F473482

General Info

Members Datasets Scaffolds Average Seq Length
662 306 1324 198

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10063832|Ga0307515_100638322
Length 229
Sequence MSVDESRQSRLRGGPDLVADGRSRSGGQGGQGPFLVVGLGNPGPKYERNRHNVGFMVADLLAERVGGSWKSAARVKAAVAQGRLPLNSGAPGGPGVVLAKPLTFMNLSGGPVSGLARFFKLEVGQVIVVHDELDLPFGTVRLKKGGGEGGHNGLRSMSQSLGSKDYLRVRFGVGRPPGRMDAADYVLRDFSSVERPELPVLLERAADALVDTLVEGLEAAQNRWHVAPA

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
254 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
255 2643221548 Streptomyces sp. Root55 Isolate Unclassified
256 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
257 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
258 2739367653 Kocuria sp. OV113 Isolate Unclassified
259 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
260 2773857933 Frankia sp. BMG5.30 Isolate Nodule
261 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
262 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
263 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
264 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
265 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
266 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
267 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
268 2857727296 Kocuria sp. R-72562 Isolate Unclassified
269 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
270 2858868258 Micromonospora sp. MH33 Isolate Unclassified
271 2858882152 Micromonospora noduli MED15 Isolate Nodule
272 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
273 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
274 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
275 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
276 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
277 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
278 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
279 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
280 2867369537 Streptomyces sp. Z26 Isolate Unclassified
281 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
282 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
283 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
284 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
285 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
286 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
287 2902582711 Micromonospora sp. AP08 Isolate Unclassified
288 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
289 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
290 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
291 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
292 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
293 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
294 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
295 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
296 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
297 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
298 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
299 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
300 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
301 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
302 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
303 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
304 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
305 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
306 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.24
Metatranscriptomes 0.6
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 1.06
Rhizoplane 7.1
Rhizosphere 85.35
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10063832 3300028794 Bacteria 5162
2 JGI25406J46586_10004330 3300003203 Bacteria 6620
3 Ga0070658_10010403 3300005327 Bacteria 7460
4 Ga0070658_10125679 3300005327 Bacteria 2134
5 Ga0070658_10444230 3300005327 Bacteria 1117
6 Ga0070683_100000995 3300005329 Bacteria 21222
7 Ga0070683_100938980 3300005329 Bacteria 830
8 Ga0068869_100344625 3300005334 Bacteria 1213
9 Ga0070680_100693264 3300005336 Bacteria 876
10 Ga0070680_100775393 3300005336 Bacteria 826
11 Ga0070680_100892827 3300005336 Bacteria 767
12 Ga0070682_100290446 3300005337 Bacteria 1196
13 Ga0068868_100022901 3300005338 Bacteria 4722
14 Ga0068868_100378859 3300005338 Bacteria 1217
15 Ga0070675_100795541 3300005354 Bacteria 864
16 Ga0070671_100047252 3300005355 Bacteria 3580
17 Ga0070709_10000307 3300005434 Bacteria 31007
18 Ga0070709_10034907 3300005434 Bacteria 3053
19 Ga0070709_10399182 3300005434 Bacteria 1026
20 Ga0070709_10406515 3300005434 Bacteria 1017
21 Ga0070714_100003576 3300005435 Bacteria 11626
22 Ga0070714_100147830 3300005435 Bacteria 2115
23 Ga0070714_100340568 3300005435 Bacteria 1406
24 Ga0070714_100341898 3300005435 Bacteria 1404
25 Ga0070713_100000689 3300005436 Bacteria 21691
26 Ga0070713_100012299 3300005436 Bacteria 6271
27 Ga0070713_100498339 3300005436 Bacteria 1149
28 Ga0070713_100739642 3300005436 Bacteria 940
29 Ga0070713_100739645 3300005436 Bacteria 940
30 Ga0070710_10001337 3300005437 Bacteria 11626
31 Ga0070710_10135459 3300005437 Bacteria 1505
32 Ga0070710_10390324 3300005437 Bacteria 930
33 Ga0070711_100002106 3300005439 Bacteria 11253
34 Ga0070711_100110095 3300005439 Bacteria 2020
35 Ga0070711_100126141 3300005439 Bacteria 1900
36 Ga0070708_100161920 3300005445 Bacteria 2085
37 Ga0070708_100279339 3300005445 Bacteria 1572
38 Ga0070678_100032236 3300005456 Bacteria 3625
39 Ga0070662_100369615 3300005457 Bacteria 1178
40 Ga0070681_10190949 3300005458 Bacteria 1968
41 Ga0070706_100063854 3300005467 Bacteria 3403
42 Ga0070707_100017896 3300005468 Bacteria 6664
43 Ga0070707_100021447 3300005468 Bacteria 6106
44 Ga0070707_100286108 3300005468 Bacteria 1602
45 Ga0070698_100101264 3300005471 Bacteria 2852
46 Ga0070698_100249490 3300005471 Bacteria 1708
47 Ga0070699_100055066 3300005518 Bacteria 3444
48 Ga0070699_100055962 3300005518 Bacteria 3415
49 Ga0070699_100538736 3300005518 Bacteria 1062
50 Ga0070679_100272869 3300005530 Bacteria 1645
51 Ga0070679_101158594 3300005530 Bacteria 718
52 Ga0070684_100007125 3300005535 Bacteria 8689
53 Ga0070684_100075850 3300005535 Bacteria 2966
54 Ga0070684_100381363 3300005535 Bacteria 1298
55 Ga0070697_100111616 3300005536 Bacteria 2279
56 Ga0070697_100169508 3300005536 Bacteria 1847
57 Ga0070697_100227881 3300005536 Bacteria 1589
