F473482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 306 | 1324 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10063832|Ga0307515_100638322 |
| Length | 229 |
| Sequence | MSVDESRQSRLRGGPDLVADGRSRSGGQGGQGPFLVVGLGNPGPKYERNRHNVGFMVADLLAERVGGSWKSAARVKAAVAQGRLPLNSGAPGGPGVVLAKPLTFMNLSGGPVSGLARFFKLEVGQVIVVHDELDLPFGTVRLKKGGGEGGHNGLRSMSQSLGSKDYLRVRFGVGRPPGRMDAADYVLRDFSSVERPELPVLLERAADALVDTLVEGLEAAQNRWHVAPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 129 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 137 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 143 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 162 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 250 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 252 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 253 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 254 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 255 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 256 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 257 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 258 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 259 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 260 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 261 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 262 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 263 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 264 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 265 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 266 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 267 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 268 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 269 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 270 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 271 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 272 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 273 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 274 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 275 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 276 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 277 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 278 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 279 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 280 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 281 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 282 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 283 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 284 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 285 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 286 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 287 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 288 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 289 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 290 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 291 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 292 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 293 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 294 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 295 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 296 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 297 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 298 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 299 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 300 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 301 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 302 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 303 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 304 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 305 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 306 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.24 |
| Metatranscriptomes | 0.6 |
| Isolates | 8.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.45 |
| Nodule | 1.06 |
| Rhizoplane | 7.1 |
| Rhizosphere | 85.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307515_10063832 | 3300028794 | Bacteria | 5162 |
| 2 | JGI25406J46586_10004330 | 3300003203 | Bacteria | 6620 |
| 3 | Ga0070658_10010403 | 3300005327 | Bacteria | 7460 |
| 4 | Ga0070658_10125679 | 3300005327 | Bacteria | 2134 |
| 5 | Ga0070658_10444230 | 3300005327 | Bacteria | 1117 |
| 6 | Ga0070683_100000995 | 3300005329 | Bacteria | 21222 |
| 7 | Ga0070683_100938980 | 3300005329 | Bacteria | 830 |
| 8 | Ga0068869_100344625 | 3300005334 | Bacteria | 1213 |
| 9 | Ga0070680_100693264 | 3300005336 | Bacteria | 876 |
| 10 | Ga0070680_100775393 | 3300005336 | Bacteria | 826 |
| 11 | Ga0070680_100892827 | 3300005336 | Bacteria | 767 |
| 12 | Ga0070682_100290446 | 3300005337 | Bacteria | 1196 |
| 13 | Ga0068868_100022901 | 3300005338 | Bacteria | 4722 |
| 14 | Ga0068868_100378859 | 3300005338 | Bacteria | 1217 |
| 15 | Ga0070675_100795541 | 3300005354 | Bacteria | 864 |
| 16 | Ga0070671_100047252 | 3300005355 | Bacteria | 3580 |
| 17 | Ga0070709_10000307 | 3300005434 | Bacteria | 31007 |
| 18 | Ga0070709_10034907 | 3300005434 | Bacteria | 3053 |
| 19 | Ga0070709_10399182 | 3300005434 | Bacteria | 1026 |
| 20 | Ga0070709_10406515 | 3300005434 | Bacteria | 1017 |
| 21 | Ga0070714_100003576 | 3300005435 | Bacteria | 11626 |
| 22 | Ga0070714_100147830 | 3300005435 | Bacteria | 2115 |
| 23 | Ga0070714_100340568 | 3300005435 | Bacteria | 1406 |
| 24 | Ga0070714_100341898 | 3300005435 | Bacteria | 1404 |
| 25 | Ga0070713_100000689 | 3300005436 | Bacteria | 21691 |
| 26 | Ga0070713_100012299 | 3300005436 | Bacteria | 6271 |
| 27 | Ga0070713_100498339 | 3300005436 | Bacteria | 1149 |
| 28 | Ga0070713_100739642 | 3300005436 | Bacteria | 940 |
| 29 | Ga0070713_100739645 | 3300005436 | Bacteria | 940 |
| 30 | Ga0070710_10001337 | 3300005437 | Bacteria | 11626 |
| 31 | Ga0070710_10135459 | 3300005437 | Bacteria | 1505 |
| 32 | Ga0070710_10390324 | 3300005437 | Bacteria | 930 |
| 33 | Ga0070711_100002106 | 3300005439 | Bacteria | 11253 |
| 34 | Ga0070711_100110095 | 3300005439 | Bacteria | 2020 |
| 35 | Ga0070711_100126141 | 3300005439 | Bacteria | 1900 |
| 36 | Ga0070708_100161920 | 3300005445 | Bacteria | 2085 |
| 37 | Ga0070708_100279339 | 3300005445 | Bacteria | 1572 |
| 38 | Ga0070678_100032236 | 3300005456 | Bacteria | 3625 |
| 39 | Ga0070662_100369615 | 3300005457 | Bacteria | 1178 |
| 40 | Ga0070681_10190949 | 3300005458 | Bacteria | 1968 |
| 41 | Ga0070706_100063854 | 3300005467 | Bacteria | 3403 |
| 42 | Ga0070707_100017896 | 3300005468 | Bacteria | 6664 |
| 43 | Ga0070707_100021447 | 3300005468 | Bacteria | 6106 |
| 44 | Ga0070707_100286108 | 3300005468 | Bacteria | 1602 |
| 45 | Ga0070698_100101264 | 3300005471 | Bacteria | 2852 |
| 46 | Ga0070698_100249490 | 3300005471 | Bacteria | 1708 |
| 47 | Ga0070699_100055066 | 3300005518 | Bacteria | 3444 |
| 48 | Ga0070699_100055962 | 3300005518 | Bacteria | 3415 |
| 49 | Ga0070699_100538736 | 3300005518 | Bacteria | 1062 |
| 50 | Ga0070679_100272869 | 3300005530 | Bacteria | 1645 |
| 51 | Ga0070679_101158594 | 3300005530 | Bacteria | 718 |
| 52 | Ga0070684_100007125 | 3300005535 | Bacteria | 8689 |
| 53 | Ga0070684_100075850 | 3300005535 | Bacteria | 2966 |
| 54 | Ga0070684_100381363 | 3300005535 | Bacteria | 1298 |
| 55 | Ga0070697_100111616 | 3300005536 | Bacteria | 2279 |
| 56 | Ga0070697_100169508 | 3300005536 | Bacteria | 1847 |
| 57 | Ga0070697_100227881 | 3300005536 | Bacteria | 1589 |
| 58 | Ga0070695_100310015 | 3300005545 | Bacteria | 1169 |
| 59 | Ga0070695_100324775 | 3300005545 | Bacteria | 1145 |
| 60 | Ga0070696_100348079 | 3300005546 | Bacteria | 1147 |
| 61 | Ga0070665_100090210 | 3300005548 | Bacteria | 3071 |
| 62 | Ga0070665_100486488 | 3300005548 | Bacteria | 1245 |
| 63 | Ga0068855_100362123 | 3300005563 | Bacteria | 1596 |
| 64 | Ga0068855_101182007 | 3300005563 | Bacteria | 796 |
| 65 | Ga0068855_101335072 | 3300005563 | Unclassified | 741 |
| 66 | Ga0070664_100119117 | 3300005564 | Bacteria | 2310 |
| 67 | Ga0070664_100136706 | 3300005564 | Bacteria | 2156 |
| 68 | Ga0070664_100880906 | 3300005564 | Bacteria | 839 |
| 69 | Ga0068857_100192323 | 3300005577 | Bacteria | 1858 |
