F473479

General Info

Members Datasets Scaffolds Average Seq Length
662 451 405 144

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10030578|Ga0213872_100305785
Length 170
Sequence MMTRYADPRHLAHEEIIANAMVDVATELRLADLSELVALIRSEQAANIADLVNSSSELFFRCGTLRYALSAAFDFQWESAPTVRLDMEFRNGAVCAFFGLVIGRKRAAVQVAKILFDDEPLDDAEKTQRLLSAIAEARLQPLGRSRGDAFDRIERLAGHTWRKPGASPAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
14 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
15 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
16 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
17 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
18 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
19 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
20 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
21 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
22 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
23 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
24 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2738543024 Aminobacter sp. AP02 Isolate Unclassified
26 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
27 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
28 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
29 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
30 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
31 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
32 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
33 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
34 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
35 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
36 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
37 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
38 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
39 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
40 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
41 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
42 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
43 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
44 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
45 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
46 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
47 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
48 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
49 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
50 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
51 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
52 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
53 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
54 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
55 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
56 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
57 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
58 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
59 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
60 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
61 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
62 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
63 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
64 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
65 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
66 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
67 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
68 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
69 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
70 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
71 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
72 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
73 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
74 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
75 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
76 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
77 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
78 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
79 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
80 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
81 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
82 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
83 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
84 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
85 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
86 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
87 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
88 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
89 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
90 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
91 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
92 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
93 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
94 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
95 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
96 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
97 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
98 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
99 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
100 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
101 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
102 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
103 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