58 Ga0070695_100310015 3300005545 Bacteria 1169
59 Ga0070695_100324775 3300005545 Bacteria 1145
60 Ga0070696_100348079 3300005546 Bacteria 1147
61 Ga0070665_100090210 3300005548 Bacteria 3071
62 Ga0070665_100486488 3300005548 Bacteria 1245
63 Ga0068855_100362123 3300005563 Bacteria 1596
64 Ga0068855_101182007 3300005563 Bacteria 796
65 Ga0068855_101335072 3300005563 Unclassified 741
66 Ga0070664_100119117 3300005564 Bacteria 2310
67 Ga0070664_100136706 3300005564 Bacteria 2156
68 Ga0070664_100880906 3300005564 Bacteria 839
69 Ga0068857_100192323 3300005577 Bacteria 1858
70 Ga0068857_100294523 3300005577 Bacteria 1495
71 Ga0068857_101064852 3300005577 Bacteria 780
72 Ga0068856_100049011 3300005614 Bacteria 4163
73 Ga0068856_100053234 3300005614 Bacteria 3991
74 Ga0068856_100103528 3300005614 Bacteria 2840
75 Ga0068856_100295894 3300005614 Bacteria 1636
76 Ga0068856_100979806 3300005614 Bacteria 864
77 Ga0068859_101080311 3300005617 Bacteria 882
78 Ga0068864_100005188 3300005618 Bacteria 10671
79 Ga0068864_100030224 3300005618 Bacteria 4591
80 Ga0068864_100049251 3300005618 Bacteria 3625
81 Ga0068863_100028410 3300005841 Bacteria 5340
82 Ga0068863_100070350 3300005841 Bacteria 3309
83 Ga0068863_100284459 3300005841 Bacteria 1603
84 Ga0068863_100749301 3300005841 Bacteria 972
85 Ga0068858_100000162 3300005842 Bacteria 71107
86 Ga0068858_100014629 3300005842 Bacteria 7390
87 Ga0068858_100688672 3300005842 Bacteria 994
88 Ga0068860_100739077 3300005843 Bacteria 995
89 Ga0081455_10151371 3300005937 Bacteria 1788
90 Ga0081540_1001602 3300005983 Bacteria 19298
91 Ga0081539_10000094 3300005985 Bacteria 206102
92 Ga0070717_10001045 3300006028 Bacteria 18562
93 Ga0070717_10202547 3300006028 Bacteria 1739
94 Ga0070717_10487408 3300006028 Bacteria 1113
95 Ga0070717_10666486 3300006028 Bacteria 945
96 Ga0070715_10016655 3300006163 Bacteria 2767
97 Ga0070715_10023955 3300006163 Bacteria 2398
98 Ga0070715_10029962 3300006163 Bacteria 2195
99 Ga0070715_10132352 3300006163 Bacteria 1202
100 Ga0070716_100000228 3300006173 Bacteria 22532
101 Ga0070716_100016649 3300006173 Bacteria 3799
102 Ga0070716_100070981 3300006173 Bacteria 2046
103 Ga0070712_100000806 3300006175 Bacteria 18623
104 Ga0070712_100091120 3300006175 Bacteria 2233
105 Ga0070712_100159961 3300006175 Bacteria 1738
106 Ga0097621_100078852 3300006237 Bacteria 2737
107 Ga0097621_100137047 3300006237 Bacteria 2088
108 Ga0068871_100066456 3300006358 Bacteria 2956
109 Ga0068871_100514888 3300006358 Bacteria 1080
110 Ga0075428_100000146 3300006844 Bacteria 63972
111 Ga0075428_100003404 3300006844 Bacteria 17397
112 Ga0075428_101150534 3300006844 Bacteria 819
113 Ga0075428_101359110 3300006844 Bacteria 746
114 Ga0075430_100022640 3300006846 Bacteria 5347
115 Ga0075430_100073708 3300006846 Bacteria 2862
116 Ga0075430_100230150 3300006846 Bacteria 1537
117 Ga0075430_100296652 3300006846 Bacteria 1337
118 Ga0075431_100041914 3300006847 Bacteria 4720
119 Ga0075431_100667650 3300006847 Bacteria 1019
120 Ga0075433_10064694 3300006852 Bacteria 3206
121 Ga0075433_10248655 3300006852 Bacteria 1578
122 Ga0075434_100157738 3300006871 Bacteria 2288
123 Ga0075434_100502745 3300006871 Bacteria 1233
124 Ga0075429_100079301 3300006880 Bacteria 2862
125 Ga0075429_100277542 3300006880 Bacteria 1467
126 Ga0075429_100405785 3300006880 Bacteria 1193
127 Ga0075436_100024374 3300006914 Bacteria 4158
128 Ga0075436_100152670 3300006914 Bacteria 1626
129 Ga0097620_100318054 3300006931 Bacteria 1650
130 Ga0097620_101080401 3300006931 Bacteria 882
131 Ga0075435_100038617 3300007076 Bacteria 3807
132 Ga0075435_100108921 3300007076 Bacteria 2302
133 Ga0075435_100141630 3300007076 Bacteria 2018
134 Ga0111539_10865099 3300009094 Bacteria 1052
135 Ga0105245_10064096 3300009098 Bacteria 3321
136 Ga0105247_10047754 3300009101 Bacteria 2629
137 Ga0114129_10000001 3300009147 Bacteria 292978
138 Ga0114129_10000011 3300009147 Bacteria 139000
139 Ga0114129_10069528 3300009147 Bacteria 4908
140 Ga0114129_10677570 3300009147 Bacteria 1328
141 Ga0114129_10844865 3300009147 Bacteria 1164
142 Ga0114129_11370159 3300009147 Bacteria 874
143 Ga0105248_10019803 3300009177 Bacteria 7452
144 Ga0105248_10367580 3300009177 Bacteria 1619
145 Ga0105248_10367615 3300009177 Bacteria 1619
146 Ga0105237_10083878 3300009545 Bacteria 3177
147 Ga0105237_10265186 3300009545 Bacteria 1720
148 Ga0105238_10895405 3300009551 Bacteria 906
149 Ga0105249_10326631 3300009553 Bacteria 1547
150 Ga0105033_100674 3300009986 Bacteria 2640
151 Ga0105239_10031831 3300010375 Bacteria 5796
152 Ga0157370_10023102 3300013104 Bacteria 6181
153 Ga0157369_10167790 3300013105 Bacteria 2314
154 Ga0157369_10951416 3300013105 Bacteria 880
155 Ga0157374_10037062 3300013296 Bacteria 4472
156 Ga0157378_10836312 3300013297 Bacteria 948
157 Ga0157372_10623396 3300013307 Bacteria 1257
158 Ga0157375_10006335 3300013308 Bacteria 10314
159 Ga0163163_10002415 3300014325 Bacteria 15800
160 Ga0163163_10248056 3300014325 Bacteria 1831
161 Ga0163163_10928914 3300014325 Bacteria 933
162 Ga0163163_11488953 3300014325 Bacteria 738
163 Ga0157379_10011375 3300014968 Bacteria 7761
164 Ga0157379_10036481 3300014968 Bacteria 4383
165 Ga0157379_10728181 3300014968 Bacteria 932
166 Ga0157376_10044896 3300014969 Bacteria 3635
167 Ga0157376_10371964 3300014969 Bacteria 1374
168 Ga0206356_11868067 3300020070 Bacteria 2063
169 Ga0206354_11545539 3300020081 Bacteria 1458
170 Ga0206353_11068033 3300020082 Bacteria 4318
171 Ga0207692_10000173 3300025898 Bacteria 20587
172 Ga0207692_10005997 3300025898 Bacteria 4912
173 Ga0207692_10030743 3300025898 Bacteria 2564
174 Ga0207685_10000968 3300025905 Bacteria 5537
175 Ga0207685_10009701 3300025905 Bacteria 2807
176 Ga0207685_10013171 3300025905 Bacteria 2550
177 Ga0207699_10000599 3300025906 Bacteria 17726
178 Ga0207699_10006578 3300025906 Bacteria 5639
179 Ga0207699_10027353 3300025906 Bacteria 3156
180 Ga0207699_10097297 3300025906 Bacteria 1860
181 Ga0207699_10150081 3300025906 Bacteria 1541
182 Ga0207684_10355006 3300025910 Bacteria 1262
183 Ga0207671_10152918 3300025914 Bacteria 1783
184 Ga0207693_10026181 3300025915 Bacteria 4618
185 Ga0207693_10133049 3300025915 Bacteria 1955
186 Ga0207663_10001386 3300025916 Bacteria 11248
187 Ga0207663_10019456 3300025916 Bacteria 3825
188 Ga0207663_10085721 3300025916 Bacteria 2075
189 Ga0207660_10640578 3300025917 Bacteria 866
190 Ga0207657_10142011 3300025919 Bacteria 1961