| 70 | Ga0068857_100294523 | 3300005577 | Bacteria | 1495 |
| 71 | Ga0068857_101064852 | 3300005577 | Bacteria | 780 |
| 72 | Ga0068856_100049011 | 3300005614 | Bacteria | 4163 |
| 73 | Ga0068856_100053234 | 3300005614 | Bacteria | 3991 |
| 74 | Ga0068856_100103528 | 3300005614 | Bacteria | 2840 |
| 75 | Ga0068856_100295894 | 3300005614 | Bacteria | 1636 |
| 76 | Ga0068856_100979806 | 3300005614 | Bacteria | 864 |
| 77 | Ga0068859_101080311 | 3300005617 | Bacteria | 882 |
| 78 | Ga0068864_100005188 | 3300005618 | Bacteria | 10671 |
| 79 | Ga0068864_100030224 | 3300005618 | Bacteria | 4591 |
| 80 | Ga0068864_100049251 | 3300005618 | Bacteria | 3625 |
| 81 | Ga0068863_100028410 | 3300005841 | Bacteria | 5340 |
| 82 | Ga0068863_100070350 | 3300005841 | Bacteria | 3309 |
| 83 | Ga0068863_100284459 | 3300005841 | Bacteria | 1603 |
| 84 | Ga0068863_100749301 | 3300005841 | Bacteria | 972 |
| 85 | Ga0068858_100000162 | 3300005842 | Bacteria | 71107 |
| 86 | Ga0068858_100014629 | 3300005842 | Bacteria | 7390 |
| 87 | Ga0068858_100688672 | 3300005842 | Bacteria | 994 |
| 88 | Ga0068860_100739077 | 3300005843 | Bacteria | 995 |
| 89 | Ga0081455_10151371 | 3300005937 | Bacteria | 1788 |
| 90 | Ga0081540_1001602 | 3300005983 | Bacteria | 19298 |
| 91 | Ga0081539_10000094 | 3300005985 | Bacteria | 206102 |
| 92 | Ga0070717_10001045 | 3300006028 | Bacteria | 18562 |
| 93 | Ga0070717_10202547 | 3300006028 | Bacteria | 1739 |
| 94 | Ga0070717_10487408 | 3300006028 | Bacteria | 1113 |
| 95 | Ga0070717_10666486 | 3300006028 | Bacteria | 945 |
| 96 | Ga0070715_10016655 | 3300006163 | Bacteria | 2767 |
| 97 | Ga0070715_10023955 | 3300006163 | Bacteria | 2398 |
| 98 | Ga0070715_10029962 | 3300006163 | Bacteria | 2195 |
| 99 | Ga0070715_10132352 | 3300006163 | Bacteria | 1202 |
| 100 | Ga0070716_100000228 | 3300006173 | Bacteria | 22532 |
| 101 | Ga0070716_100016649 | 3300006173 | Bacteria | 3799 |
| 102 | Ga0070716_100070981 | 3300006173 | Bacteria | 2046 |
| 103 | Ga0070712_100000806 | 3300006175 | Bacteria | 18623 |
| 104 | Ga0070712_100091120 | 3300006175 | Bacteria | 2233 |
| 105 | Ga0070712_100159961 | 3300006175 | Bacteria | 1738 |
| 106 | Ga0097621_100078852 | 3300006237 | Bacteria | 2737 |
| 107 | Ga0097621_100137047 | 3300006237 | Bacteria | 2088 |
| 108 | Ga0068871_100066456 | 3300006358 | Bacteria | 2956 |
| 109 | Ga0068871_100514888 | 3300006358 | Bacteria | 1080 |
| 110 | Ga0075428_100000146 | 3300006844 | Bacteria | 63972 |
| 111 | Ga0075428_100003404 | 3300006844 | Bacteria | 17397 |
| 112 | Ga0075428_101150534 | 3300006844 | Bacteria | 819 |
| 113 | Ga0075428_101359110 | 3300006844 | Bacteria | 746 |
| 114 | Ga0075430_100022640 | 3300006846 | Bacteria | 5347 |
| 115 | Ga0075430_100073708 | 3300006846 | Bacteria | 2862 |
| 116 | Ga0075430_100230150 | 3300006846 | Bacteria | 1537 |
| 117 | Ga0075430_100296652 | 3300006846 | Bacteria | 1337 |
| 118 | Ga0075431_100041914 | 3300006847 | Bacteria | 4720 |
| 119 | Ga0075431_100667650 | 3300006847 | Bacteria | 1019 |
| 120 | Ga0075433_10064694 | 3300006852 | Bacteria | 3206 |
| 121 | Ga0075433_10248655 | 3300006852 | Bacteria | 1578 |
| 122 | Ga0075434_100157738 | 3300006871 | Bacteria | 2288 |
| 123 | Ga0075434_100502745 | 3300006871 | Bacteria | 1233 |
| 124 | Ga0075429_100079301 | 3300006880 | Bacteria | 2862 |
| 125 | Ga0075429_100277542 | 3300006880 | Bacteria | 1467 |
| 126 | Ga0075429_100405785 | 3300006880 | Bacteria | 1193 |
| 127 | Ga0075436_100024374 | 3300006914 | Bacteria | 4158 |
| 128 | Ga0075436_100152670 | 3300006914 | Bacteria | 1626 |
| 129 | Ga0097620_100318054 | 3300006931 | Bacteria | 1650 |
| 130 | Ga0097620_101080401 | 3300006931 | Bacteria | 882 |
| 131 | Ga0075435_100038617 | 3300007076 | Bacteria | 3807 |
| 132 | Ga0075435_100108921 | 3300007076 | Bacteria | 2302 |
| 133 | Ga0075435_100141630 | 3300007076 | Bacteria | 2018 |
| 134 | Ga0111539_10865099 | 3300009094 | Bacteria | 1052 |
| 135 | Ga0105245_10064096 | 3300009098 | Bacteria | 3321 |
| 136 | Ga0105247_10047754 | 3300009101 | Bacteria | 2629 |
| 137 | Ga0114129_10000001 | 3300009147 | Bacteria | 292978 |
| 138 | Ga0114129_10000011 | 3300009147 | Bacteria | 139000 |
| 139 | Ga0114129_10069528 | 3300009147 | Bacteria | 4908 |
| 140 | Ga0114129_10677570 | 3300009147 | Bacteria | 1328 |
| 141 | Ga0114129_10844865 | 3300009147 | Bacteria | 1164 |
| 142 | Ga0114129_11370159 | 3300009147 | Bacteria | 874 |
| 143 | Ga0105248_10019803 | 3300009177 | Bacteria | 7452 |
| 144 | Ga0105248_10367580 | 3300009177 | Bacteria | 1619 |
| 145 | Ga0105248_10367615 | 3300009177 | Bacteria | 1619 |
| 146 | Ga0105237_10083878 | 3300009545 | Bacteria | 3177 |
| 147 | Ga0105237_10265186 | 3300009545 | Bacteria | 1720 |
| 148 | Ga0105238_10895405 | 3300009551 | Bacteria | 906 |
| 149 | Ga0105249_10326631 | 3300009553 | Bacteria | 1547 |
| 150 | Ga0105033_100674 | 3300009986 | Bacteria | 2640 |
| 151 | Ga0105239_10031831 | 3300010375 | Bacteria | 5796 |
| 152 | Ga0157370_10023102 | 3300013104 | Bacteria | 6181 |
| 153 | Ga0157369_10167790 | 3300013105 | Bacteria | 2314 |
| 154 | Ga0157369_10951416 | 3300013105 | Bacteria | 880 |
| 155 | Ga0157374_10037062 | 3300013296 | Bacteria | 4472 |
| 156 | Ga0157378_10836312 | 3300013297 | Bacteria | 948 |
| 157 | Ga0157372_10623396 | 3300013307 | Bacteria | 1257 |
| 158 | Ga0157375_10006335 | 3300013308 | Bacteria | 10314 |
| 159 | Ga0163163_10002415 | 3300014325 | Bacteria | 15800 |
| 160 | Ga0163163_10248056 | 3300014325 | Bacteria | 1831 |
| 161 | Ga0163163_10928914 | 3300014325 | Bacteria | 933 |
| 162 | Ga0163163_11488953 | 3300014325 | Bacteria | 738 |
| 163 | Ga0157379_10011375 | 3300014968 | Bacteria | 7761 |
| 164 | Ga0157379_10036481 | 3300014968 | Bacteria | 4383 |
| 165 | Ga0157379_10728181 | 3300014968 | Bacteria | 932 |
| 166 | Ga0157376_10044896 | 3300014969 | Bacteria | 3635 |
| 167 | Ga0157376_10371964 | 3300014969 | Bacteria | 1374 |
| 168 | Ga0206356_11868067 | 3300020070 | Bacteria | 2063 |
| 169 | Ga0206354_11545539 | 3300020081 | Bacteria | 1458 |
| 170 | Ga0206353_11068033 | 3300020082 | Bacteria | 4318 |
| 171 | Ga0207692_10000173 | 3300025898 | Bacteria | 20587 |
| 172 | Ga0207692_10005997 | 3300025898 | Bacteria | 4912 |
| 173 | Ga0207692_10030743 | 3300025898 | Bacteria | 2564 |
| 174 | Ga0207685_10000968 | 3300025905 | Bacteria | 5537 |
| 175 | Ga0207685_10009701 | 3300025905 | Bacteria | 2807 |
| 176 | Ga0207685_10013171 | 3300025905 | Bacteria | 2550 |
| 177 | Ga0207699_10000599 | 3300025906 | Bacteria | 17726 |
| 178 | Ga0207699_10006578 | 3300025906 | Bacteria | 5639 |
| 179 | Ga0207699_10027353 | 3300025906 | Bacteria | 3156 |
| 180 | Ga0207699_10097297 | 3300025906 | Bacteria | 1860 |
| 181 | Ga0207699_10150081 | 3300025906 | Bacteria | 1541 |
| 182 | Ga0207684_10355006 | 3300025910 | Bacteria | 1262 |
| 183 | Ga0207671_10152918 | 3300025914 | Bacteria | 1783 |
| 184 | Ga0207693_10026181 | 3300025915 | Bacteria | 4618 |
| 185 | Ga0207693_10133049 | 3300025915 | Bacteria | 1955 |
| 186 | Ga0207663_10001386 | 3300025916 | Bacteria | 11248 |
| 187 | Ga0207663_10019456 | 3300025916 | Bacteria | 3825 |
| 188 | Ga0207663_10085721 | 3300025916 | Bacteria | 2075 |
| 189 | Ga0207660_10640578 | 3300025917 | Bacteria | 866 |
| 190 | Ga0207657_10142011 | 3300025919 | Bacteria | 1961 |
| 191 | Ga0207649_10259544 | 3300025920 | Bacteria | 1255 |
| 192 | Ga0207646_10053036 | 3300025922 | Bacteria | 3628 |
| 193 | Ga0207646_10144124 | 3300025922 | Bacteria | 2146 |
| 194 | Ga0207646_10447323 | 3300025922 | Bacteria | 1166 |
| 195 | Ga0207694_10203125 | 3300025924 | Bacteria | 1613 |
| 196 | Ga0207687_10037126 | 3300025927 | Bacteria | 3322 |
| 197 | Ga0207700_10000291 | 3300025928 | Bacteria | 29714 |
| 198 | Ga0207700_10038685 | 3300025928 | Bacteria | 3464 |
| 199 | Ga0207700_10086925 | 3300025928 | Bacteria | 2458 |
| 200 | Ga0207700_10119189 | 3300025928 | Bacteria | 2137 |
| 201 | Ga0207700_10163164 | 3300025928 | Bacteria | 1852 |
| 202 | Ga0207700_10165112 | 3300025928 | Bacteria | 1842 |
| 203 | Ga0207700_10192123 | 3300025928 | Bacteria | 1716 |
| 204 | Ga0207664_10000163 | 3300025929 | Bacteria | 53290 |
| 205 | Ga0207664_10010303 | 3300025929 | Bacteria | 6603 |
| 206 | Ga0207664_10063822 | 3300025929 | Bacteria | 2945 |
| 207 | Ga0207664_10084764 | 3300025929 | Bacteria | 2585 |