104 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
105 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
106 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
107 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
108 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
109 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
110 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
111 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
112 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
113 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
114 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
115 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
116 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
117 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
118 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
119 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
120 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
121 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
122 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
123 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
124 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
125 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
126 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
127 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
128 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
129 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
130 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
131 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
132 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
133 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
134 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
135 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
136 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
137 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
138 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
139 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
140 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
141 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
142 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
143 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
144 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
145 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
146 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
147 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
148 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
149 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
150 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
151 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
152 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
153 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
154 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
155 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
156 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
157 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
158 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
159 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
160 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
161 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
162 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
163 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
164 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
165 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
166 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
167 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
168 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
169 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
170 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
171 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
172 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
173 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
174 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
175 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
176 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
177 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
178 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
179 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
180 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
181 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
182 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
183 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
184 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
185 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
186 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
187 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
188 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
189 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
190 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
191 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
192 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
193 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
194 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
195 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
196 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
197 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
198 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
199 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
200 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
201 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
202 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
203 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
204 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
205 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
206 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
207 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
208 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
209 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
210 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
211 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
212 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
213 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
214 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
215 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
216 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
217 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
218 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
219 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
220 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
221 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
222 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
223 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
224 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
225 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
226 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
227 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
228 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
229 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
230 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
231 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
232 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
233 3004167301 Mesorhizobium loti 582 Isolate Unclassified
234 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
235 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
236 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
237 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
238 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
239 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
240 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
241 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
242 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
243 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
244 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
245 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
246 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
247 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
248 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
249 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
250 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
251 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
252 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
253 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
254 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
255 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
256 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
257 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
258 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
259 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
260 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
261 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
262 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
263 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
264 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
265 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
266 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
267 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
268 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
269 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
270 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
271 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
272 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
273 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
274 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
275 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
276 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
277 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
278 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
279 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
280 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
281 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
282 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
283 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
284 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
285 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
286 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
287 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
288 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
289 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
290 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
291 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
292 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
293 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
294 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
295 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