191 Ga0207649_10259544 3300025920 Bacteria 1255
192 Ga0207646_10053036 3300025922 Bacteria 3628
193 Ga0207646_10144124 3300025922 Bacteria 2146
194 Ga0207646_10447323 3300025922 Bacteria 1166
195 Ga0207694_10203125 3300025924 Bacteria 1613
196 Ga0207687_10037126 3300025927 Bacteria 3322
197 Ga0207700_10000291 3300025928 Bacteria 29714
198 Ga0207700_10038685 3300025928 Bacteria 3464
199 Ga0207700_10086925 3300025928 Bacteria 2458
200 Ga0207700_10119189 3300025928 Bacteria 2137
201 Ga0207700_10163164 3300025928 Bacteria 1852
202 Ga0207700_10165112 3300025928 Bacteria 1842
203 Ga0207700_10192123 3300025928 Bacteria 1716
204 Ga0207664_10000163 3300025929 Bacteria 53290
205 Ga0207664_10010303 3300025929 Bacteria 6603
206 Ga0207664_10063822 3300025929 Bacteria 2945
207 Ga0207664_10084764 3300025929 Bacteria 2585
208 Ga0207664_10087355 3300025929 Bacteria 2549
209 Ga0207664_10369890 3300025929 Bacteria 1271
210 Ga0207644_10050719 3300025931 Bacteria 2976
211 Ga0207706_10211734 3300025933 Bacteria 1699
212 Ga0207665_10002219 3300025939 Bacteria 13097
213 Ga0207665_10018028 3300025939 Bacteria 4638
214 Ga0207665_10111789 3300025939 Bacteria 1920
215 Ga0207711_10072171 3300025941 Bacteria 2998
216 Ga0207711_10967615 3300025941 Bacteria 790
217 Ga0207689_10358383 3300025942 Bacteria 1213
218 Ga0207661_10003454 3300025944 Bacteria 10968
219 Ga0207661_10454469 3300025944 Bacteria 1167
220 Ga0207667_10680923 3300025949 Unclassified 1032
221 Ga0207651_10700773 3300025960 Bacteria 892
222 Ga0207677_10025587 3300026023 Bacteria 3684
223 Ga0207677_10527316 3300026023 Bacteria 1025
224 Ga0207703_10030538 3300026035 Bacteria 4260
225 Ga0207639_11324188 3300026041 Bacteria 676
226 Ga0207641_10036856 3300026088 Bacteria 4082
227 Ga0207641_10056043 3300026088 Bacteria 3348
228 Ga0207641_10307646 3300026088 Bacteria 1499
229 Ga0207676_10037717 3300026095 Bacteria 3685
230 Ga0207676_10076788 3300026095 Bacteria 2700
231 Ga0207676_10817101 3300026095 Bacteria 910
232 Ga0207674_10175407 3300026116 Bacteria 2096
233 Ga0207674_10181870 3300026116 Bacteria 2054
234 Ga0207674_10267481 3300026116 Bacteria 1657
235 Ga0207675_100250311 3300026118 Bacteria 1715
236 Ga0207683_10507306 3300026121 Bacteria 1114
237 Ga0268266_10210875 3300028379 Bacteria 1781
238 Ga0268266_10539001 3300028379 Bacteria 1117
239 Ga0268266_10592755 3300028379 Bacteria 1064
240 Ga0307515_10512297 3300028794 Bacteria 810
241 Ga0307511_10001096 3300030521 Bacteria 28800
242 Ga0265328_10023968 3300031239 Bacteria 2309
243 Ga0307513_10017027 3300031456 Bacteria 8733
244 Ga0307509_10654066 3300031507 Bacteria 720
245 Ga0307408_100217280 3300031548 Bacteria 1558
246 Ga0307408_100918478 3300031548 Bacteria 802
247 Ga0307408_100922168 3300031548 Bacteria 801
248 Ga0307508_10385657 3300031616 Bacteria 992
249 Ga0307405_10009164 3300031731 Bacteria 5063
250 Ga0307413_10011456 3300031824 Bacteria 4363
251 Ga0307413_10129253 3300031824 Bacteria 1726
252 Ga0307410_10041833 3300031852 Bacteria 3024
253 Ga0307410_10182011 3300031852 Bacteria 1591
254 Ga0307406_10009812 3300031901 Bacteria 5388
255 Ga0307407_10071498 3300031903 Bacteria 2066
256 Ga0307409_100000720 3300031995 Bacteria 14794
257 Ga0307409_100067501 3300031995 Bacteria 2824
258 Ga0307409_100088890 3300031995 Bacteria 2523
259 Ga0307409_100731528 3300031995 Bacteria 992
260 Ga0307416_100005756 3300032002 Bacteria 7675
261 Ga0307416_100085652 3300032002 Bacteria 2683
262 Ga0307416_100156989 3300032002 Bacteria 2096
263 Ga0307416_100302322 3300032002 Bacteria 1591
264 Ga0307416_101867449 3300032002 Bacteria 704
265 Ga0307414_10085290 3300032004 Bacteria 2326
266 Ga0307414_10356979 3300032004 Bacteria 1256
267 Ga0307411_10173204 3300032005 Bacteria 1630
268 Ga0307411_10698762 3300032005 Bacteria 883
269 Ga0307415_100000028 3300032126 Bacteria 60969
270 Ga0307415_100006943 3300032126 Bacteria 6151
271 Ga0307415_100015934 3300032126 Bacteria 4464
272 Ga0307415_100032012 3300032126 Bacteria 3396
273 Ga0307415_100100304 3300032126 Bacteria 2121
274 Ga0307415_100131981 3300032126 Bacteria 1893
275 Ga0307415_100258175 3300032126 Bacteria 1420
276 Ga0307415_101181367 3300032126 Bacteria 720
277 Ga0373950_0010781 3300034818 Bacteria 1483
278 Ga0373926_0148335 3300035083 Bacteria 892
279 Ga0373934_0000431 3300035086 Bacteria 14649
280 Ga0373940_0016429 3300035088 Bacteria 1833
281 Ga0373944_0021653 3300035089 Bacteria 1863
282 Ga0373949_0013637 3300035090 Bacteria 1804
283 Ga0373923_0003717 3300035111 Bacteria 4942
284 Ga0373923_0021724 3300035111 Bacteria 2509
285 Ga0373923_0386227 3300035111 Bacteria 672
286 Ga0373932_0029481 3300035112 Bacteria 1515
287 Ga0373936_0135319 3300035113 Bacteria 1061
288 Ga0373939_0228886 3300035114 Bacteria 715
289 Ga0373941_0232994 3300035115 Bacteria 712
290 Ga0373945_0078614 3300035116 Bacteria 1260
291 Ga0373953_0000076 3300035117 Bacteria 23953
292 Ga0373953_0021104 3300035117 Bacteria 2440
293 Ga0373954_0000183 3300035118 Bacteria 22612
294 Ga0373956_0003835 3300035119 Bacteria 6052
295 Ga0373956_0011807 3300035119 Bacteria 3606
296 Ga0373956_0050282 3300035119 Bacteria 1871
297 Ga0373957_0000477 3300035120 Bacteria 10125
298 Ga0373957_0056173 3300035120 Bacteria 1515
299 Ga0373957_0139735 3300035120 Bacteria 989
300 Ga0373960_0019786 3300035121 Bacteria 1772
301 Ga0373943_0075120 3300035170 Bacteria 1720
302 Ga0373943_0149475 3300035170 Bacteria 1264
303 Ga0373943_0201573 3300035170 Bacteria 1101
304 Ga0373946_0046295 3300035171 Bacteria 1802
305 Ga0373946_0294954 3300035171 Bacteria 800
306 Ga0373955_0000126 3300035172 Bacteria 30266
307 Ga0373955_0003574 3300035172 Bacteria 6842
308 Ga0373955_0110120 3300035172 Bacteria 1591
309 Ga0373955_0181073 3300035172 Bacteria 1250
310 Ga0373955_0210763 3300035172 Bacteria 1158
311 Ga0373961_0012709 3300035241 Bacteria 2112
312 Ga0373924_0000152 3300035410 Bacteria 20298
313 Ga0373924_0082434 3300035410 Bacteria 1369
314 Ga0373931_0032301 3300035691 Bacteria 2708
315 Ga0373931_0234236 3300035691 Bacteria 1111
316 Ga0373935_0228997 3300035692 Bacteria 1293
317 Ga0373927_0099969 3300035695 Bacteria 1886
318 Ga0373927_0274277 3300035695 Bacteria 1109
319 Ga0373927_0275342 3300035695 Bacteria 1107
320 Ga0373927_0285678 3300035695 Bacteria 1085
321 Ga0373927_0403146 3300035695 Bacteria 902
322 Ga0373933_0000098 3300035724 Bacteria 54263
323 Ga0373933_0017258 3300035724 Bacteria 4048
324 Ga0373933_0038002 3300035724 Bacteria 2827