| 208 | Ga0207664_10087355 | 3300025929 | Bacteria | 2549 |
| 209 | Ga0207664_10369890 | 3300025929 | Bacteria | 1271 |
| 210 | Ga0207644_10050719 | 3300025931 | Bacteria | 2976 |
| 211 | Ga0207706_10211734 | 3300025933 | Bacteria | 1699 |
| 212 | Ga0207665_10002219 | 3300025939 | Bacteria | 13097 |
| 213 | Ga0207665_10018028 | 3300025939 | Bacteria | 4638 |
| 214 | Ga0207665_10111789 | 3300025939 | Bacteria | 1920 |
| 215 | Ga0207711_10072171 | 3300025941 | Bacteria | 2998 |
| 216 | Ga0207711_10967615 | 3300025941 | Bacteria | 790 |
| 217 | Ga0207689_10358383 | 3300025942 | Bacteria | 1213 |
| 218 | Ga0207661_10003454 | 3300025944 | Bacteria | 10968 |
| 219 | Ga0207661_10454469 | 3300025944 | Bacteria | 1167 |
| 220 | Ga0207667_10680923 | 3300025949 | Unclassified | 1032 |
| 221 | Ga0207651_10700773 | 3300025960 | Bacteria | 892 |
| 222 | Ga0207677_10025587 | 3300026023 | Bacteria | 3684 |
| 223 | Ga0207677_10527316 | 3300026023 | Bacteria | 1025 |
| 224 | Ga0207703_10030538 | 3300026035 | Bacteria | 4260 |
| 225 | Ga0207639_11324188 | 3300026041 | Bacteria | 676 |
| 226 | Ga0207641_10036856 | 3300026088 | Bacteria | 4082 |
| 227 | Ga0207641_10056043 | 3300026088 | Bacteria | 3348 |
| 228 | Ga0207641_10307646 | 3300026088 | Bacteria | 1499 |
| 229 | Ga0207676_10037717 | 3300026095 | Bacteria | 3685 |
| 230 | Ga0207676_10076788 | 3300026095 | Bacteria | 2700 |
| 231 | Ga0207676_10817101 | 3300026095 | Bacteria | 910 |
| 232 | Ga0207674_10175407 | 3300026116 | Bacteria | 2096 |
| 233 | Ga0207674_10181870 | 3300026116 | Bacteria | 2054 |
| 234 | Ga0207674_10267481 | 3300026116 | Bacteria | 1657 |
| 235 | Ga0207675_100250311 | 3300026118 | Bacteria | 1715 |
| 236 | Ga0207683_10507306 | 3300026121 | Bacteria | 1114 |
| 237 | Ga0268266_10210875 | 3300028379 | Bacteria | 1781 |
| 238 | Ga0268266_10539001 | 3300028379 | Bacteria | 1117 |
| 239 | Ga0268266_10592755 | 3300028379 | Bacteria | 1064 |
| 240 | Ga0307515_10512297 | 3300028794 | Bacteria | 810 |
| 241 | Ga0307511_10001096 | 3300030521 | Bacteria | 28800 |
| 242 | Ga0265328_10023968 | 3300031239 | Bacteria | 2309 |
| 243 | Ga0307513_10017027 | 3300031456 | Bacteria | 8733 |
| 244 | Ga0307509_10654066 | 3300031507 | Bacteria | 720 |
| 245 | Ga0307408_100217280 | 3300031548 | Bacteria | 1558 |
| 246 | Ga0307408_100918478 | 3300031548 | Bacteria | 802 |
| 247 | Ga0307408_100922168 | 3300031548 | Bacteria | 801 |
| 248 | Ga0307508_10385657 | 3300031616 | Bacteria | 992 |
| 249 | Ga0307405_10009164 | 3300031731 | Bacteria | 5063 |
| 250 | Ga0307413_10011456 | 3300031824 | Bacteria | 4363 |
| 251 | Ga0307413_10129253 | 3300031824 | Bacteria | 1726 |
| 252 | Ga0307410_10041833 | 3300031852 | Bacteria | 3024 |
| 253 | Ga0307410_10182011 | 3300031852 | Bacteria | 1591 |
| 254 | Ga0307406_10009812 | 3300031901 | Bacteria | 5388 |
| 255 | Ga0307407_10071498 | 3300031903 | Bacteria | 2066 |
| 256 | Ga0307409_100000720 | 3300031995 | Bacteria | 14794 |
| 257 | Ga0307409_100067501 | 3300031995 | Bacteria | 2824 |
| 258 | Ga0307409_100088890 | 3300031995 | Bacteria | 2523 |
| 259 | Ga0307409_100731528 | 3300031995 | Bacteria | 992 |
| 260 | Ga0307416_100005756 | 3300032002 | Bacteria | 7675 |
| 261 | Ga0307416_100085652 | 3300032002 | Bacteria | 2683 |
| 262 | Ga0307416_100156989 | 3300032002 | Bacteria | 2096 |
| 263 | Ga0307416_100302322 | 3300032002 | Bacteria | 1591 |
| 264 | Ga0307416_101867449 | 3300032002 | Bacteria | 704 |
| 265 | Ga0307414_10085290 | 3300032004 | Bacteria | 2326 |
| 266 | Ga0307414_10356979 | 3300032004 | Bacteria | 1256 |
| 267 | Ga0307411_10173204 | 3300032005 | Bacteria | 1630 |
| 268 | Ga0307411_10698762 | 3300032005 | Bacteria | 883 |
| 269 | Ga0307415_100000028 | 3300032126 | Bacteria | 60969 |
| 270 | Ga0307415_100006943 | 3300032126 | Bacteria | 6151 |
| 271 | Ga0307415_100015934 | 3300032126 | Bacteria | 4464 |
| 272 | Ga0307415_100032012 | 3300032126 | Bacteria | 3396 |
| 273 | Ga0307415_100100304 | 3300032126 | Bacteria | 2121 |
| 274 | Ga0307415_100131981 | 3300032126 | Bacteria | 1893 |
| 275 | Ga0307415_100258175 | 3300032126 | Bacteria | 1420 |
| 276 | Ga0307415_101181367 | 3300032126 | Bacteria | 720 |
| 277 | Ga0373950_0010781 | 3300034818 | Bacteria | 1483 |
| 278 | Ga0373926_0148335 | 3300035083 | Bacteria | 892 |
| 279 | Ga0373934_0000431 | 3300035086 | Bacteria | 14649 |
| 280 | Ga0373940_0016429 | 3300035088 | Bacteria | 1833 |
| 281 | Ga0373944_0021653 | 3300035089 | Bacteria | 1863 |
| 282 | Ga0373949_0013637 | 3300035090 | Bacteria | 1804 |
| 283 | Ga0373923_0003717 | 3300035111 | Bacteria | 4942 |
| 284 | Ga0373923_0021724 | 3300035111 | Bacteria | 2509 |
| 285 | Ga0373923_0386227 | 3300035111 | Bacteria | 672 |
| 286 | Ga0373932_0029481 | 3300035112 | Bacteria | 1515 |
| 287 | Ga0373936_0135319 | 3300035113 | Bacteria | 1061 |
| 288 | Ga0373939_0228886 | 3300035114 | Bacteria | 715 |
| 289 | Ga0373941_0232994 | 3300035115 | Bacteria | 712 |
| 290 | Ga0373945_0078614 | 3300035116 | Bacteria | 1260 |
| 291 | Ga0373953_0000076 | 3300035117 | Bacteria | 23953 |
| 292 | Ga0373953_0021104 | 3300035117 | Bacteria | 2440 |
| 293 | Ga0373954_0000183 | 3300035118 | Bacteria | 22612 |
| 294 | Ga0373956_0003835 | 3300035119 | Bacteria | 6052 |
| 295 | Ga0373956_0011807 | 3300035119 | Bacteria | 3606 |
| 296 | Ga0373956_0050282 | 3300035119 | Bacteria | 1871 |
| 297 | Ga0373957_0000477 | 3300035120 | Bacteria | 10125 |
| 298 | Ga0373957_0056173 | 3300035120 | Bacteria | 1515 |
| 299 | Ga0373957_0139735 | 3300035120 | Bacteria | 989 |
| 300 | Ga0373960_0019786 | 3300035121 | Bacteria | 1772 |
| 301 | Ga0373943_0075120 | 3300035170 | Bacteria | 1720 |
| 302 | Ga0373943_0149475 | 3300035170 | Bacteria | 1264 |
| 303 | Ga0373943_0201573 | 3300035170 | Bacteria | 1101 |
| 304 | Ga0373946_0046295 | 3300035171 | Bacteria | 1802 |
| 305 | Ga0373946_0294954 | 3300035171 | Bacteria | 800 |
| 306 | Ga0373955_0000126 | 3300035172 | Bacteria | 30266 |
| 307 | Ga0373955_0003574 | 3300035172 | Bacteria | 6842 |
| 308 | Ga0373955_0110120 | 3300035172 | Bacteria | 1591 |
| 309 | Ga0373955_0181073 | 3300035172 | Bacteria | 1250 |
| 310 | Ga0373955_0210763 | 3300035172 | Bacteria | 1158 |
| 311 | Ga0373961_0012709 | 3300035241 | Bacteria | 2112 |
| 312 | Ga0373924_0000152 | 3300035410 | Bacteria | 20298 |
| 313 | Ga0373924_0082434 | 3300035410 | Bacteria | 1369 |
| 314 | Ga0373931_0032301 | 3300035691 | Bacteria | 2708 |
| 315 | Ga0373931_0234236 | 3300035691 | Bacteria | 1111 |
| 316 | Ga0373935_0228997 | 3300035692 | Bacteria | 1293 |
| 317 | Ga0373927_0099969 | 3300035695 | Bacteria | 1886 |
| 318 | Ga0373927_0274277 | 3300035695 | Bacteria | 1109 |
| 319 | Ga0373927_0275342 | 3300035695 | Bacteria | 1107 |
| 320 | Ga0373927_0285678 | 3300035695 | Bacteria | 1085 |
| 321 | Ga0373927_0403146 | 3300035695 | Bacteria | 902 |
| 322 | Ga0373933_0000098 | 3300035724 | Bacteria | 54263 |
| 323 | Ga0373933_0017258 | 3300035724 | Bacteria | 4048 |
| 324 | Ga0373933_0038002 | 3300035724 | Bacteria | 2827 |
| 325 | Ga0373933_0039245 | 3300035724 | Bacteria | 2785 |
| 326 | Ga0373933_0243575 | 3300035724 | Bacteria | 1157 |
| 327 | Ga0373947_0055002 | 3300035725 | Bacteria | 2403 |
| 328 | Ga0373947_0086216 | 3300035725 | Bacteria | 1951 |
| 329 | Ga0373947_0265571 | 3300035725 | Bacteria | 1138 |
| 330 | Ga0373947_0268996 | 3300035725 | Bacteria | 1131 |
| 331 | Ga0373947_0349916 | 3300035725 | Bacteria | 991 |
| 332 | Ga0373937_0000067 | 3300036401 | Bacteria | 94291 |
| 333 | Ga0373937_0002213 | 3300036401 | Bacteria | 16253 |
| 334 | Ga0373937_0127654 | 3300036401 | Bacteria | 2373 |
| 335 | Ga0373937_0245184 | 3300036401 | Bacteria | 1688 |
| 336 | Ga0373937_0364114 | 3300036401 | Bacteria | 1370 |
| 337 | Ga0373925_0002689 | 3300037068 | Bacteria | 14105 |
| 338 | Ga0373925_0124747 | 3300037068 | Bacteria | 2002 |
| 339 | Ga0373925_0144563 | 3300037068 | Bacteria | 1863 |
| 340 | Ga0373925_0341704 | 3300037068 | Bacteria | 1214 |
| 341 | Ga0373925_0537910 | 3300037068 | Bacteria | 960 |
| 342 | Ga0395899_0127904 | 3300037312 | Bacteria | 1816 |
| 343 | Ga0395900_0189737 | 3300037418 | Bacteria | 2085 |
| 344 | Ga0395905_0120387 | 3300037471 | Bacteria | 2467 |
| 345 | Ga0395901_0084120 | 3300038443 | Bacteria | 3325 |
| 346 | Ga0466966_0043985 | 3300044684 | Bacteria | 2860 |
| 347 | Ga0466966_0048800 | 3300044684 | Bacteria | 2697 |