296 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
297 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
298 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
299 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
300 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
302 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
303 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
305 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
333 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
336 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
337 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
338 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
339 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
340 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
341 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
342 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
343 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
344 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
345 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
346 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
347 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
348 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
349 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
350 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
351 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
352 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
353 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
354 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
355 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
356 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
357 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
358 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
359 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
360 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
363 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
364 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
370 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
371 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
413 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
414 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
415 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
416 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
420 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
427 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
428 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
429 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
430 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
431 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
432 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
437 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
438 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
441 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
442 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
443 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
444 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
445 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
446 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
447 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
448 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
449 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
450 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
451 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.18
Metatranscriptomes 0
Isolates 38.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 33.69
Rhizoplane 2.87
Rhizosphere 46.68
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017014 3300001979 Bacteria 2611
2 JGI25165J46597_1000042 3300003214 Bacteria 271606
3 rootL2_10197691 3300003322 Bacteria 1292
4 Ga0055542_1000337 3300003762 Bacteria 50039
5 Ga0055529_1002099 3300003763 Bacteria 4257
6 Ga0070658_10056630 3300005327 Bacteria 3187
7 Ga0070660_100120235 3300005339 Unclassified 2096
8 Ga0070660_100851998 3300005339 Bacteria 767
9 Ga0070661_100639665 3300005344 Bacteria 863
10 Ga0070674_100303075 3300005356 Bacteria 1274
11 Ga0070674_101571677 3300005356 Bacteria 592
12 Ga0070667_100731193 3300005367 Bacteria 917
13 Ga0070663_100055541 3300005455 Bacteria 2835
14 Ga0070678_101773709 3300005456 Bacteria 581
15 Ga0070678_102096727 3300005456 Bacteria 536
16 Ga0070662_100805505 3300005457 Bacteria 799
17 Ga0068867_100120280 3300005459 Bacteria 2029
18 Ga0068853_100095026 3300005539 Bacteria 2627
19 Ga0068853_100204578 3300005539 Bacteria 1797
20 Ga0068853_100781203 3300005539 Bacteria 914
21 Ga0070665_100020512 3300005548 Bacteria 6638
22 Ga0070665_100373209 3300005548 Bacteria 1433
23 Ga0070704_101504430 3300005549 Bacteria 619
24 Ga0068855_100800996 3300005563 Bacteria 1001
25 Ga0068857_100065733 3300005577 Bacteria 3226
26 Ga0068857_100250044 3300005577 Bacteria 1625
27 Ga0068854_100112979 3300005578 Bacteria 2051
28 Ga0068854_101283998 3300005578 Bacteria 658
29 Ga0068856_100354265 3300005614 Bacteria 1486
30 Ga0068852_100355992 3300005616 Bacteria 1431
31 Ga0075365_10006675 3300006038 Bacteria 6375
32 Ga0075365_10007215 3300006038 Bacteria 6209
33 Ga0075365_10053488 3300006038 Bacteria 2674
34 Ga0075365_10061131 3300006038 Bacteria 2515
35 Ga0075365_10318811 3300006038 Bacteria 1095
36 Ga0075368_10053131 3300006042 Bacteria 1612
37 Ga0075368_10143577 3300006042 Bacteria 995
38 Ga0075363_100023691 3300006048 Bacteria 3114
