106_0078480
1168 Ga0496107_0018115
1169 Ga0496107_0532513
1170 Ga0496108_0007397
1171 Ga0496108_0025928
1172 Ga0496108_0026612
1173 Ga0496108_0055951
1174 Ga0496109_0016672
1175 Ga0496109_0079532
1176 Ga0496109_0152973
1177 Ga0496109_0305915
1178 Ga0496109_1123727
1179 Ga0496110_0001017
1180 Ga0496110_0004404
1181 Ga0496110_0066287
1182 Ga0496110_0067958
1183 Ga0496110_0580267
1184 Ga0496110_0639154
1185 Ga0496111_0002974
1186 Ga0496111_0004824
1187 Ga0496111_0042415
1188 Ga0496111_0062208
1189 Ga0496112_0011025
1190 Ga0496112_0613768
1191 Ga0496113_0003329
1192 Ga0496113_0311076
1193 Ga0496114_0007427
1194 Ga0496114_0023808
1195 Ga0496114_0099966
1196 Ga0496114_0364745
1197 Ga0496114_0938823
1198 Ga0496115_0008496
1199 Ga0496115_0521249
1200 Ga0496117_0000196
1201 Ga0496118_0009672
1202 Ga0496118_0052691
1203 Ga0496119_0300450
1204 Ga0496125_0021486
1205 Ga0496125_0198231
1206 Ga0496126_0013614
1207 Ga0501031_0022979
1208 Ga0501031_0031342
1209 Ga0501031_0052825
1210 Ga0501032_0002947
1211 Ga0501033_0012459
1212 Ga0501033_0051321
1213 Ga0501034_0007966
1214 Ga0501034_0017873
1215 Ga0501034_0040119
1216 Ga0501036_0002052
1217 Ga0501036_0006933
1218 Ga0501036_0047742
1219 Ga0501036_0108796
1220 Ga0501037_0011477
1221 Ga0501037_0017390
1222 Ga0501038_0000434
1223 Ga0501038_0003312
1224 Ga0501038_0060954
1225 Ga0501039_0019189
1226 Ga0501039_0037998
1227 Ga0501039_0052374
1228 Ga0501040_0017116
1229 Ga0501040_0122687
1230 Ga0501041_0002785
1231 Ga0501041_0063573
1232 Ga0501042_0010500
1233 Ga0501042_0078817
1234 Ga0501043_0005510
1235 Ga0501043_0007822
1236 Ga0501046_0023435
1237 Ga0501046_0025659
1238 Ga0501047_0001256
1239 Ga0501047_0004783
1240 Ga0501048_0002768
1241 Ga0501048_0018787
1242 Ga0501048_0057645
1243 Ga0501067_0045851
1244 Ga0501068_0014571
1245 Ga0501070_0011622
1246 Ga0501070_0220057
1247 Ga0501071_0000487
1248 Ga0501071_0000789
1249 Ga0501072_0046670
1250 Ga0501072_0078471
1251 Ga0501072_0370988
1252 Ga0501073_0000735
1253 Ga0501073_0022240
1254 Ga0501074_0004579
1255 Ga0501074_0013350
1256 Ga0501075_0002267
1257 Ga0501075_0288541
1258 Ga0501076_0056489
1259 Ga0501076_0108554
1260 Ga0501077_0577915
1261 Ga0501079_0016371
1262 Ga0501079_0076578
1263 Ga0501079_0518962
1264 Ga0501080_0000231
1265 Ga0501080_0110464
1266 Ga0501081_0019752
1267 Ga0501083_0029334
1268 Ga0501083_0029891
1269 Ga0501035_0035789
1270 Ga0501044_0010836
1271 Ga0501044_0056224
1272 Ga0501044_0067600
1273 Ga0501044_0263296
1274 Ga0501045_0013787
1275 nmdc:mga09592_148400_c1
1276 nmdc:mga0qj67_139451_c1
1277 nmdc:mga06r32_251402_c1
1278 nmdc:mga06r32_514780_c1
1279 nmdc:mga06r32_549389_c1
1280 nmdc:mga06r32_718906_c1
1281 nmdc:mga06r32_951170_c1
1282 nmdc:mga08y16_15125_c1
1283 nmdc:mga08y16_275922_c1
1284 nmdc:mga0n895_6028_c1
1285 nmdc:mga0rr50_4916_c1
1286 nmdc:mga08x19_53389_c1
1287 nmdc:mga0a205_6088_c1
1288 Ga0495619_0145008
1289 Ga0500583_0148137
1290 Ga0500560_085999
1291 Ga0500593_178322
1292 Ga0500573_0209636
1293 Ga0500616_0001051
1294 Ga0500620_039967
1295 Ga0501084_0009923
1296 Ga0501084_0063193
1297 Ga0501082_0023286
1298 Ga0501082_0029431
1299 Ga0501082_0492754
1300 Ga0530510_0041720
1301 8002784710
1302 2508670731
1303 2644019276
1304 2644174184
1305 2644445688
1306 2676201239
1307 2689960535
1308 2729906698
1309 2731908637
1310 2774845815
1311 2785374244
1312 2816424708
1313 2819743770
1314 2837272348
1315 2861524329
1316 2868091901
1317 2873321041
1318 2897563848
1319 2946073198
1320 2997453438
1321 3006492119
1322 8002781564
1323 8025485818
1324 8056667095

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

46

158

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

185

241

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9878 158 218
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9877 158 218
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9832 158 218
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.979 158 217
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9767 158 218
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9967 159 212 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9697 158 219 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9682 159 219 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9663 157 212 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9651 157 209 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3L7XDC5-F1-model_v4 Response regulator 0.9671 1 138 GO:0000160
GO:0003677
AF-A0A535F951-F1-model_v4 Response regulator transcription factor 0.9185 1 218 GO:0000160
GO:0003677
GO:0006355
AF-A0A7X8SM34-F1-model_v4 Response regulator transcription factor 0.9156 7 223 GO:0000160
GO:0003677
GO:0006355
AF-A0A3T1AZC1-F1-model_v4 DNA-binding response regulator 0.9046 1 218 GO:0000160
GO:0003677
GO:0006355
AF-A0A366IML7-F1-model_v4 LuxR family two component transcriptional regulator 0.9038 1 219 GO:0000160
GO:0003677
GO:0006355

Map