| 348 | Ga0466963_0041640 | 3300044694 | Bacteria | 3013 |
| 349 | Ga0466963_0160891 | 3300044694 | Bacteria | 1562 |
| 350 | Ga0466963_0268111 | 3300044694 | Bacteria | 1199 |
| 351 | Ga0466963_0620195 | 3300044694 | Bacteria | 764 |
| 352 | Ga0466971_0055441 | 3300044719 | Bacteria | 1787 |
| 353 | Ga0466971_0169308 | 3300044719 | Bacteria | 1025 |
| 354 | Ga0466971_0174757 | 3300044719 | Bacteria | 1009 |
| 355 | Ga0466970_0046538 | 3300044765 | Bacteria | 2311 |
| 356 | Ga0466957_0046982 | 3300044842 | Bacteria | 2622 |
| 357 | Ga0466957_0269576 | 3300044842 | Bacteria | 1136 |
| 358 | Ga0466960_0002582 | 3300044901 | Bacteria | 6810 |
| 359 | Ga0466960_0030268 | 3300044901 | Bacteria | 2490 |
| 360 | Ga0466960_0076368 | 3300044901 | Bacteria | 1678 |
| 361 | Ga0466959_0073935 | 3300045049 | Bacteria | 2465 |
| 362 | Ga0466959_0077572 | 3300045049 | Bacteria | 2397 |
| 363 | Ga0466959_0654047 | 3300045049 | Bacteria | 705 |
| 364 | Ga0466958_0059860 | 3300045836 | Bacteria | 2318 |
| 365 | Ga0466958_0173126 | 3300045836 | Bacteria | 1367 |
| 366 | Ga0466967_0036423 | 3300045976 | Bacteria | 4200 |
| 367 | Ga0466967_0098380 | 3300045976 | Bacteria | 2671 |
| 368 | Ga0466967_0169865 | 3300045976 | Bacteria | 2051 |
| 369 | Ga0466967_0182203 | 3300045976 | Bacteria | 1982 |
| 370 | Ga0495592_0000069 | 3300046454 | Bacteria | 94288 |
| 371 | Ga0495592_0038355 | 3300046454 | Bacteria | 3605 |
| 372 | Ga0495592_0121146 | 3300046454 | Bacteria | 1840 |
| 373 | Ga0495592_0134042 | 3300046454 | Bacteria | 1729 |
| 374 | Ga0495592_0249686 | 3300046454 | Bacteria | 1173 |
| 375 | Ga0495603_0166170 | 3300046455 | Bacteria | 1279 |
| 376 | Ga0495629_0027992 | 3300046459 | Bacteria | 4002 |
| 377 | Ga0495629_0029747 | 3300046459 | Bacteria | 3872 |
| 378 | Ga0495629_0048759 | 3300046459 | Bacteria | 2969 |
| 379 | Ga0495641_0021999 | 3300046461 | Bacteria | 3198 |
| 380 | Ga0495651_0000016 | 3300046462 | Bacteria | 125612 |
| 381 | Ga0495651_0015500 | 3300046462 | Bacteria | 5896 |
| 382 | Ga0495651_0016791 | 3300046462 | Bacteria | 5669 |
| 383 | Ga0495651_0031123 | 3300046462 | Bacteria | 4161 |
| 384 | Ga0495651_0074885 | 3300046462 | Bacteria | 2567 |
| 385 | Ga0495653_0000770 | 3300046463 | Bacteria | 24601 |
| 386 | Ga0495653_0006893 | 3300046463 | Bacteria | 9340 |
| 387 | Ga0495653_0031473 | 3300046463 | Bacteria | 4217 |
| 388 | Ga0495653_0042511 | 3300046463 | Bacteria | 3539 |
| 389 | Ga0495653_0050683 | 3300046463 | Bacteria | 3191 |
| 390 | Ga0495653_0142410 | 3300046463 | Bacteria | 1684 |
| 391 | Ga0495580_0184033 | 3300046472 | Bacteria | 1442 |
| 392 | Ga0495582_0035278 | 3300046473 | Bacteria | 2750 |
| 393 | Ga0495582_0158941 | 3300046473 | Bacteria | 1285 |
| 394 | Ga0495639_0060985 | 3300046475 | Bacteria | 1729 |
| 395 | Ga0495639_0134458 | 3300046475 | Bacteria | 1186 |
| 396 | Ga0495639_0203311 | 3300046475 | Bacteria | 970 |
| 397 | Ga0495662_0147747 | 3300046476 | Bacteria | 1157 |
| 398 | Ga0495664_0234079 | 3300046477 | Bacteria | 1111 |
| 399 | Ga0495594_0086486 | 3300046499 | Bacteria | 1754 |
| 400 | Ga0495594_0120813 | 3300046499 | Bacteria | 1481 |
| 401 | Ga0495606_0002664 | 3300046507 | Bacteria | 20310 |
| 402 | Ga0495608_0000051 | 3300046511 | Bacteria | 94719 |
| 403 | Ga0495608_0022256 | 3300046511 | Bacteria | 4344 |
| 404 | Ga0495608_0049279 | 3300046511 | Bacteria | 2796 |
| 405 | Ga0495608_0059769 | 3300046511 | Bacteria | 2510 |
| 406 | Ga0495608_0134080 | 3300046511 | Bacteria | 1583 |
| 407 | Ga0495618_0051598 | 3300046514 | Bacteria | 2599 |
| 408 | Ga0495618_0117936 | 3300046514 | Bacteria | 1699 |
| 409 | Ga0495618_0176037 | 3300046514 | Bacteria | 1360 |
| 410 | Ga0495618_0189784 | 3300046514 | Bacteria | 1303 |
| 411 | Ga0495628_0000126 | 3300046516 | Bacteria | 63839 |
| 412 | Ga0495628_0042496 | 3300046516 | Bacteria | 3625 |
| 413 | Ga0495628_0087031 | 3300046516 | Bacteria | 2422 |
| 414 | Ga0495628_0205867 | 3300046516 | Bacteria | 1481 |
| 415 | Ga0495628_0233451 | 3300046516 | Bacteria | 1378 |
| 416 | Ga0495630_0146117 | 3300046517 | Bacteria | 1798 |
| 417 | Ga0495630_0176091 | 3300046517 | Bacteria | 1630 |
| 418 | Ga0495630_0229677 | 3300046517 | Bacteria | 1417 |
| 419 | Ga0495630_0949271 | 3300046517 | Bacteria | 654 |
| 420 | Ga0495666_0023838 | 3300046526 | Bacteria | 3026 |
| 421 | Ga0495652_0000761 | 3300046529 | Bacteria | 37066 |
| 422 | Ga0495652_0011175 | 3300046529 | Bacteria | 8132 |
| 423 | Ga0495652_0034221 | 3300046529 | Bacteria | 4429 |
| 424 | Ga0495652_0061916 | 3300046529 | Bacteria | 3157 |
| 425 | Ga0495652_0097293 | 3300046529 | Bacteria | 2394 |
| 426 | Ga0495652_0126532 | 3300046529 | Bacteria | 2029 |
| 427 | Ga0495665_0006251 | 3300046531 | Bacteria | 6424 |
| 428 | Ga0495640_0027840 | 3300046533 | Bacteria | 4072 |
| 429 | Ga0495640_0046622 | 3300046533 | Bacteria | 3002 |
| 430 | Ga0495640_0071142 | 3300046533 | Bacteria | 2334 |
| 431 | Ga0495640_0155722 | 3300046533 | Bacteria | 1466 |
| 432 | Ga0495587_0000058 | 3300046536 | Bacteria | 94307 |
| 433 | Ga0495587_0008337 | 3300046536 | Bacteria | 6671 |
| 434 | Ga0495587_0008404 | 3300046536 | Bacteria | 6640 |
| 435 | Ga0495587_0136246 | 3300046536 | Bacteria | 1402 |
| 436 | Ga0495645_0114901 | 3300046543 | Bacteria | 1901 |
| 437 | Ga0495645_0262233 | 3300046543 | Bacteria | 1143 |
| 438 | Ga0495645_0275938 | 3300046543 | Bacteria | 1107 |
| 439 | Ga0495667_0000062 | 3300046559 | Bacteria | 94307 |
| 440 | Ga0495667_0007401 | 3300046559 | Bacteria | 7444 |
| 441 | Ga0495667_0031698 | 3300046559 | Bacteria | 3545 |
| 442 | Ga0495667_0075543 | 3300046559 | Bacteria | 2192 |
| 443 | Ga0495667_0161462 | 3300046559 | Bacteria | 1441 |
| 444 | Ga0495667_0194738 | 3300046559 | Bacteria | 1298 |
| 445 | Ga0495656_0000003 | 3300046615 | Bacteria | 338227 |
| 446 | Ga0495668_0000169 | 3300046616 | Bacteria | 97150 |
| 447 | Ga0495634_0110389 | 3300046642 | Bacteria | 1769 |
| 448 | Ga0495625_0002610 | 3300046660 | Bacteria | 19286 |
| 449 | Ga0495635_0007102 | 3300046663 | Bacteria | 7830 |
| 450 | Ga0495635_0034060 | 3300046663 | Bacteria | 3533 |
| 451 | Ga0495635_0148785 | 3300046663 | Bacteria | 1594 |
| 452 | Ga0495635_0204717 | 3300046663 | Bacteria | 1338 |
| 453 | Ga0495635_0249950 | 3300046663 | Bacteria | 1195 |
| 454 | Ga0495635_0737650 | 3300046663 | Bacteria | 637 |
| 455 | Ga0495657_0000065 | 3300046675 | Bacteria | 94307 |
| 456 | Ga0495657_0016187 | 3300046675 | Bacteria | 5438 |
| 457 | Ga0495657_0031558 | 3300046675 | Bacteria | 3702 |
| 458 | Ga0495657_0055641 | 3300046675 | Bacteria | 2638 |
| 459 | Ga0495657_0085761 | 3300046675 | Bacteria | 2029 |
| 460 | Ga0495599_0000045 | 3300046678 | Bacteria | 86086 |
| 461 | Ga0495599_0019207 | 3300046678 | Bacteria | 4262 |
| 462 | Ga0495599_0063783 | 3300046678 | Bacteria | 2302 |
| 463 | Ga0495599_0073153 | 3300046678 | Bacteria | 2139 |
| 464 | Ga0495599_0177740 | 3300046678 | Bacteria | 1312 |
| 465 | Ga0495599_0238766 | 3300046678 | Bacteria | 1108 |
| 466 | Ga0495599_0239379 | 3300046678 | Bacteria | 1107 |
| 467 | Ga0495599_0304698 | 3300046678 | Bacteria | 961 |
| 468 | Ga0495623_0000787 | 3300046679 | Bacteria | 21284 |
| 469 | Ga0495623_0065263 | 3300046679 | Bacteria | 2277 |
| 470 | Ga0495623_0199742 | 3300046679 | Bacteria | 1150 |
| 471 | Ga0495623_0215720 | 3300046679 | Bacteria | 1096 |
| 472 | Ga0495646_0001648 | 3300046680 | Bacteria | 13328 |
| 473 | Ga0495646_0015988 | 3300046680 | Bacteria | 4762 |
| 474 | Ga0495646_0108257 | 3300046680 | Bacteria | 1585 |
| 475 | Ga0495647_0059685 | 3300046681 | Bacteria | 1502 |
| 476 | Ga0495658_0022001 | 3300046683 | Bacteria | 3367 |
| 477 | Ga0495613_0058274 | 3300046689 | Bacteria | 2835 |
| 478 | Ga0495624_0026084 | 3300046690 | Bacteria | 3832 |
| 479 | Ga0495600_0000392 | 3300046809 | Bacteria | 22642 |
| 480 | Ga0495600_0000536 | 3300046809 | Bacteria | 19669 |
| 481 | Ga0495600_0009392 | 3300046809 | Bacteria | 6041 |
| 482 | Ga0495600_0021271 | 3300046809 | Bacteria | 4152 |
| 483 | Ga0495600_0200277 | 3300046809 | Bacteria | 1282 |
| 484 | Ga0495581_0044328 | 3300047315 | Bacteria | 2572 |
| 485 | Ga0495581_0094758 | 3300047315 | Bacteria | 1733 |
| 486 | Ga0495581_0136741 | 3300047315 | Bacteria | 1428 |
| 487 | Ga0495604_0001132 | 3300047317 | Bacteria | 22122 |