39 Ga0075363_100184628 3300006048 Bacteria 1188
40 Ga0075364_10063305 3300006051 Bacteria 2428
41 Ga0075364_10071412 3300006051 Bacteria 2287
42 Ga0075364_10369227 3300006051 Bacteria 978
43 Ga0070716_100722743 3300006173 Unclassified 763
44 Ga0075362_10018384 3300006177 Bacteria 2891
45 Ga0075362_10035102 3300006177 Bacteria 2188
46 Ga0075362_10199916 3300006177 Bacteria 973
47 Ga0075367_10026956 3300006178 Bacteria 3264
48 Ga0075367_10122896 3300006178 Bacteria 1600
49 Ga0075367_10163518 3300006178 Bacteria 1384
50 Ga0075367_10350634 3300006178 Bacteria 931
51 Ga0075367_10584619 3300006178 Bacteria 709
52 Ga0075369_10054573 3300006186 Bacteria 1735
53 Ga0075369_10203743 3300006186 Bacteria 913
54 Ga0075366_10273036 3300006195 Bacteria 1033
55 Ga0075370_10033211 3300006353 Bacteria 2888
56 Ga0068865_100813886 3300006881 Bacteria 807
57 Ga0105240_10052161 3300009093 Bacteria 5143
58 Ga0105240_10100603 3300009093 Bacteria 3517
59 Ga0105240_10235453 3300009093 Bacteria 2125
60 Ga0105240_10533814 3300009093 Bacteria 1300
61 Ga0105240_11180908 3300009093 Bacteria 811
62 Ga0105240_11357835 3300009093 Bacteria 748
63 Ga0105240_11875839 3300009093 Bacteria 624
64 Ga0105245_10725350 3300009098 Bacteria 1028
65 Ga0105243_11301925 3300009148 Bacteria 744
66 Ga0105241_10054943 3300009174 Bacteria 3050
67 Ga0105248_10079642 3300009177 Bacteria 3682
68 Ga0105237_10405062 3300009545 Bacteria 1369
69 Ga0105237_11630180 3300009545 Bacteria 652
70 Ga0105238_10033517 3300009551 Bacteria 5227
71 Ga0105238_10054721 3300009551 Bacteria 4007
72 Ga0105238_11586590 3300009551 Bacteria 684
73 Ga0105238_11955899 3300009551 Bacteria 620
74 Ga0105238_12164644 3300009551 Bacteria 591
75 Ga0105249_10456832 3300009553 Bacteria 1317
76 Ga0105239_10237791 3300010375 Unclassified 2044
77 Ga0105239_10694284 3300010375 Bacteria 1163
78 Ga0105239_11038084 3300010375 Bacteria 943
79 Ga0105239_11110761 3300010375 Bacteria 910
80 Ga0157371_10533240 3300013102 Bacteria 869
81 Ga0157370_10245507 3300013104 Bacteria 1656
82 Ga0157370_10366886 3300013104 Bacteria 1327
83 Ga0157369_10025374 3300013105 Bacteria 6579
84 Ga0157369_10698446 3300013105 Unclassified 1045
85 Ga0157378_10498618 3300013297 Bacteria 1216
86 Ga0157378_10717849 3300013297 Bacteria 1020
87 Ga0163162_11233921 3300013306 Bacteria 849
88 Ga0157372_10277255 3300013307 Bacteria 1949
89 Ga0157372_11288982 3300013307 Bacteria 843
90 Ga0157372_11573882 3300013307 Bacteria 757
91 Ga0157372_12884633 3300013307 Unclassified 551
92 Ga0157375_10613867 3300013308 Bacteria 1246
93 Ga0157375_12907536 3300013308 Bacteria 572
94 Ga0182008_10095358 3300014497 Bacteria 1468
95 Ga0182006_1064211 3300015261 Bacteria 1377
96 Ga0182005_1014315 3300015265 Bacteria 2220
97 Ga0163161_10616612 3300017792 Bacteria 896
98 Ga0213872_10030578 3300021361 Bacteria 2468
99 Ga0213876_10077685 3300021384 Bacteria 1753
100 Ga0209026_1000029 3300025250 Bacteria 337109
101 Ga0209148_1000080 3300025254 Bacteria 277806
102 Ga0209759_1000040 3300025256 Bacteria 254501
103 Ga0209759_1050001 3300025256 Bacteria 651
104 Ga0209233_1000028 3300025261 Bacteria 642062
105 Ga0209233_1095943 3300025261 Bacteria 501
106 Ga0209455_1000239 3300025272 Bacteria 68601
107 Ga0209758_1024974 3300025297 Bacteria 2641
108 Ga0207688_10368233 3300025901 Bacteria 888
109 Ga0207647_10000898 3300025904 Bacteria 23040
110 Ga0207647_10182518 3300025904 Bacteria 1218
111 Ga0207645_10094671 3300025907 Bacteria 1923
112 Ga0207705_10137232 3300025909 Unclassified 1824
113 Ga0207705_10748219 3300025909 Bacteria 759
114 Ga0207654_10076831 3300025911 Bacteria 2000
115 Ga0207707_10823678 3300025912 Bacteria 772
116 Ga0207695_10234005 3300025913 Bacteria 1740
117 Ga0207695_10351691 3300025913 Bacteria 1361
118 Ga0207695_10389783 3300025913 Bacteria 1278
119 Ga0207695_11310149 3300025913 Unclassified 605
120 Ga0207671_10111742 3300025914 Bacteria 2079
121 Ga0207671_10123146 3300025914 Bacteria 1983
122 Ga0207671_10141504 3300025914 Bacteria 1854
123 Ga0207657_10113814 3300025919 Bacteria 2232
124 Ga0207657_10153129 3300025919 Bacteria 1877
125 Ga0207649_10873721 3300025920 Bacteria 704
126 Ga0207694_10453624 3300025924 Bacteria 1070
127 Ga0207694_10546943 3300025924 Unclassified 971
128 Ga0207690_10301427 3300025932 Bacteria 1254
129 Ga0207706_10513379 3300025933 Bacteria 1034
130 Ga0207709_10372481 3300025935 Bacteria 1084
131 Ga0207669_10738425 3300025937 Bacteria 812
132 Ga0207711_10972287 3300025941 Bacteria 788
133 Ga0207679_10332298 3300025945 Bacteria 1319
134 Ga0207667_10476858 3300025949 Bacteria 1267
135 Ga0207712_10485560 3300025961 Bacteria 1054
136 Ga0207668_10783772 3300025972 Bacteria 843
137 Ga0207658_10901982 3300025986 Bacteria 805
138 Ga0207677_10535354 3300026023 Bacteria 1018
139 Ga0207639_10019956 3300026041 Bacteria 4790
140 Ga0207639_10804845 3300026041 Bacteria 876
141 Ga0207639_12165594 3300026041 Bacteria 517
142 Ga0207678_10028677 3300026067 Bacteria 4858
143 Ga0207678_10225549 3300026067 Bacteria 1604
144 Ga0207678_10526647 3300026067 Bacteria 1032
145 Ga0207702_10459900 3300026078 Bacteria 1236
146 Ga0207648_10652351 3300026089 Bacteria 973
147 Ga0207648_10936105 3300026089 Bacteria 810
148 Ga0207674_10219181 3300026116 Bacteria 1851
149 Ga0207674_10335070 3300026116 Bacteria 1463
150 Ga0209813_10008953 3300027866 Bacteria 2545
151 Ga0268266_10024991 3300028379 Bacteria 5084
152 Ga0268266_10296585 3300028379 Bacteria 1507
153 Ga0268266_11199684 3300028379 Bacteria 734
154 Ga0268264_11638593 3300028381 Unclassified 654
155 Ga0307517_10261356 3300028786 Bacteria 1005
156 Ga0307515_10501689 3300028794 Bacteria 824