325 Ga0373933_0039245 3300035724 Bacteria 2785
326 Ga0373933_0243575 3300035724 Bacteria 1157
327 Ga0373947_0055002 3300035725 Bacteria 2403
328 Ga0373947_0086216 3300035725 Bacteria 1951
329 Ga0373947_0265571 3300035725 Bacteria 1138
330 Ga0373947_0268996 3300035725 Bacteria 1131
331 Ga0373947_0349916 3300035725 Bacteria 991
332 Ga0373937_0000067 3300036401 Bacteria 94291
333 Ga0373937_0002213 3300036401 Bacteria 16253
334 Ga0373937_0127654 3300036401 Bacteria 2373
335 Ga0373937_0245184 3300036401 Bacteria 1688
336 Ga0373937_0364114 3300036401 Bacteria 1370
337 Ga0373925_0002689 3300037068 Bacteria 14105
338 Ga0373925_0124747 3300037068 Bacteria 2002
339 Ga0373925_0144563 3300037068 Bacteria 1863
340 Ga0373925_0341704 3300037068 Bacteria 1214
341 Ga0373925_0537910 3300037068 Bacteria 960
342 Ga0395899_0127904 3300037312 Bacteria 1816
343 Ga0395900_0189737 3300037418 Bacteria 2085
344 Ga0395905_0120387 3300037471 Bacteria 2467
345 Ga0395901_0084120 3300038443 Bacteria 3325
346 Ga0466966_0043985 3300044684 Bacteria 2860
347 Ga0466966_0048800 3300044684 Bacteria 2697
348 Ga0466963_0041640 3300044694 Bacteria 3013
349 Ga0466963_0160891 3300044694 Bacteria 1562
350 Ga0466963_0268111 3300044694 Bacteria 1199
351 Ga0466963_0620195 3300044694 Bacteria 764
352 Ga0466971_0055441 3300044719 Bacteria 1787
353 Ga0466971_0169308 3300044719 Bacteria 1025
354 Ga0466971_0174757 3300044719 Bacteria 1009
355 Ga0466970_0046538 3300044765 Bacteria 2311
356 Ga0466957_0046982 3300044842 Bacteria 2622
357 Ga0466957_0269576 3300044842 Bacteria 1136
358 Ga0466960_0002582 3300044901 Bacteria 6810
359 Ga0466960_0030268 3300044901 Bacteria 2490
360 Ga0466960_0076368 3300044901 Bacteria 1678
361 Ga0466959_0073935 3300045049 Bacteria 2465
362 Ga0466959_0077572 3300045049 Bacteria 2397
363 Ga0466959_0654047 3300045049 Bacteria 705
364 Ga0466958_0059860 3300045836 Bacteria 2318
365 Ga0466958_0173126 3300045836 Bacteria 1367
366 Ga0466967_0036423 3300045976 Bacteria 4200
367 Ga0466967_0098380 3300045976 Bacteria 2671
368 Ga0466967_0169865 3300045976 Bacteria 2051
369 Ga0466967_0182203 3300045976 Bacteria 1982
370 Ga0495592_0000069 3300046454 Bacteria 94288
371 Ga0495592_0038355 3300046454 Bacteria 3605
372 Ga0495592_0121146 3300046454 Bacteria 1840
373 Ga0495592_0134042 3300046454 Bacteria 1729
374 Ga0495592_0249686 3300046454 Bacteria 1173
375 Ga0495603_0166170 3300046455 Bacteria 1279
376 Ga0495629_0027992 3300046459 Bacteria 4002
377 Ga0495629_0029747 3300046459 Bacteria 3872
378 Ga0495629_0048759 3300046459 Bacteria 2969
379 Ga0495641_0021999 3300046461 Bacteria 3198
380 Ga0495651_0000016 3300046462 Bacteria 125612
381 Ga0495651_0015500 3300046462 Bacteria 5896
382 Ga0495651_0016791 3300046462 Bacteria 5669
383 Ga0495651_0031123 3300046462 Bacteria 4161
384 Ga0495651_0074885 3300046462 Bacteria 2567
385 Ga0495653_0000770 3300046463 Bacteria 24601
386 Ga0495653_0006893 3300046463 Bacteria 9340
387 Ga0495653_0031473 3300046463 Bacteria 4217
388 Ga0495653_0042511 3300046463 Bacteria 3539
389 Ga0495653_0050683 3300046463 Bacteria 3191
390 Ga0495653_0142410 3300046463 Bacteria 1684
391 Ga0495580_0184033 3300046472 Bacteria 1442
392 Ga0495582_0035278 3300046473 Bacteria 2750
393 Ga0495582_0158941 3300046473 Bacteria 1285
394 Ga0495639_0060985 3300046475 Bacteria 1729
395 Ga0495639_0134458 3300046475 Bacteria 1186
396 Ga0495639_0203311 3300046475 Bacteria 970
397 Ga0495662_0147747 3300046476 Bacteria 1157
398 Ga0495664_0234079 3300046477 Bacteria 1111
399 Ga0495594_0086486 3300046499 Bacteria 1754
400 Ga0495594_0120813 3300046499 Bacteria 1481
401 Ga0495606_0002664 3300046507 Bacteria 20310
402 Ga0495608_0000051 3300046511 Bacteria 94719
403 Ga0495608_0022256 3300046511 Bacteria 4344
404 Ga0495608_0049279 3300046511 Bacteria 2796
405 Ga0495608_0059769 3300046511 Bacteria 2510
406 Ga0495608_0134080 3300046511 Bacteria 1583
407 Ga0495618_0051598 3300046514 Bacteria 2599
408 Ga0495618_0117936 3300046514 Bacteria 1699
409 Ga0495618_0176037 3300046514 Bacteria 1360
410 Ga0495618_0189784 3300046514 Bacteria 1303
411 Ga0495628_0000126 3300046516 Bacteria 63839
412 Ga0495628_0042496 3300046516 Bacteria 3625
413 Ga0495628_0087031 3300046516 Bacteria 2422
414 Ga0495628_0205867 3300046516 Bacteria 1481
415 Ga0495628_0233451 3300046516 Bacteria 1378
416 Ga0495630_0146117 3300046517 Bacteria 1798
417 Ga0495630_0176091 3300046517 Bacteria 1630
418 Ga0495630_0229677 3300046517 Bacteria 1417
419 Ga0495630_0949271 3300046517 Bacteria 654
420 Ga0495666_0023838 3300046526 Bacteria 3026
421 Ga0495652_0000761 3300046529 Bacteria 37066
422 Ga0495652_0011175 3300046529 Bacteria 8132
423 Ga0495652_0034221 3300046529 Bacteria 4429
424 Ga0495652_0061916 3300046529 Bacteria 3157
425 Ga0495652_0097293 3300046529 Bacteria 2394
426 Ga0495652_0126532 3300046529 Bacteria 2029
427 Ga0495665_0006251 3300046531 Bacteria 6424
428 Ga0495640_0027840 3300046533 Bacteria 4072
429 Ga0495640_0046622 3300046533 Bacteria 3002
430 Ga0495640_0071142 3300046533 Bacteria 2334
431 Ga0495640_0155722 3300046533 Bacteria 1466
432 Ga0495587_0000058 3300046536 Bacteria 94307
433 Ga0495587_0008337 3300046536 Bacteria 6671
434 Ga0495587_0008404 3300046536 Bacteria 6640
435 Ga0495587_0136246 3300046536 Bacteria 1402
436 Ga0495645_0114901 3300046543 Bacteria 1901
437 Ga0495645_0262233 3300046543 Bacteria 1143
438 Ga0495645_0275938 3300046543 Bacteria 1107
439 Ga0495667_0000062 3300046559 Bacteria 94307
440 Ga0495667_0007401 3300046559 Bacteria 7444
441 Ga0495667_0031698 3300046559 Bacteria 3545
442 Ga0495667_0075543 3300046559 Bacteria 2192
443 Ga0495667_0161462 3300046559 Bacteria 1441
444 Ga0495667_0194738 3300046559 Bacteria 1298
445 Ga0495656_0000003 3300046615 Bacteria 338227
446 Ga0495668_0000169 3300046616 Bacteria 97150
447 Ga0495634_0110389 3300046642 Bacteria 1769
448 Ga0495625_0002610 3300046660 Bacteria 19286
449 Ga0495635_0007102 3300046663 Bacteria 7830
450 Ga0495635_0034060 3300046663 Bacteria 3533
451 Ga0495635_0148785 3300046663 Bacteria 1594
452 Ga0495635_0204717 3300046663 Bacteria 1338
453 Ga0495635_0249950 3300046663 Bacteria 1195
454 Ga0495635_0737650 3300046663 Bacteria 637
455 Ga0495657_0000065 3300046675 Bacteria 94307
456 Ga0495657_0016187 3300046675 Bacteria 5438
457 Ga0495657_0031558 3300046675 Bacteria 3702
458 Ga0495657_0055641 3300046675 Bacteria 2638
459 Ga0495657_0085761 3300046675 Bacteria 2029
460 Ga0495599_0000045 3300046678 Bacteria 86086