| 488 | Ga0495604_0011978 | 3300047317 | Bacteria | 6894 |
| 489 | Ga0495604_0042273 | 3300047317 | Bacteria | 3572 |
| 490 | Ga0495604_0080949 | 3300047317 | Bacteria | 2432 |
| 491 | Ga0495674_0003461 | 3300047319 | Bacteria | 15333 |
| 492 | Ga0495674_0020554 | 3300047319 | Bacteria | 6110 |
| 493 | Ga0495674_0479761 | 3300047319 | Bacteria | 996 |
| 494 | Ga0495676_0089261 | 3300047321 | Bacteria | 2310 |
| 495 | Ga0495676_0128071 | 3300047321 | Bacteria | 1837 |
| 496 | Ga0495676_0323017 | 3300047321 | Bacteria | 1036 |
| 497 | Ga0495680_0000444 | 3300047322 | Bacteria | 46401 |
| 498 | Ga0495680_0009939 | 3300047322 | Bacteria | 8519 |
| 499 | Ga0495680_0014777 | 3300047322 | Bacteria | 6748 |
| 500 | Ga0495680_0044853 | 3300047322 | Bacteria | 3493 |
| 501 | Ga0495680_0089235 | 3300047322 | Bacteria | 2314 |
| 502 | Ga0495680_0388956 | 3300047322 | Bacteria | 965 |
| 503 | Ga0495675_0000655 | 3300047444 | Bacteria | 21934 |
| 504 | Ga0495675_0027125 | 3300047444 | Bacteria | 3650 |
| 505 | Ga0495675_0263647 | 3300047444 | Bacteria | 1031 |
| 506 | Ga0495684_0016089 | 3300047471 | Bacteria | 5758 |
| 507 | Ga0495684_0126830 | 3300047471 | Bacteria | 1919 |
| 508 | Ga0495684_0173978 | 3300047471 | Bacteria | 1599 |
| 509 | Ga0495684_0183504 | 3300047471 | Bacteria | 1550 |
| 510 | Ga0495593_0033130 | 3300047673 | Bacteria | 2815 |
| 511 | Ga0495593_0052646 | 3300047673 | Bacteria | 2151 |
| 512 | Ga0495593_0092971 | 3300047673 | Bacteria | 1552 |
| 513 | Ga0495602_0000079 | 3300048088 | Bacteria | 94307 |
| 514 | Ga0495602_0015074 | 3300048088 | Bacteria | 7817 |
| 515 | Ga0495602_0031285 | 3300048088 | Bacteria | 5034 |
| 516 | Ga0495602_0067906 | 3300048088 | Bacteria | 3064 |
| 517 | Ga0495602_0420883 | 3300048088 | Bacteria | 949 |
| 518 | Ga0495614_0095281 | 3300048089 | Bacteria | 1297 |
| 519 | Ga0495626_0001289 | 3300048091 | Bacteria | 20450 |
| 520 | Ga0496100_0086861 | 3300048903 | Bacteria | 2125 |
| 521 | Ga0496100_0174476 | 3300048903 | Bacteria | 1551 |
| 522 | Ga0496100_0718489 | 3300048903 | Bacteria | 780 |
| 523 | Ga0496101_0033113 | 3300048904 | Bacteria | 3643 |
| 524 | Ga0496101_0051792 | 3300048904 | Bacteria | 2959 |
| 525 | Ga0496101_0091658 | 3300048904 | Bacteria | 2262 |
| 526 | Ga0496102_0281312 | 3300048905 | Bacteria | 1568 |
| 527 | Ga0496102_0317841 | 3300048905 | Bacteria | 1467 |
| 528 | Ga0496104_0004947 | 3300048907 | Bacteria | 11626 |
| 529 | Ga0496104_0033822 | 3300048907 | Bacteria | 4764 |
| 530 | Ga0496104_0172964 | 3300048907 | Bacteria | 2070 |
| 531 | Ga0496104_1121969 | 3300048907 | Bacteria | 690 |
| 532 | Ga0496105_0003955 | 3300048908 | Bacteria | 11087 |
| 533 | Ga0496105_0046017 | 3300048908 | Bacteria | 3601 |
| 534 | Ga0496105_0051325 | 3300048908 | Bacteria | 3407 |
| 535 | Ga0496105_0137255 | 3300048908 | Bacteria | 2014 |
| 536 | Ga0496105_0617763 | 3300048908 | Bacteria | 840 |
| 537 | Ga0496106_0150699 | 3300048909 | Bacteria | 1834 |
| 538 | Ga0496107_0067578 | 3300048910 | Bacteria | 2593 |
| 539 | Ga0496107_0283388 | 3300048910 | Bacteria | 1233 |
| 540 | Ga0496107_0398277 | 3300048910 | Bacteria | 1024 |
| 541 | Ga0496108_0018925 | 3300048911 | Bacteria | 5647 |
| 542 | Ga0496108_0081860 | 3300048911 | Bacteria | 2736 |
| 543 | Ga0496108_0103055 | 3300048911 | Bacteria | 2435 |
| 544 | Ga0496108_0156604 | 3300048911 | Bacteria | 1967 |
| 545 | Ga0496109_0021476 | 3300048912 | Bacteria | 5709 |
| 546 | Ga0496109_0023161 | 3300048912 | Bacteria | 5509 |
| 547 | Ga0496109_0023373 | 3300048912 | Bacteria | 5487 |
| 548 | Ga0496109_0324190 | 3300048912 | Bacteria | 1454 |
| 549 | Ga0496110_0006369 | 3300048913 | Bacteria | 9333 |
| 550 | Ga0496110_0012238 | 3300048913 | Bacteria | 7050 |
| 551 | Ga0496111_0004057 | 3300048914 | Bacteria | 9198 |
| 552 | Ga0496111_0046094 | 3300048914 | Bacteria | 3138 |
| 553 | Ga0496111_0381225 | 3300048914 | Bacteria | 1043 |
| 554 | Ga0496112_0016556 | 3300048915 | Bacteria | 6911 |
| 555 | Ga0496112_0033642 | 3300048915 | Bacteria | 4984 |
| 556 | Ga0496112_0073675 | 3300048915 | Bacteria | 3375 |
| 557 | Ga0496112_0147889 | 3300048915 | Bacteria | 2317 |
| 558 | Ga0496112_1266003 | 3300048915 | Bacteria | 653 |
| 559 | Ga0496113_0004227 | 3300048916 | Bacteria | 8785 |
| 560 | Ga0496113_0023091 | 3300048916 | Bacteria | 4408 |
| 561 | Ga0496113_0141905 | 3300048916 | Bacteria | 1890 |
| 562 | Ga0496113_0240606 | 3300048916 | Bacteria | 1444 |
| 563 | Ga0496113_0406359 | 3300048916 | Bacteria | 1093 |
| 564 | Ga0496114_0630977 | 3300048917 | Bacteria | 944 |
| 565 | Ga0496115_0013595 | 3300048918 | Bacteria | 6158 |
| 566 | Ga0496115_0835469 | 3300048918 | Bacteria | 714 |
| 567 | Ga0496124_0069956 | 3300048927 | Bacteria | 2912 |
| 568 | Ga0501321_038048 | 3300049537 | Bacteria | 667 |
| 569 | Ga0501034_0218083 | 3300049571 | Bacteria | 1861 |
| 570 | Ga0501034_0800466 | 3300049571 | Bacteria | 835 |
| 571 | Ga0501047_0073015 | 3300049581 | Bacteria | 3303 |
| 572 | nmdc:mga05p37_1057_c1 | 3300050507 | Bacteria | 31447 |
| 573 | nmdc:mga05p37_1964_c1 | 3300050507 | Bacteria | 23980 |
| 574 | nmdc:mga05p37_738684_c1 | 3300050507 | Bacteria | 1087 |
| 575 | nmdc:mga05p37_889982_c1 | 3300050507 | Bacteria | 961 |
| 576 | nmdc:mga05p37_943731_c1 | 3300050507 | Bacteria | 924 |
| 577 | nmdc:mga09592_16_c1 | 3300050508 | Bacteria | 97518 |
| 578 | nmdc:mga09592_203853_c1 | 3300050508 | Bacteria | 1713 |
| 579 | nmdc:mga09592_376345_c1 | 3300050508 | Bacteria | 1228 |
| 580 | nmdc:mga0qj67_101449_c1 | 3300050509 | Bacteria | 2320 |
| 581 | nmdc:mga0qj67_16_c1 | 3300050509 | Bacteria | 124323 |
| 582 | nmdc:mga0qj67_289679_c1 | 3300050509 | Bacteria | 1327 |
| 583 | nmdc:mga0qj67_44019_c1 | 3300050509 | Bacteria | 3516 |
| 584 | nmdc:mga06r32_1454616_c1 | 3300050510 | Bacteria | 626 |
| 585 | nmdc:mga06r32_151796_c1 | 3300050510 | Bacteria | 2295 |
| 586 | nmdc:mga06r32_38_c3 | 3300050510 | Bacteria | 44584 |
| 587 | nmdc:mga0n895_549158_c1 | 3300050512 | Bacteria | 1161 |
| 588 | nmdc:mga0n895_741144_c1 | 3300050512 | Unclassified | 976 |
| 589 | nmdc:mga0rr50_2905_c1 | 3300050513 | Bacteria | 9776 |
| 590 | nmdc:mga08x19_255951_c1 | 3300050514 | Bacteria | 1209 |
| 591 | nmdc:mga0a205_151447_c1 | 3300050515 | Bacteria | 2219 |
| 592 | nmdc:mga0a205_3075_c1 | 3300050515 | Bacteria | 8623 |
| 593 | Ga0495601_0103263 | 3300053077 | Bacteria | 1842 |
| 594 | Ga0495612_0023438 | 3300053078 | Bacteria | 2477 |
| 595 | Ga0495612_0063212 | 3300053078 | Bacteria | 1535 |
| 596 | Ga0495612_0277085 | 3300053078 | Bacteria | 749 |
| 597 | Ga0495595_0011520 | 3300053084 | Bacteria | 3698 |
| 598 | Ga0495619_0005317 | 3300053085 | Bacteria | 8156 |
| 599 | Ga0495619_0172606 | 3300053085 | Bacteria | 1495 |
| 600 | Ga0495619_0279603 | 3300053085 | Bacteria | 1156 |
| 601 | Ga0495619_0290097 | 3300053085 | Bacteria | 1133 |
| 602 | Ga0500646_0000285 | 3300053090 | Bacteria | 15561 |
| 603 | Ga0500654_115529 | 3300053099 | Bacteria | 1079 |
| 604 | Ga0500588_0012090 | 3300053146 | Bacteria | 2131 |
| 605 | Ga0466962_0010199 | 3300061719 | Bacteria | 4512 |
| 606 | Ga0466962_0044127 | 3300061719 | Bacteria | 2133 |
| 607 | Ga0466962_0088522 | 3300061719 | Bacteria | 1483 |
| 608 | Ga0466962_0168708 | 3300061719 | Bacteria | 1065 |
| 609 | 2516085583 | 2515154202 | Bacteria | 5471270 |
| 610 | 2623586500 | 2622736626 | Bacteria | 7181580 |
| 611 | 2643765656 | 2643221548 | Bacteria | 8053412 |
| 612 | 2644459768 | 2643221682 | Bacteria | 6743283 |
| 613 | 2676481483 | 2675903059 | Bacteria | 8644972 |
| 614 | 2739603902 | 2739367653 | Bacteria | 2780952 |
| 615 | 2772641729 | 2772190715 | Bacteria | 6959372 |
| 616 | 2774901375 | 2773857933 | Bacteria | 5818019 |
| 617 | 2817509634 | 2816332305 | Bacteria | 2697803 |
| 618 | 2831940401 | 2831935698 | Bacteria | 5963223 |
| 619 | 2832007827 | 2832004796 | Bacteria | 6538017 |
| 620 | 2855672284 | 2855670206 | Bacteria | 7120389 |
| 621 | 2855678925 | 2855676851 | Bacteria | 7063653 |
| 622 | 2857289997 | 2857288857 | Bacteria | 7189066 |
| 623 | 2857712163 | 2857710386 | Bacteria | 3186771 |
| 624 | 2857729601 | 2857727296 | Bacteria | 2745552 |
| 625 | 2858849829 | 2858848962 | Bacteria | 6963058 |
| 626 | 2858872494 | 2858868258 | Bacteria | 7683772 |
| 627 | 2858888592 | 2858882152 | Bacteria | 7230291 |