157 Ga0307408_101306557 3300031548 Bacteria 680
158 Ga0307405_11176431 3300031731 Bacteria 662
159 Ga0307410_10961591 3300031852 Bacteria 735
160 Ga0307416_101500952 3300032002 Bacteria 780
161 Ga0307415_100703283 3300032126 Bacteria 912
162 Ga0373935_0537437 3300035692 Bacteria 851
163 Ga0395899_0074339 3300037312 Bacteria 2483
164 Ga0395899_0381126 3300037312 Bacteria 937
165 Ga0395899_0784289 3300037312 Bacteria 590
166 Ga0395900_0000042 3300037418 Bacteria 242667
167 Ga0395900_0067751 3300037418 Bacteria 3667
168 Ga0395900_0134575 3300037418 Bacteria 2532
169 Ga0395900_0209947 3300037418 Bacteria 1966
170 Ga0395900_0459661 3300037418 Bacteria 1228
171 Ga0395900_0521811 3300037418 Bacteria 1136
172 Ga0395898_0000080 3300037466 Bacteria 242667
173 Ga0395898_0071353 3300037466 Bacteria 3356
174 Ga0395898_0100416 3300037466 Bacteria 2779
175 Ga0395898_0448174 3300037466 Bacteria 1229
176 Ga0395905_0000044 3300037471 Bacteria 242916
177 Ga0395905_0025968 3300037471 Bacteria 5522
178 Ga0395905_0170820 3300037471 Bacteria 2042
179 Ga0395905_0237623 3300037471 Bacteria 1703
180 Ga0395905_0571850 3300037471 Bacteria 1031
181 Ga0395905_1002028 3300037471 Bacteria 738
182 Ga0395905_1399582 3300037471 Bacteria 603
183 Ga0395901_0000027 3300038443 Bacteria 244204
184 Ga0395901_0016852 3300038443 Bacteria 7446
185 Ga0395901_0070966 3300038443 Bacteria 3629
186 Ga0395901_0802578 3300038443 Bacteria 930
187 Ga0395901_0909233 3300038443 Bacteria 861
188 Ga0395901_1012430 3300038443 Bacteria 806
189 Ga0436365_0670560 3300039437 Bacteria 2883
190 Ga0436360_0252935 3300039438 Unclassified 1473
191 Ga0436360_1116737 3300039438 Bacteria 4174
192 Ga0436360_1227354 3300039438 Bacteria 4770
193 Ga0436361_0405020 3300039447 Bacteria 1625
194 Ga0436361_0417337 3300039447 Bacteria 846
195 Ga0436361_0440717 3300039447 Unclassified 730
196 Ga0436361_1041899 3300039447 Bacteria 8455
197 Ga0436362_0008493 3300039453 Unclassified 632
198 Ga0436362_0703424 3300039453 Bacteria 3665
199 Ga0436362_1151281 3300039453 Bacteria 653
200 Ga0439465_0067865 3300041413 Bacteria 1191
201 Ga0451789_0670054 3300041443 Bacteria 690
202 Ga0451791_0521251 3300041451 Bacteria 590
203 Ga0451841_1448958 3300041498 Bacteria 845
204 Ga0451843_1299145 3300041509 Bacteria 958
205 Ga0466972_0081604 3300044658 Bacteria 1539
206 Ga0466972_0084075 3300044658 Bacteria 1513
207 Ga0466960_0103944 3300044901 Bacteria 1467
208 Ga0466967_0146013 3300045976 Bacteria 2207
209 Ga0495627_079469 3300046453 Bacteria 952
210 Ga0495638_0020514 3300046460 Bacteria 4365
211 Ga0495638_0149097 3300046460 Bacteria 1358
212 Ga0495596_0063053 3300046500 Bacteria 1442
213 Ga0495620_0155063 3300046515 Bacteria 891
214 Ga0495643_0027101 3300046522 Bacteria 3224
215 Ga0495648_0263760 3300046524 Bacteria 825
216 Ga0495597_0091470 3300046542 Bacteria 1291
217 Ga0495668_0480587 3300046616 Bacteria 684
218 Ga0495625_0136982 3300046660 Bacteria 1654
219 Ga0495661_0074718 3300046665 Bacteria 1972
220 Ga0495671_0237529 3300046692 Bacteria 881
221 Ga0495687_036895 3300047443 Bacteria 2182
222 Ga0495681_0036625 3300047470 Bacteria 2425
223 Ga0495686_0502497 3300047472 Bacteria 638
224 Ga0495602_0230939 3300048088 Bacteria 1390
225 Ga0495626_0072888 3300048091 Bacteria 1539
226 Ga0496101_0254401 3300048904 Bacteria 1369
227 Ga0496102_0478895 3300048905 Bacteria 1166
228 Ga0496102_1309794 3300048905 Bacteria 643
229 Ga0496104_0061462 3300048907 Unclassified 3562
230 Ga0496104_0247446 3300048907 Bacteria 1696
231 Ga0496105_0135868 3300048908 Unclassified 2026
232 Ga0496105_0150957 3300048908 Bacteria 1910
233 Ga0496106_0631278 3300048909 Bacteria 857
234 Ga0496107_0311062 3300048910 Bacteria 1172
235 Ga0496110_0101699 3300048913 Unclassified 2577
236 Ga0496111_0035400 3300048914 Bacteria 3568
237 Ga0496112_0508702 3300048915 Bacteria 1139
238 Ga0496114_0665698 3300048917 Bacteria 915
239 Ga0496115_0033294 3300048918 Bacteria 4068
240 Ga0496115_0622263 3300048918 Bacteria 856
241 Ga0496115_1074922 3300048918 Bacteria 611
242 Ga0496118_0055294 3300048921 Bacteria 2997
243 Ga0496118_0320634 3300048921 Bacteria 841
244 Ga0496119_0019845 3300048922 Bacteria 4928
245 Ga0496120_0000615 3300048923 Bacteria 53858
246 Ga0496121_0540067 3300048924 Bacteria 731
247 Ga0496124_0389764 3300048927 Bacteria 971
248 Ga0496126_0199740 3300048929 Bacteria 1689
249 Ga0496126_0294869 3300048929 Bacteria 1340
250 Ga0496126_0343994 3300048929 Bacteria 1221
251 Ga0496126_0426822 3300048929 Bacteria 1071
252 Ga0501031_0000007 3300049568 Bacteria 166008
253 Ga0501031_0003478 3300049568 Bacteria 10108
254 Ga0501031_0022248 3300049568 Bacteria 4131
255 Ga0501031_0376546 3300049568 Bacteria 918
256 Ga0501032_0000007 3300049569 Bacteria 253881
257 Ga0501032_0000042 3300049569 Bacteria 111875
258 Ga0501032_0002249 3300049569 Bacteria 15186
259 Ga0501032_0051489 3300049569 Bacteria 2776
260 Ga0501032_0115491 3300049569 Bacteria 1775
261 Ga0501032_0236540 3300049569 Bacteria 1187
262 Ga0501032_0461226 3300049569 Bacteria 813
263 Ga0501032_0491921 3300049569 Bacteria 784
264 Ga0501033_0000040 3300049570 Bacteria 142586
265 Ga0501033_0000153 3300049570 Bacteria 66686
266 Ga0501033_0001706 3300049570 Bacteria 19245
267 Ga0501033_0023796 3300049570 Bacteria 4620
268 Ga0501033_0043151 3300049570 Bacteria 3359
269 Ga0501033_0048312 3300049570 Bacteria 3161
270 Ga0501033_0063627 3300049570 Bacteria 2715
271 Ga0501033_1072259 3300049570 Bacteria 536
272 Ga0501034_0000029 3300049571 Bacteria 253881
273 Ga0501034_0000446 3300049571 Bacteria 68342
274 Ga0501034_0038152 3300049571 Bacteria 4865