461 Ga0495599_0019207 3300046678 Bacteria 4262
462 Ga0495599_0063783 3300046678 Bacteria 2302
463 Ga0495599_0073153 3300046678 Bacteria 2139
464 Ga0495599_0177740 3300046678 Bacteria 1312
465 Ga0495599_0238766 3300046678 Bacteria 1108
466 Ga0495599_0239379 3300046678 Bacteria 1107
467 Ga0495599_0304698 3300046678 Bacteria 961
468 Ga0495623_0000787 3300046679 Bacteria 21284
469 Ga0495623_0065263 3300046679 Bacteria 2277
470 Ga0495623_0199742 3300046679 Bacteria 1150
471 Ga0495623_0215720 3300046679 Bacteria 1096
472 Ga0495646_0001648 3300046680 Bacteria 13328
473 Ga0495646_0015988 3300046680 Bacteria 4762
474 Ga0495646_0108257 3300046680 Bacteria 1585
475 Ga0495647_0059685 3300046681 Bacteria 1502
476 Ga0495658_0022001 3300046683 Bacteria 3367
477 Ga0495613_0058274 3300046689 Bacteria 2835
478 Ga0495624_0026084 3300046690 Bacteria 3832
479 Ga0495600_0000392 3300046809 Bacteria 22642
480 Ga0495600_0000536 3300046809 Bacteria 19669
481 Ga0495600_0009392 3300046809 Bacteria 6041
482 Ga0495600_0021271 3300046809 Bacteria 4152
483 Ga0495600_0200277 3300046809 Bacteria 1282
484 Ga0495581_0044328 3300047315 Bacteria 2572
485 Ga0495581_0094758 3300047315 Bacteria 1733
486 Ga0495581_0136741 3300047315 Bacteria 1428
487 Ga0495604_0001132 3300047317 Bacteria 22122
488 Ga0495604_0011978 3300047317 Bacteria 6894
489 Ga0495604_0042273 3300047317 Bacteria 3572
490 Ga0495604_0080949 3300047317 Bacteria 2432
491 Ga0495674_0003461 3300047319 Bacteria 15333
492 Ga0495674_0020554 3300047319 Bacteria 6110
493 Ga0495674_0479761 3300047319 Bacteria 996
494 Ga0495676_0089261 3300047321 Bacteria 2310
495 Ga0495676_0128071 3300047321 Bacteria 1837
496 Ga0495676_0323017 3300047321 Bacteria 1036
497 Ga0495680_0000444 3300047322 Bacteria 46401
498 Ga0495680_0009939 3300047322 Bacteria 8519
499 Ga0495680_0014777 3300047322 Bacteria 6748
500 Ga0495680_0044853 3300047322 Bacteria 3493
501 Ga0495680_0089235 3300047322 Bacteria 2314
502 Ga0495680_0388956 3300047322 Bacteria 965
503 Ga0495675_0000655 3300047444 Bacteria 21934
504 Ga0495675_0027125 3300047444 Bacteria 3650
505 Ga0495675_0263647 3300047444 Bacteria 1031
506 Ga0495684_0016089 3300047471 Bacteria 5758
507 Ga0495684_0126830 3300047471 Bacteria 1919
508 Ga0495684_0173978 3300047471 Bacteria 1599
509 Ga0495684_0183504 3300047471 Bacteria 1550
510 Ga0495593_0033130 3300047673 Bacteria 2815
511 Ga0495593_0052646 3300047673 Bacteria 2151
512 Ga0495593_0092971 3300047673 Bacteria 1552
513 Ga0495602_0000079 3300048088 Bacteria 94307
514 Ga0495602_0015074 3300048088 Bacteria 7817
515 Ga0495602_0031285 3300048088 Bacteria 5034
516 Ga0495602_0067906 3300048088 Bacteria 3064
517 Ga0495602_0420883 3300048088 Bacteria 949
518 Ga0495614_0095281 3300048089 Bacteria 1297
519 Ga0495626_0001289 3300048091 Bacteria 20450
520 Ga0496100_0086861 3300048903 Bacteria 2125
521 Ga0496100_0174476 3300048903 Bacteria 1551
522 Ga0496100_0718489 3300048903 Bacteria 780
523 Ga0496101_0033113 3300048904 Bacteria 3643
524 Ga0496101_0051792 3300048904 Bacteria 2959
525 Ga0496101_0091658 3300048904 Bacteria 2262
526 Ga0496102_0281312 3300048905 Bacteria 1568
527 Ga0496102_0317841 3300048905 Bacteria 1467
528 Ga0496104_0004947 3300048907 Bacteria 11626
529 Ga0496104_0033822 3300048907 Bacteria 4764
530 Ga0496104_0172964 3300048907 Bacteria 2070
531 Ga0496104_1121969 3300048907 Bacteria 690
532 Ga0496105_0003955 3300048908 Bacteria 11087
533 Ga0496105_0046017 3300048908 Bacteria 3601
534 Ga0496105_0051325 3300048908 Bacteria 3407
535 Ga0496105_0137255 3300048908 Bacteria 2014
536 Ga0496105_0617763 3300048908 Bacteria 840
537 Ga0496106_0150699 3300048909 Bacteria 1834
538 Ga0496107_0067578 3300048910 Bacteria 2593
539 Ga0496107_0283388 3300048910 Bacteria 1233
540 Ga0496107_0398277 3300048910 Bacteria 1024
541 Ga0496108_0018925 3300048911 Bacteria 5647
542 Ga0496108_0081860 3300048911 Bacteria 2736
543 Ga0496108_0103055 3300048911 Bacteria 2435
544 Ga0496108_0156604 3300048911 Bacteria 1967
545 Ga0496109_0021476 3300048912 Bacteria 5709
546 Ga0496109_0023161 3300048912 Bacteria 5509
547 Ga0496109_0023373 3300048912 Bacteria 5487
548 Ga0496109_0324190 3300048912 Bacteria 1454
549 Ga0496110_0006369 3300048913 Bacteria 9333
550 Ga0496110_0012238 3300048913 Bacteria 7050
551 Ga0496111_0004057 3300048914 Bacteria 9198
552 Ga0496111_0046094 3300048914 Bacteria 3138
553 Ga0496111_0381225 3300048914 Bacteria 1043
554 Ga0496112_0016556 3300048915 Bacteria 6911
555 Ga0496112_0033642 3300048915 Bacteria 4984
556 Ga0496112_0073675 3300048915 Bacteria 3375
557 Ga0496112_0147889 3300048915 Bacteria 2317
558 Ga0496112_1266003 3300048915 Bacteria 653
559 Ga0496113_0004227 3300048916 Bacteria 8785
560 Ga0496113_0023091 3300048916 Bacteria 4408
561 Ga0496113_0141905 3300048916 Bacteria 1890
562 Ga0496113_0240606 3300048916 Bacteria 1444
563 Ga0496113_0406359 3300048916 Bacteria 1093
564 Ga0496114_0630977 3300048917 Bacteria 944
565 Ga0496115_0013595 3300048918 Bacteria 6158
566 Ga0496115_0835469 3300048918 Bacteria 714
567 Ga0496124_0069956 3300048927 Bacteria 2912
568 Ga0501321_038048 3300049537 Bacteria 667
569 Ga0501034_0218083 3300049571 Bacteria 1861
570 Ga0501034_0800466 3300049571 Bacteria 835
571 Ga0501047_0073015 3300049581 Bacteria 3303
572 nmdc:mga05p37_1057_c1 3300050507 Bacteria 31447
573 nmdc:mga05p37_1964_c1 3300050507 Bacteria 23980
574 nmdc:mga05p37_738684_c1 3300050507 Bacteria 1087
575 nmdc:mga05p37_889982_c1 3300050507 Bacteria 961
576 nmdc:mga05p37_943731_c1 3300050507 Bacteria 924
577 nmdc:mga09592_16_c1 3300050508 Bacteria 97518
578 nmdc:mga09592_203853_c1 3300050508 Bacteria 1713
579 nmdc:mga09592_376345_c1 3300050508 Bacteria 1228
580 nmdc:mga0qj67_101449_c1 3300050509 Bacteria 2320
581 nmdc:mga0qj67_16_c1 3300050509 Bacteria 124323
582 nmdc:mga0qj67_289679_c1 3300050509 Bacteria 1327
583 nmdc:mga0qj67_44019_c1 3300050509 Bacteria 3516
584 nmdc:mga06r32_1454616_c1 3300050510 Bacteria 626
585 nmdc:mga06r32_151796_c1 3300050510 Bacteria 2295
586 nmdc:mga06r32_38_c3 3300050510 Bacteria 44584
587 nmdc:mga0n895_549158_c1 3300050512 Bacteria 1161
588 nmdc:mga0n895_741144_c1 3300050512 Unclassified 976
589 nmdc:mga0rr50_2905_c1 3300050513 Bacteria 9776
590 nmdc:mga08x19_255951_c1 3300050514 Bacteria 1209
591 nmdc:mga0a205_151447_c1 3300050515 Bacteria 2219
592 nmdc:mga0a205_3075_c1 3300050515 Bacteria 8623
593 Ga0495601_0103263 3300053077 Bacteria 1842
594 Ga0495612_0023438 3300053078 Bacteria 2477