| 628 | 2858890700 | 2858888857 | Bacteria | 7060307 |
| 629 | 2858898618 | 2858895516 | Bacteria | 7378898 |
| 630 | 2858908744 | 2858902515 | Bacteria | 7086037 |
| 631 | 2861524878 | 2861520306 | Bacteria | 8348283 |
| 632 | 2866066488 | 2866065130 | Bacteria | 6518152 |
| 633 | 2867303877 | 2867302475 | Bacteria | 7087181 |
| 634 | 2867313281 | 2867312974 | Bacteria | 7058875 |
| 635 | 2867325722 | 2867319477 | Bacteria | 7069771 |
| 636 | 2867371688 | 2867369537 | Bacteria | 6501581 |
| 637 | 2869054088 | 2869048445 | Bacteria | 6875584 |
| 638 | 2869068531 | 2869061728 | Bacteria | 7112407 |
| 639 | 2869072863 | 2869068681 | Bacteria | 7205615 |
| 640 | 2880493690 | 2880489317 | Bacteria | 7096270 |
| 641 | 2880498633 | 2880495981 | Bacteria | 7340502 |
| 642 | 2887483757 | 2887478801 | Bacteria | 8972725 |
| 643 | 2902586319 | 2902582711 | Bacteria | 6187705 |
| 644 | 2929220630 | 2929219909 | Bacteria | 6984360 |
| 645 | 2929227211 | 2929226422 | Bacteria | 7248583 |
| 646 | 2996227288 | 2996221748 | Bacteria | 6799777 |
| 647 | 3003005151 | 3002998708 | Bacteria | 11715108 |
| 648 | 3006427071 | 3006425503 | Bacteria | 6491253 |
| 649 | 8001782458 | 8001781756 | Bacteria | 9586736 |
| 650 | 8003835046 | 8003830390 | Bacteria | 6541657 |
| 651 | 8003872390 | 8003870546 | Bacteria | 7396674 |
| 652 | 8025479134 | 8025478263 | Bacteria | 8209203 |
| 653 | 8053946175 | 8053945823 | Bacteria | 8962862 |
| 654 | 8054564244 | 8054563764 | Bacteria | 5592885 |
| 655 | 8054708144 | 8054704163 | Bacteria | 7247792 |
| 656 | 8054730932 | 8054727385 | Bacteria | 7558670 |
| 657 | 8054735063 | 8054734606 | Bacteria | 6947278 |
| 658 | 8055412924 | 8055412473 | Bacteria | 6257500 |
| 659 | 8056062553 | 8056060235 | Bacteria | 7259403 |
| 660 | 8056450376 | 8056447290 | Bacteria | 7680491 |
| 661 | 8056669395 | 8056667051 | Bacteria | 6953971 |
| 662 | 8057569885 | 8057568493 | Bacteria | 7221719 |
| 663 | Ga0307515_10063832 | |||
| 664 | JGI25406J46586_10004330 | |||
| 665 | Ga0070658_10010403 | |||
| 666 | Ga0070658_10125679 | |||
| 667 | Ga0070658_10444230 | |||
| 668 | Ga0070683_100000995 | |||
| 669 | Ga0070683_100938980 | |||
| 670 | Ga0068869_100344625 | |||
| 671 | Ga0070680_100693264 | |||
| 672 | Ga0070680_100775393 | |||
| 673 | Ga0070680_100892827 | |||
| 674 | Ga0070682_100290446 | |||
| 675 | Ga0068868_100022901 | |||
| 676 | Ga0068868_100378859 | |||
| 677 | Ga0070675_100795541 | |||
| 678 | Ga0070671_100047252 | |||
| 679 | Ga0070709_10000307 | |||
| 680 | Ga0070709_10034907 | |||
| 681 | Ga0070709_10399182 | |||
| 682 | Ga0070709_10406515 | |||
| 683 | Ga0070714_100003576 | |||
| 684 | Ga0070714_100147830 | |||
| 685 | Ga0070714_100340568 | |||
| 686 | Ga0070714_100341898 | |||
| 687 | Ga0070713_100000689 | |||
| 688 | Ga0070713_100012299 | |||
| 689 | Ga0070713_100498339 | |||
| 690 | Ga0070713_100739642 | |||
| 691 | Ga0070713_100739645 | |||
| 692 | Ga0070710_10001337 | |||
| 693 | Ga0070710_10135459 | |||
| 694 | Ga0070710_10390324 | |||
| 695 | Ga0070711_100002106 | |||
| 696 | Ga0070711_100110095 | |||
| 697 | Ga0070711_100126141 | |||
| 698 | Ga0070708_100161920 | |||
| 699 | Ga0070708_100279339 | |||
| 700 | Ga0070678_100032236 | |||
| 701 | Ga0070662_100369615 | |||
| 702 | Ga0070681_10190949 | |||
| 703 | Ga0070706_100063854 | |||
| 704 | Ga0070707_100017896 | |||
| 705 | Ga0070707_100021447 | |||
| 706 | Ga0070707_100286108 | |||
| 707 | Ga0070698_100101264 | |||
| 708 | Ga0070698_100249490 | |||
| 709 | Ga0070699_100055066 | |||
| 710 | Ga0070699_100055962 | |||
| 711 | Ga0070699_100538736 | |||
| 712 | Ga0070679_100272869 | |||
| 713 | Ga0070679_101158594 | |||
| 714 | Ga0070684_100007125 | |||
| 715 | Ga0070684_100075850 | |||
| 716 | Ga0070684_100381363 | |||
| 717 | Ga0070697_100111616 | |||
| 718 | Ga0070697_100169508 | |||
| 719 | Ga0070697_100227881 | |||
| 720 | Ga0070695_100310015 | |||
| 721 | Ga0070695_100324775 | |||
| 722 | Ga0070696_100348079 | |||
| 723 | Ga0070665_100090210 | |||
| 724 | Ga0070665_100486488 | |||
| 725 | Ga0068855_100362123 | |||
| 726 | Ga0068855_101182007 | |||
| 727 | Ga0068855_101335072 | |||
| 728 | Ga0070664_100119117 | |||
| 729 | Ga0070664_100136706 | |||
| 730 | Ga0070664_100880906 | |||
| 731 | Ga0068857_100192323 | |||
| 732 | Ga0068857_100294523 | |||
| 733 | Ga0068857_101064852 | |||
| 734 | Ga0068856_100049011 | |||
| 735 | Ga0068856_100053234 | |||
| 736 | Ga0068856_100103528 | |||
| 737 | Ga0068856_100295894 | |||
| 738 | Ga0068856_100979806 | |||
| 739 | Ga0068859_101080311 | |||
| 740 | Ga0068864_100005188 | |||
| 741 | Ga0068864_100030224 | |||
| 742 | Ga0068864_100049251 | |||
| 743 | Ga0068863_100028410 | |||
| 744 | Ga0068863_100070350 | |||
| 745 | Ga0068863_100284459 | |||
| 746 | Ga0068863_100749301 | |||
| 747 | Ga0068858_100000162 | |||
| 748 | Ga0068858_100014629 | |||
| 749 | Ga0068858_100688672 | |||
| 750 | Ga0068860_100739077 | |||
| 751 | Ga0081455_10151371 | |||
| 752 | Ga0081540_1001602 | |||
| 753 | Ga0081539_10000094 | |||
| 754 | Ga0070717_10001045 | |||
| 755 | Ga0070717_10202547 | |||
| 756 | Ga0070717_10487408 | |||
| 757 | Ga0070717_10666486 | |||
| 758 | Ga0070715_10016655 | |||
| 759 | Ga0070715_10023955 | |||
| 760 | Ga0070715_10029962 | |||
| 761 | Ga0070715_10132352 | |||
| 762 | Ga0070716_100000228 | |||
| 763 | Ga0070716_100016649 | |||
| 764 | Ga0070716_100070981 | |||
| 765 | Ga0070712_100000806 | |||
| 766 | Ga0070712_100091120 | |||
| 767 | Ga0070712_100159961 | |||
| 768 | Ga0097621_100078852 | |||
| 769 | Ga0097621_100137047 | |||
| 770 | Ga0068871_100066456 | |||
| 771 | Ga0068871_100514888 | |||
| 772 | Ga0075428_100000146 | |||
| 773 | Ga0075428_100003404 | |||
| 774 | Ga0075428_101150534 | |||
| 775 | Ga0075428_101359110 | |||
| 776 | Ga0075430_100022640 | |||
| 777 | Ga0075430_100073708 | |||
| 778 | Ga0075430_100230150 | |||
| 779 | Ga0075430_100296652 | |||
| 780 | Ga0075431_100041914 | |||
| 781 | Ga0075431_100667650 | |||
| 782 | Ga0075433_10064694 | |||
| 783 | Ga0075433_10248655 | |||
| 784 | Ga0075434_100157738 | |||
| 785 | Ga0075434_100502745 | |||
| 786 | Ga0075429_100079301 | |||
| 787 | Ga0075429_100277542 | |||
| 788 | Ga0075429_100405785 | |||
| 789 | Ga0075436_100024374 | |||
| 790 | Ga0075436_100152670 | |||
| 791 | Ga0097620_100318054 | |||
| 792 | Ga0097620_101080401 | |||
| 793 | Ga0075435_100038617 | |||
| 794 | Ga0075435_100108921 | |||
| 795 | Ga0075435_100141630 | |||
| 796 | Ga0111539_10865099 | |||
| 797 | Ga0105245_10064096 | |||
| 798 | Ga0105247_10047754 | |||
| 799 | Ga0114129_10000001 | |||
| 800 | Ga0114129_10000011 | |||
| 801 | Ga0114129_10069528 | |||
| 802 | Ga0114129_10677570 | |||
| 803 | Ga0114129_10844865 | |||
| 804 | Ga0114129_11370159 | |||
| 805 | Ga0105248_10019803 | |||
| 806 | Ga0105248_10367580 | |||
| 807 | Ga0105248_10367615 | |||
| 808 | Ga0105237_10083878 | |||
| 809 | Ga0105237_10265186 | |||
| 810 | Ga0105238_10895405 | |||
| 811 | Ga0105249_10326631 | |||
| 812 | Ga0105033_100674 | |||
| 813 | Ga0105239_10031831 | |||
| 814 | Ga0157370_10023102 | |||
| 815 | Ga0157369_10167790 | |||
| 816 | Ga0157369_10951416 | |||
| 817 | Ga0157374_10037062 | |||
| 818 | Ga0157378_10836312 | |||
| 819 | Ga0157372_10623396 | |||
| 820 | Ga0157375_10006335 | |||
| 821 | Ga0163163_10002415 | |||
| 822 | Ga0163163_10248056 | |||
| 823 | Ga0163163_10928914 | |||
| 824 | Ga0163163_11488953 | |||
| 825 | Ga0157379_10011375 | |||
| 826 | Ga0157379_10036481 | |||
| 827 | Ga0157379_10728181 | |||
| 828 | Ga0157376_10044896 | |||
| 829 | Ga0157376_10371964 | |||
| 830 | Ga0206356_11868067 | |||
| 831 | Ga0206354_11545539 | |||
| 832 | Ga0206353_11068033 | |||
| 833 | Ga0207692_10000173 | |||
| 834 | Ga0207692_10005997 | |||
| 835 | Ga0207692_10030743 | |||
| 836 | Ga0207685_10000968 | |||
| 837 | Ga0207685_10009701 | |||
| 838 | Ga0207685_10013171 | |||
| 839 | Ga0207699_10000599 | |||
| 840 | Ga0207699_10006578 | |||
| 841 | Ga0207699_10027353 | |||
| 842 | Ga0207699_10097297 | |||
| 843 | Ga0207699_10150081 | |||
| 844 | Ga0207684_10355006 | |||
| 845 | Ga0207671_10152918 | |||
| 846 | Ga0207693_10026181 | |||
| 847 | Ga0207693_10133049 | |||
| 848 | Ga0207663_10001386 | |||
| 849 | Ga0207663_10019456 | |||
| 850 | Ga0207663_10085721 | |||
| 851 | Ga0207660_10640578 | |||
| 852 | Ga0207657_10142011 | |||
| 853 | Ga0207649_10259544 | |||
| 854 | Ga0207646_10053036 | |||
| 855 | Ga0207646_10144124 | |||
| 856 | Ga0207646_10447323 | |||
| 857 | Ga0207694_10203125 | |||
| 858 | Ga0207687_10037126 | |||
| 859 | Ga0207700_10000291 | |||
| 860 | Ga0207700_10038685 | |||
| 861 | Ga0207700_10086925 | |||
| 862 | Ga0207700_10119189 | |||
| 863 | Ga0207700_10163164 | |||
| 864 | Ga0207700_10165112 | |||
| 865 | Ga0207700_10192123 | |||
| 866 | Ga0207664_10000163 | |||
| 867 | Ga0207664_10010303 | |||
| 868 | Ga0207664_10063822 | |||
| 869 | Ga0207664_10084764 | |||
| 870 | Ga0207664_10087355 | |||
| 871 | Ga0207664_10369890 | |||
| 872 | Ga0207644_10050719 | |||
| 873 | Ga0207706_10211734 | |||
| 874 | Ga0207665_10002219 | |||
| 875 | Ga0207665_10018028 | |||
| 876 | Ga0207665_10111789 | |||
| 877 | Ga0207711_10072171 | |||
| 878 | Ga0207711_10967615 | |||
| 879 | Ga0207689_10358383 | |||
| 880 | Ga0207661_10003454 | |||
| 881 | Ga0207661_10454469 | |||
| 882 | Ga0207667_10680923 | |||
| 883 | Ga0207651_10700773 | |||
| 884 | Ga0207677_10025587 | |||
| 885 | Ga0207677_10527316 | |||
| 886 | Ga0207703_10030538 | |||
| 887 | Ga0207639_11324188 | |||
| 888 | Ga0207641_10036856 | |||
| 889 | Ga0207641_10056043 | |||
| 890 | Ga0207641_10307646 | |||
| 891 | Ga0207676_10037717 | |||
| 892 | Ga0207676_10076788 | |||
| 893 | Ga0207676_10817101 | |||
| 894 | Ga0207674_10175407 | |||
| 895 | Ga0207674_10181870 | |||
| 896 | Ga0207674_10267481 | |||
| 897 | Ga0207675_100250311 | |||
| 898 | Ga0207683_10507306 | |||
| 899 | Ga0268266_10210875 | |||
| 900 | Ga0268266_10539001 | |||
| 901 | Ga0268266_10592755 | |||
| 902 | Ga0307515_10512297 | |||
| 903 | Ga0307511_10001096 | |||
| 904 | Ga0265328_10023968 | |||
| 905 | Ga0307513_10017027 | |||
| 906 | Ga0307509_10654066 | |||
| 907 | Ga0307408_100217280 | |||
| 908 | Ga0307408_100918478 | |||
| 909 | Ga0307408_100922168 | |||
| 910 | Ga0307508_10385657 | |||
| 911 | Ga0307405_10009164 | |||
| 912 | Ga0307413_10011456 | |||
| 913 | Ga0307413_10129253 | |||
| 914 | Ga0307410_10041833 | |||
| 915 | Ga0307410_10182011 | |||
| 916 | Ga0307406_10009812 | |||
| 917 | Ga0307407_10071498 | |||
| 918 | Ga0307409_100000720 | |||
| 919 | Ga0307409_100067501 | |||
| 920 | Ga0307409_100088890 | |||
| 921 | Ga0307409_100731528 | |||
| 922 | Ga0307416_100005756 | |||
| 923 | Ga0307416_100085652 | |||
| 924 | Ga0307416_100156989 | |||
| 925 | Ga0307416_100302322 | |||
| 926 | Ga0307416_101867449 | |||
| 927 | Ga0307414_10085290 | |||
| 928 | Ga0307414_10356979 | |||
| 929 | Ga0307411_10173204 | |||
| 930 | Ga0307411_10698762 | |||
| 931 | Ga0307415_100000028 | |||
| 932 | Ga0307415_100006943 | |||
| 933 | Ga0307415_100015934 | |||
| 934 | Ga0307415_100032012 | |||
| 935 | Ga0307415_100100304 | |||
| 936 | Ga0307415_100131981 | |||
| 937 | Ga0307415_100258175 | |||
| 938 | Ga0307415_101181367 | |||
| 939 | Ga0373950_0010781 | |||
| 940 | Ga0373926_0148335 | |||
| 941 | Ga0373934_0000431 | |||
| 942 | Ga0373940_0016429 | |||
| 943 | Ga0373944_0021653 | |||
| 944 | Ga0373949_0013637 | |||
| 945 | Ga0373923_0003717 | |||
| 946 | Ga0373923_0021724 | |||
| 947 | Ga0373923_0386227 | |||
| 948 | Ga0373932_0029481 | |||
| 949 | Ga0373936_0135319 | |||
| 950 | Ga0373939_0228886 | |||
| 951 | Ga0373941_0232994 | |||
| 952 | Ga0373945_0078614 | |||
| 953 | Ga0373953_0000076 | |||
| 954 | Ga0373953_0021104 | |||
| 955 | Ga0373954_0000183 | |||
| 956 | Ga0373956_0003835 | |||
| 957 | Ga0373956_0011807 | |||
| 958 | Ga0373956_0050282 | |||
| 959 | Ga0373957_0000477 | |||
| 960 | Ga0373957_0056173 | |||
| 961 | Ga0373957_0139735 | |||
| 962 | Ga0373960_0019786 | |||
| 963 | Ga0373943_0075120 | |||
| 964 | Ga0373943_0149475 | |||
| 965 | Ga0373943_0201573 | |||
| 966 | Ga0373946_0046295 | |||
| 967 | Ga0373946_0294954 | |||
| 968 | Ga0373955_0000126 | |||
| 969 | Ga0373955_0003574 | |||
| 970 | Ga0373955_0110120 | |||
| 971 | Ga0373955_0181073 | |||
| 972 | Ga0373955_0210763 | |||
| 973 | Ga0373961_0012709 | |||
| 974 | Ga0373924_0000152 | |||
| 975 | Ga0373924_0082434 | |||
| 976 | Ga0373931_0032301 | |||
| 977 | Ga0373931_0234236 | |||
| 978 | Ga0373935_0228997 | |||
| 979 | Ga0373927_0099969 | |||
| 980 | Ga0373927_0274277 | |||
| 981 | Ga0373927_0275342 | |||
| 982 | Ga0373927_0285678 | |||
| 983 | Ga0373927_0403146 | |||
| 984 | Ga0373933_0000098 | |||
| 985 | Ga0373933_0017258 | |||
| 986 | Ga0373933_0038002 | |||
| 987 | Ga0373933_0039245 | |||
| 988 | Ga0373933_0243575 | |||
| 989 | Ga0373947_0055002 | |||
| 990 | Ga0373947_0086216 | |||
| 991 | Ga0373947_0265571 | |||
| 992 | Ga0373947_0268996 | |||
| 993 | Ga0373947_0349916 | |||
| 994 | Ga0373937_0000067 | |||
| 995 | Ga0373937_0002213 | |||
| 996 | Ga0373937_0127654 | |||
| 997 | Ga0373937_0245184 | |||
| 998 | Ga0373937_0364114 | |||
| 999 | Ga0373925_0002689 | |||
| 1000 | Ga0373925_0124747 | |||
| 1001 | Ga0373925_0144563 | |||
| 1002 | Ga0373925_0341704 | |||
| 1003 | Ga0373925_0537910 | |||
| 1004 | Ga0395899_0127904 | |||
| 1005 | Ga0395900_0189737 | |||
| 1006 | Ga0395905_0120387 | |||
| 1007 | Ga0395901_0084120 | |||
| 1008 | Ga0466966_0043985 | |||
| 1009 | Ga0466966_0048800 | |||
| 1010 | Ga0466963_0041640 | |||
| 1011 | Ga0466963_0160891 | |||
| 1012 | Ga0466963_0268111 | |||
| 1013 | Ga0466963_0620195 | |||
| 1014 | Ga0466971_0055441 | |||
| 1015 | Ga0466971_0169308 | |||
| 1016 | Ga0466971_0174757 | |||
| 1017 | Ga0466970_0046538 | |||
| 1018 | Ga0466957_0046982 | |||
| 1019 | Ga0466957_0269576 | |||
| 1020 | Ga0466960_0002582 | |||
| 1021 | Ga0466960_0030268 | |||
| 1022 | Ga0466960_0076368 | |||
| 1023 | Ga0466959_0073935 | |||
| 1024 | Ga0466959_0077572 | |||
| 1025 | Ga0466959_0654047 | |||
| 1026 | Ga0466958_0059860 | |||
| 1027 | Ga0466958_0173126 | |||
| 1028 | Ga0466967_0036423 | |||
| 1029 | Ga0466967_0098380 | |||
| 1030 | Ga0466967_0169865 | |||
| 1031 | Ga0466967_0182203 | |||
| 1032 | Ga0495592_0000069 | |||
| 1033 | Ga0495592_0038355 | |||
| 1034 | Ga0495592_0121146 | |||
| 1035 | Ga0495592_0134042 | |||
| 1036 | Ga0495592_0249686 | |||
| 1037 | Ga0495603_0166170 | |||
| 1038 | Ga0495629_0027992 | |||
| 1039 | Ga0495629_0029747 | |||
| 1040 | Ga0495629_0048759 | |||
| 1041 | Ga0495641_0021999 | |||
| 1042 | Ga0495651_0000016 | |||
| 1043 | Ga0495651_0015500 | |||
| 1044 | Ga0495651_0016791 | |||
| 1045 | Ga0495651_0031123 | |||
| 1046 | Ga0495651_0074885 | |||
| 1047 | Ga0495653_0000770 | |||
| 1048 | Ga0495653_0006893 | |||
| 1049 | Ga0495653_0031473 | |||
| 1050 | Ga0495653_0042511 | |||
| 1051 | Ga0495653_0050683 | |||
| 1052 | Ga0495653_0142410 | |||
| 1053 | Ga0495580_0184033 | |||
| 1054 | Ga0495582_0035278 | |||
| 1055 | Ga0495582_0158941 | |||
| 1056 | Ga0495639_0060985 | |||
| 1057 | Ga0495639_0134458 | |||
| 1058 | Ga0495639_0203311 | |||
| 1059 | Ga0495662_0147747 | |||
| 1060 | Ga0495664_0234079 | |||
| 1061 | Ga0495594_0086486 | |||
| 1062 | Ga0495594_0120813 | |||
| 1063 | Ga0495606_0002664 | |||
| 1064 | Ga0495608_0000051 | |||
| 1065 | Ga0495608_0022256 | |||
| 1066 | Ga0495608_0049279 | |||
| 1067 | Ga0495608_0059769 | |||
| 1068 | Ga0495608_0134080 | |||
| 1069 | Ga0495618_0051598 | |||
| 1070 | Ga0495618_0117936 | |||
| 1071 | Ga0495618_0176037 | |||
| 1072 | Ga0495618_0189784 | |||
| 1073 | Ga0495628_0000126 | |||
| 1074 | Ga0495628_0042496 | |||
| 1075 | Ga0495628_0087031 | |||
| 1076 | Ga0495628_0205867 | |||
| 1077 | Ga0495628_0233451 | |||
| 1078 | Ga0495630_0146117 | |||
| 1079 | Ga0495630_0176091 | |||
| 1080 | Ga0495630_0229677 | |||
| 1081 | Ga0495630_0949271 | |||
| 1082 | Ga0495666_0023838 | |||
| 1083 | Ga0495652_0000761 | |||
| 1084 | Ga0495652_0011175 | |||
| 1085 | Ga0495652_0034221 | |||
| 1086 | Ga0495652_0061916 | |||
| 1087 | Ga0495652_0097293 | |||
| 1088 | Ga0495652_0126532 | |||
| 1089 | Ga0495665_0006251 | |||
| 1090 | Ga0495640_0027840 | |||
| 1091 | Ga0495640_0046622 | |||
| 1092 | Ga0495640_0071142 | |||
| 1093 | Ga0495640_0155722 | |||
| 1094 | Ga0495587_0000058 | |||
| 1095 | Ga0495587_0008337 | |||
| 1096 | Ga0495587_0008404 | |||
| 1097 | Ga0495587_0136246 | |||
| 1098 | Ga0495645_0114901 | |||
| 1099 | Ga0495645_0262233 | |||
| 1100 | Ga0495645_0275938 | |||
| 1101 | Ga0495667_0000062 | |||
| 1102 | Ga0495667_0007401 | |||
| 1103 | Ga0495667_0031698 | |||
| 1104 | Ga0495667_0075543 | |||
| 1105 | Ga0495667_0161462 | |||
| 1106 | Ga0495667_0194738 | |||