595 Ga0495612_0063212 3300053078 Bacteria 1535
596 Ga0495612_0277085 3300053078 Bacteria 749
597 Ga0495595_0011520 3300053084 Bacteria 3698
598 Ga0495619_0005317 3300053085 Bacteria 8156
599 Ga0495619_0172606 3300053085 Bacteria 1495
600 Ga0495619_0279603 3300053085 Bacteria 1156
601 Ga0495619_0290097 3300053085 Bacteria 1133
602 Ga0500646_0000285 3300053090 Bacteria 15561
603 Ga0500654_115529 3300053099 Bacteria 1079
604 Ga0500588_0012090 3300053146 Bacteria 2131
605 Ga0466962_0010199 3300061719 Bacteria 4512
606 Ga0466962_0044127 3300061719 Bacteria 2133
607 Ga0466962_0088522 3300061719 Bacteria 1483
608 Ga0466962_0168708 3300061719 Bacteria 1065
609 2516085583 2515154202 Bacteria 5471270
610 2623586500 2622736626 Bacteria 7181580
611 2643765656 2643221548 Bacteria 8053412
612 2644459768 2643221682 Bacteria 6743283
613 2676481483 2675903059 Bacteria 8644972
614 2739603902 2739367653 Bacteria 2780952
615 2772641729 2772190715 Bacteria 6959372
616 2774901375 2773857933 Bacteria 5818019
617 2817509634 2816332305 Bacteria 2697803
618 2831940401 2831935698 Bacteria 5963223
619 2832007827 2832004796 Bacteria 6538017
620 2855672284 2855670206 Bacteria 7120389
621 2855678925 2855676851 Bacteria 7063653
622 2857289997 2857288857 Bacteria 7189066
623 2857712163 2857710386 Bacteria 3186771
624 2857729601 2857727296 Bacteria 2745552
625 2858849829 2858848962 Bacteria 6963058
626 2858872494 2858868258 Bacteria 7683772
627 2858888592 2858882152 Bacteria 7230291
628 2858890700 2858888857 Bacteria 7060307
629 2858898618 2858895516 Bacteria 7378898
630 2858908744 2858902515 Bacteria 7086037
631 2861524878 2861520306 Bacteria 8348283
632 2866066488 2866065130 Bacteria 6518152
633 2867303877 2867302475 Bacteria 7087181
634 2867313281 2867312974 Bacteria 7058875
635 2867325722 2867319477 Bacteria 7069771
636 2867371688 2867369537 Bacteria 6501581
637 2869054088 2869048445 Bacteria 6875584
638 2869068531 2869061728 Bacteria 7112407
639 2869072863 2869068681 Bacteria 7205615
640 2880493690 2880489317 Bacteria 7096270
641 2880498633 2880495981 Bacteria 7340502
642 2887483757 2887478801 Bacteria 8972725
643 2902586319 2902582711 Bacteria 6187705
644 2929220630 2929219909 Bacteria 6984360
645 2929227211 2929226422 Bacteria 7248583
646 2996227288 2996221748 Bacteria 6799777
647 3003005151 3002998708 Bacteria 11715108
648 3006427071 3006425503 Bacteria 6491253
649 8001782458 8001781756 Bacteria 9586736
650 8003835046 8003830390 Bacteria 6541657
651 8003872390 8003870546 Bacteria 7396674
652 8025479134 8025478263 Bacteria 8209203
653 8053946175 8053945823 Bacteria 8962862
654 8054564244 8054563764 Bacteria 5592885
655 8054708144 8054704163 Bacteria 7247792
656 8054730932 8054727385 Bacteria 7558670
657 8054735063 8054734606 Bacteria 6947278
658 8055412924 8055412473 Bacteria 6257500
659 8056062553 8056060235 Bacteria 7259403
660 8056450376 8056447290 Bacteria 7680491
661 8056669395 8056667051 Bacteria 6953971
662 8057569885 8057568493 Bacteria 7221719
663 Ga0307515_10063832
664 JGI25406J46586_10004330
665 Ga0070658_10010403
666 Ga0070658_10125679
667 Ga0070658_10444230
668 Ga0070683_100000995
669 Ga0070683_100938980
670 Ga0068869_100344625
671 Ga0070680_100693264
672 Ga0070680_100775393
673 Ga0070680_100892827
674 Ga0070682_100290446
675 Ga0068868_100022901
676 Ga0068868_100378859
677 Ga0070675_100795541
678 Ga0070671_100047252
679 Ga0070709_10000307
680 Ga0070709_10034907
681 Ga0070709_10399182
682 Ga0070709_10406515
683 Ga0070714_100003576
684 Ga0070714_100147830
685 Ga0070714_100340568
686 Ga0070714_100341898
687 Ga0070713_100000689
688 Ga0070713_100012299
689 Ga0070713_100498339
690 Ga0070713_100739642
691 Ga0070713_100739645
692 Ga0070710_10001337
693 Ga0070710_10135459
694 Ga0070710_10390324
695 Ga0070711_100002106
696 Ga0070711_100110095
697 Ga0070711_100126141
698 Ga0070708_100161920
699 Ga0070708_100279339
700 Ga0070678_100032236
701 Ga0070662_100369615
702 Ga0070681_10190949
703 Ga0070706_100063854
704 Ga0070707_100017896
705 Ga0070707_100021447
706 Ga0070707_100286108
707 Ga0070698_100101264
708 Ga0070698_100249490
709 Ga0070699_100055066
710 Ga0070699_100055962
711 Ga0070699_100538736
712 Ga0070679_100272869
713 Ga0070679_101158594
714 Ga0070684_100007125
715 Ga0070684_100075850
716 Ga0070684_100381363
717 Ga0070697_100111616
718 Ga0070697_100169508
719 Ga0070697_100227881
720 Ga0070695_100310015
721 Ga0070695_100324775
722 Ga0070696_100348079
723 Ga0070665_100090210
724 Ga0070665_100486488
725 Ga0068855_100362123
726 Ga0068855_101182007
727 Ga0068855_101335072
728 Ga0070664_100119117
729 Ga0070664_100136706
730 Ga0070664_100880906
731 Ga0068857_100192323
732 Ga0068857_100294523
733 Ga0068857_101064852
734 Ga0068856_100049011
735 Ga0068856_100053234
736 Ga0068856_100103528
737 Ga0068856_100295894
738 Ga0068856_100979806
739 Ga0068859_101080311
740 Ga0068864_100005188
741 Ga0068864_100030224
742 Ga0068864_100049251
743 Ga0068863_100028410
744 Ga0068863_100070350
745 Ga0068863_100284459
746 Ga0068863_100749301
747 Ga0068858_100000162
748 Ga0068858_100014629
749 Ga0068858_100688672
750 Ga0068860_100739077
751 Ga0081455_10151371
752 Ga0081540_1001602
753 Ga0081539_10000094
754 Ga0070717_10001045
755 Ga0070717_10202547
756 Ga0070717_10487408
757 Ga0070717_10666486
758 Ga0070715_10016655
759 Ga0070715_10023955
760 Ga0070715_10029962
761 Ga0070715_10132352
762 Ga0070716_100000228
763 Ga0070716_100016649
764 Ga0070716_100070981
765 Ga0070712_100000806
766 Ga0070712_100091120
767 Ga0070712_100159961
768 Ga0097621_100078852
769 Ga0097621_100137047
770 Ga0068871_100066456
771 Ga0068871_100514888
772 Ga0075428_100000146
773 Ga0075428_100003404
774 Ga0075428_101150534
775 Ga0075428_101359110
776 Ga0075430_100022640
777 Ga0075430_100073708
778 Ga0075430_100230150
779 Ga0075430_100296652
780 Ga0075431_100041914
781 Ga0075431_100667650
782 Ga0075433_10064694
783 Ga0075433_10248655
784 Ga0075434_100157738
785 Ga0075434_100502745
786 Ga0075429_100079301
787 Ga0075429_100277542
788 Ga0075429_100405785
789 Ga0075436_100024374
790 Ga0075436_100152670
791 Ga0097620_100318054
792 Ga0097620_101080401
793 Ga0075435_100038617
794 Ga0075435_100108921
795 Ga0075435_100141630
796 Ga0111539_10865099
797 Ga0105245_10064096
798 Ga0105247_10047754
799 Ga0114129_10000001
800 Ga0114129_10000011
801 Ga0114129_10069528
802 Ga0114129_10677570
803 Ga0114129_10844865
804 Ga0114129_11370159
805 Ga0105248_10019803
806 Ga0105248_10367580
807 Ga0105248_10367615
808 Ga0105237_10083878
809 Ga0105237_10265186
810 Ga0105238_10895405
811 Ga0105249_10326631
812 Ga0105033_100674
813 Ga0105239_10031831
814 Ga0157370_10023102
815 Ga0157369_10167790
816 Ga0157369_10951416
817 Ga0157374_10037062
818 Ga0157378_10836312
819 Ga0157372_10623396
820 Ga0157375_10006335
821 Ga0163163_10002415
822 Ga0163163_10248056
823 Ga0163163_10928914
824 Ga0163163_11488953
825 Ga0157379_10011375
826 Ga0157379_10036481
827 Ga0157379_10728181
828 Ga0157376_10044896
829 Ga0157376_10371964
830 Ga0206356_11868067
831 Ga0206354_11545539
832 Ga0206353_11068033
833 Ga0207692_10000173
834 Ga0207692_10005997
835 Ga0207692_10030743
836 Ga0207685_10000968
837 Ga0207685_10009701
838 Ga0207685_10013171
839 Ga0207699_10000599
840 Ga0207699_10006578
841 Ga0207699_10027353
842 Ga0207699_10097297
843 Ga0207699_10150081
844 Ga0207684_10355006
845 Ga0207671_10152918
846 Ga0207693_10026181
847 Ga0207693_10133049
848 Ga0207663_10001386
849 Ga0207663_10019456
850 Ga0207663_10085721
851 Ga0207660_10640578
852 Ga0207657_10142011
853 Ga0207649_10259544
854 Ga0207646_10053036
855 Ga0207646_10144124
856 Ga0207646_10447323
857 Ga0207694_10203125
858 Ga0207687_10037126
859 Ga0207700_10000291
860 Ga0207700_10038685
861 Ga0207700_10086925
862 Ga0207700_10119189
863 Ga0207700_10163164
864 Ga0207700_10165112
865 Ga0207700_10192123
866 Ga0207664_10000163
867 Ga0207664_10010303
868 Ga0207664_10063822
869 Ga0207664_10084764
870 Ga0207664_10087355
871 Ga0207664_10369890
872 Ga0207644_10050719
873 Ga0207706_10211734
874 Ga0207665_10002219
875 Ga0207665_10018028
876 Ga0207665_10111789
877 Ga0207711_10072171
878 Ga0207711_10967615
879 Ga0207689_10358383
880 Ga0207661_10003454
881 Ga0207661_10454469
882 Ga0207667_10680923
883 Ga0207651_10700773
884 Ga0207677_10025587
885 Ga0207677_10527316
886 Ga0207703_10030538
887 Ga0207639_11324188
888 Ga0207641_10036856
889 Ga0207641_10056043
890 Ga0207641_10307646
891 Ga0207676_10037717
892 Ga0207676_10076788
893 Ga0207676_10817101
894 Ga0207674_10175407
895 Ga0207674_10181870
896 Ga0207674_10267481
897 Ga0207675_100250311
898 Ga0207683_10507306
899 Ga0268266_10210875
900 Ga0268266_10539001
901 Ga0268266_10592755
902 Ga0307515_10512297
903 Ga0307511_10001096
904 Ga0265328_10023968
905 Ga0307513_10017027
906 Ga0307509_10654066
907 Ga0307408_100217280
908 Ga0307408_100918478
909 Ga0307408_100922168
910 Ga0307508_10385657
911 Ga0307405_10009164
912 Ga0307413_10011456
913 Ga0307413_10129253
914 Ga0307410_10041833
915 Ga0307410_10182011
916 Ga0307406_10009812
917 Ga0307407_10071498
918 Ga0307409_100000720
919 Ga0307409_100067501
920 Ga0307409_100088890
921 Ga0307409_100731528
922 Ga0307416_100005756
923 Ga0307416_100085652
924 Ga0307416_100156989
925 Ga0307416_100302322
926 Ga0307416_101867449
927 Ga0307414_10085290
928 Ga0307414_10356979
929 Ga0307411_10173204
930 Ga0307411_10698762
931 Ga0307415_100000028
932 Ga0307415_100006943
933 Ga0307415_100015934
934 Ga0307415_100032012
935 Ga0307415_100100304
936 Ga0307415_100131981
937 Ga0307415_100258175
938 Ga0307415_101181367
939 Ga0373950_0010781
940 Ga0373926_0148335
941 Ga0373934_0000431
942 Ga0373940_0016429
943 Ga0373944_0021653
944 Ga0373949_0013637
945 Ga0373923_0003717
946 Ga0373923_0021724
947 Ga0373923_0386227
948 Ga0373932_0029481
949 Ga0373936_0135319
950 Ga0373939_0228886
951 Ga0373941_0232994
952 Ga0373945_0078614
953 Ga0373953_0000076
954 Ga0373953_0021104
955 Ga0373954_0000183
956 Ga0373956_0003835
957 Ga0373956_0011807
958 Ga0373956_0050282
959 Ga0373957_0000477
960 Ga0373957_0056173
961 Ga0373957_0139735
962 Ga0373960_0019786
963 Ga0373943_0075120
964 Ga0373943_0149475
965 Ga0373943_0201573
966 Ga0373946_0046295
967 Ga0373946_0294954
968 Ga0373955_0000126
969 Ga0373955_0003574
970 Ga0373955_0110120
971 Ga0373955_0181073
972 Ga0373955_0210763
973 Ga0373961_0012709
974 Ga0373924_0000152
975 Ga0373924_0082434
976 Ga0373931_0032301
977 Ga0373931_0234236
978 Ga0373935_0228997
979 Ga0373927_0099969
980 Ga0373927_0274277
981 Ga0373927_0275342
982 Ga0373927_0285678
983 Ga0373927_0403146
984 Ga0373933_0000098
985 Ga0373933_0017258
986 Ga0373933_0038002
987 Ga0373933_0039245
988 Ga0373933_0243575
989 Ga0373947_0055002
990 Ga0373947_0086216
991 Ga0373947_0265571
992 Ga0373947_0268996
993 Ga0373947_0349916
994 Ga0373937_0000067
995 Ga0373937_0002213
996 Ga0373937_0127654
997 Ga0373937_0245184
998 Ga0373937_0364114
999 Ga0373925_0002689
1000 Ga0373925_0124747
1001 Ga0373925_0144563
1002 Ga0373925_0341704
1003 Ga0373925_0537910
1004 Ga0395899_0127904
1005 Ga0395900_0189737
1006 Ga0395905_0120387
1007 Ga0395901_0084120
1008 Ga0466966_0043985
1009 Ga0466966_0048800
1010 Ga0466963_0041640
1011 Ga0466963_0160891
1012 Ga0466963_0268111
1013 Ga0466963_0620195
1014 Ga0466971_0055441
1015 Ga0466971_0169308
1016 Ga0466971_0174757
1017 Ga0466970_0046538
1018 Ga0466957_0046982
1019 Ga0466957_0269576
1020 Ga0466960_0002582
1021 Ga0466960_0030268
1022 Ga0466960_0076368
1023 Ga0466959_0073935
1024 Ga0466959_0077572
1025 Ga0466959_0654047
1026 Ga0466958_0059860
1027 Ga0466958_0173126
1028 Ga0466967_0036423
1029 Ga0466967_0098380
1030 Ga0466967_0169865
1031 Ga0466967_0182203
1032 Ga0495592_0000069
1033 Ga0495592_0038355
1034 Ga0495592_0121146
1035 Ga0495592_0134042
1036 Ga0495592_0249686
1037 Ga0495603_0166170
1038 Ga0495629_0027992
1039 Ga0495629_0029747
1040 Ga0495629_0048759
1041 Ga0495641_0021999
1042 Ga0495651_0000016
1043 Ga0495651_0015500
1044 Ga0495651_0016791
1045 Ga0495651_0031123
1046 Ga0495651_0074885
1047 Ga0495653_0000770
1048 Ga0495653_0006893
1049 Ga0495653_0031473
1050 Ga0495653_0042511
1051 Ga0495653_0050683
1052 Ga0495653_0142410
1053 Ga0495580_0184033
1054 Ga0495582_0035278
1055 Ga0495582_0158941
1056 Ga0495639_0060985
1057 Ga0495639_0134458
1058 Ga0495639_0203311
1059 Ga0495662_0147747
1060 Ga0495664_0234079
1061 Ga0495594_0086486
1062 Ga0495594_0120813
1063 Ga0495606_0002664
1064 Ga0495608_0000051
1065 Ga0495608_0022256
1066 Ga0495608_0049279
1067 Ga0495608_0059769
1068 Ga0495608_0134080
1069 Ga0495618_0051598
1070 Ga0495618_0117936
1071 Ga0495618_0176037
1072 Ga0495618_0189784
1073 Ga0495628_0000126
1074 Ga0495628_0042496
1075 Ga0495628_0087031
1076 Ga0495628_0205867
1077 Ga0495628_0233451
1078 Ga0495630_0146117
1079 Ga0495630_0176091
1080 Ga0495630_0229677
1081 Ga0495630_0949271
1082 Ga0495666_0023838
1083 Ga0495652_0000761
1084 Ga0495652_0011175
1085 Ga0495652_0034221
1086 Ga0495652_0061916
1087 Ga0495652_0097293
1088 Ga0495652_0126532