| 1107 | Ga0495656_0000003 | |||
| 1108 | Ga0495668_0000169 | |||
| 1109 | Ga0495634_0110389 | |||
| 1110 | Ga0495625_0002610 | |||
| 1111 | Ga0495635_0007102 | |||
| 1112 | Ga0495635_0034060 | |||
| 1113 | Ga0495635_0148785 | |||
| 1114 | Ga0495635_0204717 | |||
| 1115 | Ga0495635_0249950 | |||
| 1116 | Ga0495635_0737650 | |||
| 1117 | Ga0495657_0000065 | |||
| 1118 | Ga0495657_0016187 | |||
| 1119 | Ga0495657_0031558 | |||
| 1120 | Ga0495657_0055641 | |||
| 1121 | Ga0495657_0085761 | |||
| 1122 | Ga0495599_0000045 | |||
| 1123 | Ga0495599_0019207 | |||
| 1124 | Ga0495599_0063783 | |||
| 1125 | Ga0495599_0073153 | |||
| 1126 | Ga0495599_0177740 | |||
| 1127 | Ga0495599_0238766 | |||
| 1128 | Ga0495599_0239379 | |||
| 1129 | Ga0495599_0304698 | |||
| 1130 | Ga0495623_0000787 | |||
| 1131 | Ga0495623_0065263 | |||
| 1132 | Ga0495623_0199742 | |||
| 1133 | Ga0495623_0215720 | |||
| 1134 | Ga0495646_0001648 | |||
| 1135 | Ga0495646_0015988 | |||
| 1136 | Ga0495646_0108257 | |||
| 1137 | Ga0495647_0059685 | |||
| 1138 | Ga0495658_0022001 | |||
| 1139 | Ga0495613_0058274 | |||
| 1140 | Ga0495624_0026084 | |||
| 1141 | Ga0495600_0000392 | |||
| 1142 | Ga0495600_0000536 | |||
| 1143 | Ga0495600_0009392 | |||
| 1144 | Ga0495600_0021271 | |||
| 1145 | Ga0495600_0200277 | |||
| 1146 | Ga0495581_0044328 | |||
| 1147 | Ga0495581_0094758 | |||
| 1148 | Ga0495581_0136741 | |||
| 1149 | Ga0495604_0001132 | |||
| 1150 | Ga0495604_0011978 | |||
| 1151 | Ga0495604_0042273 | |||
| 1152 | Ga0495604_0080949 | |||
| 1153 | Ga0495674_0003461 | |||
| 1154 | Ga0495674_0020554 | |||
| 1155 | Ga0495674_0479761 | |||
| 1156 | Ga0495676_0089261 | |||
| 1157 | Ga0495676_0128071 | |||
| 1158 | Ga0495676_0323017 | |||
| 1159 | Ga0495680_0000444 | |||
| 1160 | Ga0495680_0009939 | |||
| 1161 | Ga0495680_0014777 | |||
| 1162 | Ga0495680_0044853 | |||
| 1163 | Ga0495680_0089235 | |||
| 1164 | Ga0495680_0388956 | |||
| 1165 | Ga0495675_0000655 | |||
| 1166 | Ga0495675_0027125 | |||
| 1167 | Ga0495675_0263647 | |||
| 1168 | Ga0495684_0016089 | |||
| 1169 | Ga0495684_0126830 | |||
| 1170 | Ga0495684_0173978 | |||
| 1171 | Ga0495684_0183504 | |||
| 1172 | Ga0495593_0033130 | |||
| 1173 | Ga0495593_0052646 | |||
| 1174 | Ga0495593_0092971 | |||
| 1175 | Ga0495602_0000079 | |||
| 1176 | Ga0495602_0015074 | |||
| 1177 | Ga0495602_0031285 | |||
| 1178 | Ga0495602_0067906 | |||
| 1179 | Ga0495602_0420883 | |||
| 1180 | Ga0495614_0095281 | |||
| 1181 | Ga0495626_0001289 | |||
| 1182 | Ga0496100_0086861 | |||
| 1183 | Ga0496100_0174476 | |||
| 1184 | Ga0496100_0718489 | |||
| 1185 | Ga0496101_0033113 | |||
| 1186 | Ga0496101_0051792 | |||
| 1187 | Ga0496101_0091658 | |||
| 1188 | Ga0496102_0281312 | |||
| 1189 | Ga0496102_0317841 | |||
| 1190 | Ga0496104_0004947 | |||
| 1191 | Ga0496104_0033822 | |||
| 1192 | Ga0496104_0172964 | |||
| 1193 | Ga0496104_1121969 | |||
| 1194 | Ga0496105_0003955 | |||
| 1195 | Ga0496105_0046017 | |||
| 1196 | Ga0496105_0051325 | |||
| 1197 | Ga0496105_0137255 | |||
| 1198 | Ga0496105_0617763 | |||
| 1199 | Ga0496106_0150699 | |||
| 1200 | Ga0496107_0067578 | |||
| 1201 | Ga0496107_0283388 | |||
| 1202 | Ga0496107_0398277 | |||
| 1203 | Ga0496108_0018925 | |||
| 1204 | Ga0496108_0081860 | |||
| 1205 | Ga0496108_0103055 | |||
| 1206 | Ga0496108_0156604 | |||
| 1207 | Ga0496109_0021476 | |||
| 1208 | Ga0496109_0023161 | |||
| 1209 | Ga0496109_0023373 | |||
| 1210 | Ga0496109_0324190 | |||
| 1211 | Ga0496110_0006369 | |||
| 1212 | Ga0496110_0012238 | |||
| 1213 | Ga0496111_0004057 | |||
| 1214 | Ga0496111_0046094 | |||
| 1215 | Ga0496111_0381225 | |||
| 1216 | Ga0496112_0016556 | |||
| 1217 | Ga0496112_0033642 | |||
| 1218 | Ga0496112_0073675 | |||
| 1219 | Ga0496112_0147889 | |||
| 1220 | Ga0496112_1266003 | |||
| 1221 | Ga0496113_0004227 | |||
| 1222 | Ga0496113_0023091 | |||
| 1223 | Ga0496113_0141905 | |||
| 1224 | Ga0496113_0240606 | |||
| 1225 | Ga0496113_0406359 | |||
| 1226 | Ga0496114_0630977 | |||
| 1227 | Ga0496115_0013595 | |||
| 1228 | Ga0496115_0835469 | |||
| 1229 | Ga0496124_0069956 | |||
| 1230 | Ga0501321_038048 | |||
| 1231 | Ga0501034_0218083 | |||
| 1232 | Ga0501034_0800466 | |||
| 1233 | Ga0501047_0073015 | |||
| 1234 | nmdc:mga05p37_1057_c1 | |||
| 1235 | nmdc:mga05p37_1964_c1 | |||
| 1236 | nmdc:mga05p37_738684_c1 | |||
| 1237 | nmdc:mga05p37_889982_c1 | |||
| 1238 | nmdc:mga05p37_943731_c1 | |||
| 1239 | nmdc:mga09592_16_c1 | |||
| 1240 | nmdc:mga09592_203853_c1 | |||
| 1241 | nmdc:mga09592_376345_c1 | |||
| 1242 | nmdc:mga0qj67_101449_c1 | |||
| 1243 | nmdc:mga0qj67_16_c1 | |||
| 1244 | nmdc:mga0qj67_289679_c1 | |||
| 1245 | nmdc:mga0qj67_44019_c1 | |||
| 1246 | nmdc:mga06r32_1454616_c1 | |||
| 1247 | nmdc:mga06r32_151796_c1 | |||
| 1248 | nmdc:mga06r32_38_c3 | |||
| 1249 | nmdc:mga0n895_549158_c1 | |||
| 1250 | nmdc:mga0n895_741144_c1 | |||
| 1251 | nmdc:mga0rr50_2905_c1 | |||
| 1252 | nmdc:mga08x19_255951_c1 | |||
| 1253 | nmdc:mga0a205_151447_c1 | |||
| 1254 | nmdc:mga0a205_3075_c1 | |||
| 1255 | Ga0495601_0103263 | |||
| 1256 | Ga0495612_0023438 | |||
| 1257 | Ga0495612_0063212 | |||
| 1258 | Ga0495612_0277085 | |||
| 1259 | Ga0495595_0011520 | |||
| 1260 | Ga0495619_0005317 | |||
| 1261 | Ga0495619_0172606 | |||
| 1262 | Ga0495619_0279603 | |||
| 1263 | Ga0495619_0290097 | |||
| 1264 | Ga0500646_0000285 | |||
| 1265 | Ga0500654_115529 | |||
| 1266 | Ga0500588_0012090 | |||
| 1267 | Ga0466962_0010199 | |||
| 1268 | Ga0466962_0044127 | |||
| 1269 | Ga0466962_0088522 | |||
| 1270 | Ga0466962_0168708 | |||
| 1271 | 2516085583 | |||
| 1272 | 2623586500 | |||
| 1273 | 2643765656 | |||
| 1274 | 2644459768 | |||
| 1275 | 2676481483 | |||
| 1276 | 2739603902 | |||
| 1277 | 2772641729 | |||
| 1278 | 2774901375 | |||
| 1279 | 2817509634 | |||
| 1280 | 2831940401 | |||
| 1281 | 2832007827 | |||
| 1282 | 2855672284 | |||
| 1283 | 2855678925 | |||
| 1284 | 2857289997 | |||
| 1285 | 2857712163 | |||
| 1286 | 2857729601 | |||
| 1287 | 2858849829 | |||
| 1288 | 2858872494 | |||
| 1289 | 2858888592 | |||
| 1290 | 2858890700 | |||
| 1291 | 2858898618 | |||
| 1292 | 2858908744 | |||
| 1293 | 2861524878 | |||
| 1294 | 2866066488 | |||
| 1295 | 2867303877 | |||
| 1296 | 2867313281 | |||
| 1297 | 2867325722 | |||
| 1298 | 2867371688 | |||
| 1299 | 2869054088 | |||
| 1300 | 2869068531 | |||
| 1301 | 2869072863 | |||
| 1302 | 2880493690 | |||
| 1303 | 2880498633 | |||
| 1304 | 2887483757 | |||
| 1305 | 2902586319 | |||
| 1306 | 2929220630 | |||
| 1307 | 2929227211 | |||
| 1308 | 2996227288 | |||
| 1309 | 3003005151 | |||
| 1310 | 3006427071 | |||
| 1311 | 8001782458 | |||
| 1312 | 8003835046 | |||
| 1313 | 8003872390 | |||
| 1314 | 8025479134 | |||
| 1315 | 8053946175 | |||
| 1316 | 8054564244 | |||
| 1317 | 8054708144 | |||
| 1318 | 8054730932 | |||
| 1319 | 8054735063 | |||
| 1320 | 8055412924 | |||
| 1321 | 8056062553 | |||
| 1322 | 8056450376 | |||
| 1323 | 8056669395 | |||
| 1324 | 8057569885 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.983 | 1 | 190 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9787 | 1 | 182 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9743 | 5 | 188 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9733 | 1 | 182 |
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.9627 | 1 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9663 | 66 | 191 | 3.40.50.1470 |
| af_Q86Y79_27_209_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9575 | 3 | 176 | 3.40.50.1470 |
| 3neaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9511 | 3 | 179 | 3.40.50.1470 |
| 5zx8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9477 | 4 | 194 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9415 | 5 | 197 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R4QPQ6-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9964 | 5 | 192 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A7D4PRE4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9955 | 2 | 180 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A560AY05-F1-model_v4 | deleted | 0.9942 | 2 | 191 |
|
| AF-A0A2M9BG41-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9938 | 3 | 191 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A840NAM4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9933 | 3 | 190 |
GO:0004045
GO:0005737 GO:0006412 |