1089 Ga0495665_0006251
1090 Ga0495640_0027840
1091 Ga0495640_0046622
1092 Ga0495640_0071142
1093 Ga0495640_0155722
1094 Ga0495587_0000058
1095 Ga0495587_0008337
1096 Ga0495587_0008404
1097 Ga0495587_0136246
1098 Ga0495645_0114901
1099 Ga0495645_0262233
1100 Ga0495645_0275938
1101 Ga0495667_0000062
1102 Ga0495667_0007401
1103 Ga0495667_0031698
1104 Ga0495667_0075543
1105 Ga0495667_0161462
1106 Ga0495667_0194738
1107 Ga0495656_0000003
1108 Ga0495668_0000169
1109 Ga0495634_0110389
1110 Ga0495625_0002610
1111 Ga0495635_0007102
1112 Ga0495635_0034060
1113 Ga0495635_0148785
1114 Ga0495635_0204717
1115 Ga0495635_0249950
1116 Ga0495635_0737650
1117 Ga0495657_0000065
1118 Ga0495657_0016187
1119 Ga0495657_0031558
1120 Ga0495657_0055641
1121 Ga0495657_0085761
1122 Ga0495599_0000045
1123 Ga0495599_0019207
1124 Ga0495599_0063783
1125 Ga0495599_0073153
1126 Ga0495599_0177740
1127 Ga0495599_0238766
1128 Ga0495599_0239379
1129 Ga0495599_0304698
1130 Ga0495623_0000787
1131 Ga0495623_0065263
1132 Ga0495623_0199742
1133 Ga0495623_0215720
1134 Ga0495646_0001648
1135 Ga0495646_0015988
1136 Ga0495646_0108257
1137 Ga0495647_0059685
1138 Ga0495658_0022001
1139 Ga0495613_0058274
1140 Ga0495624_0026084
1141 Ga0495600_0000392
1142 Ga0495600_0000536
1143 Ga0495600_0009392
1144 Ga0495600_0021271
1145 Ga0495600_0200277
1146 Ga0495581_0044328
1147 Ga0495581_0094758
1148 Ga0495581_0136741
1149 Ga0495604_0001132
1150 Ga0495604_0011978
1151 Ga0495604_0042273
1152 Ga0495604_0080949
1153 Ga0495674_0003461
1154 Ga0495674_0020554
1155 Ga0495674_0479761
1156 Ga0495676_0089261
1157 Ga0495676_0128071
1158 Ga0495676_0323017
1159 Ga0495680_0000444
1160 Ga0495680_0009939
1161 Ga0495680_0014777
1162 Ga0495680_0044853
1163 Ga0495680_0089235
1164 Ga0495680_0388956
1165 Ga0495675_0000655
1166 Ga0495675_0027125
1167 Ga0495675_0263647
1168 Ga0495684_0016089
1169 Ga0495684_0126830
1170 Ga0495684_0173978
1171 Ga0495684_0183504
1172 Ga0495593_0033130
1173 Ga0495593_0052646
1174 Ga0495593_0092971
1175 Ga0495602_0000079
1176 Ga0495602_0015074
1177 Ga0495602_0031285
1178 Ga0495602_0067906
1179 Ga0495602_0420883
1180 Ga0495614_0095281
1181 Ga0495626_0001289
1182 Ga0496100_0086861
1183 Ga0496100_0174476
1184 Ga0496100_0718489
1185 Ga0496101_0033113
1186 Ga0496101_0051792
1187 Ga0496101_0091658
1188 Ga0496102_0281312
1189 Ga0496102_0317841
1190 Ga0496104_0004947
1191 Ga0496104_0033822
1192 Ga0496104_0172964
1193 Ga0496104_1121969
1194 Ga0496105_0003955
1195 Ga0496105_0046017
1196 Ga0496105_0051325
1197 Ga0496105_0137255
1198 Ga0496105_0617763
1199 Ga0496106_0150699
1200 Ga0496107_0067578
1201 Ga0496107_0283388
1202 Ga0496107_0398277
1203 Ga0496108_0018925
1204 Ga0496108_0081860
1205 Ga0496108_0103055
1206 Ga0496108_0156604
1207 Ga0496109_0021476
1208 Ga0496109_0023161
1209 Ga0496109_0023373
1210 Ga0496109_0324190
1211 Ga0496110_0006369
1212 Ga0496110_0012238
1213 Ga0496111_0004057
1214 Ga0496111_0046094
1215 Ga0496111_0381225
1216 Ga0496112_0016556
1217 Ga0496112_0033642
1218 Ga0496112_0073675
1219 Ga0496112_0147889
1220 Ga0496112_1266003
1221 Ga0496113_0004227
1222 Ga0496113_0023091
1223 Ga0496113_0141905
1224 Ga0496113_0240606
1225 Ga0496113_0406359
1226 Ga0496114_0630977
1227 Ga0496115_0013595
1228 Ga0496115_0835469
1229 Ga0496124_0069956
1230 Ga0501321_038048
1231 Ga0501034_0218083
1232 Ga0501034_0800466
1233 Ga0501047_0073015
1234 nmdc:mga05p37_1057_c1
1235 nmdc:mga05p37_1964_c1
1236 nmdc:mga05p37_738684_c1
1237 nmdc:mga05p37_889982_c1
1238 nmdc:mga05p37_943731_c1
1239 nmdc:mga09592_16_c1
1240 nmdc:mga09592_203853_c1
1241 nmdc:mga09592_376345_c1
1242 nmdc:mga0qj67_101449_c1
1243 nmdc:mga0qj67_16_c1
1244 nmdc:mga0qj67_289679_c1
1245 nmdc:mga0qj67_44019_c1
1246 nmdc:mga06r32_1454616_c1
1247 nmdc:mga06r32_151796_c1
1248 nmdc:mga06r32_38_c3
1249 nmdc:mga0n895_549158_c1
1250 nmdc:mga0n895_741144_c1
1251 nmdc:mga0rr50_2905_c1
1252 nmdc:mga08x19_255951_c1
1253 nmdc:mga0a205_151447_c1
1254 nmdc:mga0a205_3075_c1
1255 Ga0495601_0103263
1256 Ga0495612_0023438
1257 Ga0495612_0063212
1258 Ga0495612_0277085
1259 Ga0495595_0011520
1260 Ga0495619_0005317
1261 Ga0495619_0172606
1262 Ga0495619_0279603
1263 Ga0495619_0290097
1264 Ga0500646_0000285
1265 Ga0500654_115529
1266 Ga0500588_0012090
1267 Ga0466962_0010199
1268 Ga0466962_0044127
1269 Ga0466962_0088522
1270 Ga0466962_0168708
1271 2516085583
1272 2623586500
1273 2643765656
1274 2644459768
1275 2676481483
1276 2739603902
1277 2772641729
1278 2774901375
1279 2817509634
1280 2831940401
1281 2832007827
1282 2855672284
1283 2855678925
1284 2857289997
1285 2857712163
1286 2857729601
1287 2858849829
1288 2858872494
1289 2858888592
1290 2858890700
1291 2858898618
1292 2858908744
1293 2861524878
1294 2866066488
1295 2867303877
1296 2867313281
1297 2867325722
1298 2867371688
1299 2869054088
1300 2869068531
1301 2869072863
1302 2880493690
1303 2880498633
1304 2887483757
1305 2902586319
1306 2929220630
1307 2929227211
1308 2996227288
1309 3003005151
1310 3006427071
1311 8001782458
1312 8003835046
1313 8003872390
1314 8025479134
1315 8053946175
1316 8054564244
1317 8054708144
1318 8054730932
1319 8054735063
1320 8055412924
1321 8056062553
1322 8056450376
1323 8056669395
1324 8057569885

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

35

225

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.983 1 190
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9787 1 182
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9743 5 188
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9733 1 182
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9627 1 190
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9663 66 191 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9575 3 176 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9511 3 179 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9477 4 194 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9415 5 197 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A4R4QPQ6-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9964 5 192 GO:0004045
GO:0005737
GO:0006412
AF-A0A7D4PRE4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9955 2 180 GO:0004045
GO:0005737
GO:0006412
AF-A0A560AY05-F1-model_v4 deleted 0.9942 2 191
AF-A0A2M9BG41-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9938 3 191 GO:0004045
GO:0005737
GO:0006412
AF-A0A840NAM4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9933 3 190 GO:0004045
GO:0005737
GO:0006412

Map