275 Ga0501034_0126028 3300049571 Bacteria 2546
276 Ga0501036_0000004 3300049572 Bacteria 253881
277 Ga0501036_0003573 3300049572 Bacteria 12427
278 Ga0501036_0143062 3300049572 Bacteria 2017
279 Ga0501036_0217639 3300049572 Bacteria 1604
280 Ga0501036_0987196 3300049572 Bacteria 689
281 Ga0501037_0000004 3300049573 Bacteria 253989
282 Ga0501037_0000253 3300049573 Bacteria 45817
283 Ga0501037_0267513 3300049573 Bacteria 1193
284 Ga0501037_0293177 3300049573 Bacteria 1131
285 Ga0501037_0572633 3300049573 Bacteria 760
286 Ga0501038_0000005 3300049574 Bacteria 253881
287 Ga0501038_0000315 3300049574 Bacteria 41358
288 Ga0501038_0023575 3300049574 Bacteria 5499
289 Ga0501038_0055617 3300049574 Bacteria 3399
290 Ga0501038_0109664 3300049574 Bacteria 2287
291 Ga0501038_0210480 3300049574 Bacteria 1556
292 Ga0501039_0000009 3300049575 Bacteria 253881
293 Ga0501039_0000088 3300049575 Bacteria 68342
294 Ga0501039_0044629 3300049575 Bacteria 3424
295 Ga0501040_0028623 3300049576 Bacteria 3757
296 Ga0501042_0047093 3300049578 Bacteria 3074
297 Ga0501043_0000100 3300049579 Bacteria 79167
298 Ga0501043_0000595 3300049579 Bacteria 32044
299 Ga0501043_0001190 3300049579 Bacteria 22887
300 Ga0501043_0066511 3300049579 Bacteria 2831
301 Ga0501043_0175181 3300049579 Bacteria 1672
302 Ga0501043_0283835 3300049579 Bacteria 1268
303 Ga0501046_0016925 3300049580 Bacteria 6098
304 Ga0501046_0052560 3300049580 Bacteria 3211
305 Ga0501046_0059649 3300049580 Bacteria 2988
306 Ga0501046_0158486 3300049580 Bacteria 1703
307 Ga0501047_0000393 3300049581 Bacteria 49018
308 Ga0501047_0018555 3300049581 Bacteria 6670
309 Ga0501047_0056899 3300049581 Bacteria 3782
310 Ga0501047_0106859 3300049581 Bacteria 2680
311 Ga0501047_0260521 3300049581 Bacteria 1582
312 Ga0501047_0282191 3300049581 Bacteria 1505
313 Ga0501047_0736114 3300049581 Bacteria 802
314 Ga0501048_0032662 3300049582 Bacteria 3761
315 Ga0501048_0303176 3300049582 Bacteria 1137
316 Ga0501067_0021429 3300049583 Bacteria 3577
317 Ga0501067_0097282 3300049583 Bacteria 1635
318 Ga0501068_0052791 3300049584 Bacteria 2460
319 Ga0501069_0000020 3300049585 Bacteria 122595
320 Ga0501069_0013718 3300049585 Bacteria 4323
321 Ga0501069_0381434 3300049585 Bacteria 833
322 Ga0501070_0000193 3300049586 Bacteria 57357
323 Ga0501070_0009764 3300049586 Bacteria 8118
324 Ga0501070_0023176 3300049586 Bacteria 5200
325 Ga0501070_0092794 3300049586 Bacteria 2498
326 Ga0501070_0098421 3300049586 Bacteria 2419
327 Ga0501070_0101302 3300049586 Bacteria 2382
328 Ga0501070_0237097 3300049586 Bacteria 1494
329 Ga0501070_0486344 3300049586 Bacteria 992
330 Ga0501070_0736921 3300049586 Unclassified 777
331 Ga0501071_0027772 3300049587 Bacteria 3983
332 Ga0501071_0171726 3300049587 Bacteria 1623
333 Ga0501073_0153758 3300049589 Bacteria 1594
334 Ga0501073_0482926 3300049589 Bacteria 857
335 Ga0501073_0978047 3300049589 Bacteria 582
336 Ga0501074_0000063 3300049590 Bacteria 51162
337 Ga0501074_0020945 3300049590 Bacteria 4748
338 Ga0501079_0642222 3300049741 Bacteria 836
339 Ga0501080_0001750 3300049742 Bacteria 18613
340 Ga0501080_0018243 3300049742 Bacteria 6494
341 Ga0501080_0022814 3300049742 Bacteria 5800
342 Ga0501080_0208543 3300049742 Bacteria 1791
343 Ga0501080_0270006 3300049742 Bacteria 1548
344 Ga0501083_0000263 3300049744 Bacteria 33419
345 Ga0501083_0030291 3300049744 Bacteria 3718
346 Ga0501035_0000014 3300049822 Bacteria 253874
347 Ga0501035_0000070 3300049822 Bacteria 127442
348 Ga0501035_0000220 3300049822 Bacteria 68240
349 Ga0501035_0006500 3300049822 Bacteria 10983
350 Ga0501035_0007398 3300049822 Bacteria 10260
351 Ga0501035_0011331 3300049822 Bacteria 8263
352 Ga0501035_0021104 3300049822 Bacteria 5988
353 Ga0501035_0072325 3300049822 Bacteria 3052
354 Ga0501035_0097126 3300049822 Bacteria 2587
355 Ga0501035_0207133 3300049822 Unclassified 1679
356 Ga0501035_0315954 3300049822 Bacteria 1313
357 Ga0501035_0895186 3300049822 Bacteria 703
358 Ga0501044_0000012 3300049823 Bacteria 253881
359 Ga0501044_0000037 3300049823 Bacteria 161924
360 Ga0501044_0006333 3300049823 Bacteria 13086
361 Ga0501044_0007398 3300049823 Bacteria 12078
362 Ga0501044_0009272 3300049823 Bacteria 10746
363 Ga0501044_0012643 3300049823 Bacteria 9139
364 Ga0501044_0021240 3300049823 Bacteria 6930
365 Ga0501044_0077618 3300049823 Bacteria 3368
366 Ga0501044_0103649 3300049823 Bacteria 2859
367 Ga0501044_0117876 3300049823 Bacteria 2658
368 Ga0501044_0120624 3300049823 Bacteria 2623
369 Ga0501044_0601162 3300049823 Bacteria 993
370 Ga0501044_0688600 3300049823 Bacteria 908
371 Ga0501045_0040958 3300049824 Bacteria 3369
372 nmdc:mga03683_174722_c1 3300050489 Bacteria 977
373 nmdc:mga00v17_177058_c1 3300050491 Bacteria 1376
374 nmdc:mga00v17_185368_c1 3300050491 Bacteria 776
375 nmdc:mga00v17_95938_c1 3300050491 Bacteria 1867
376 nmdc:mga0yw44_101105_c1 3300050492 Bacteria 1837
377 nmdc:mga0yw44_13235_c1 3300050492 Bacteria 4336
378 nmdc:mga0yw44_157954_c1 3300050492 Bacteria 1483
379 nmdc:mga0yw44_16176_c2 3300050492 Bacteria 3646
380 nmdc:mga0yw44_496569_c1 3300050492 Bacteria 828
381 nmdc:mga06z11_117306_c1 3300050494 Bacteria 1481
382 nmdc:mga06z11_176488_c1 3300050494 Bacteria 1230
383 nmdc:mga06z11_327069_c1 3300050494 Bacteria 915
384 nmdc:mga06z11_801948_c1 3300050494 Bacteria 574
385 nmdc:mga04h51_217272_c1 3300050495 Bacteria 756
386 nmdc:mga07m45_445859_c1 3300050496 Bacteria 751
387 nmdc:mga07m45_534137_c1 3300050496 Bacteria 679
388 nmdc:mga0sz30_194579_c1 3300050516 Bacteria 900
389 nmdc:mga0sz30_78840_c1 3300050516 Bacteria 1424
390 Ga0495612_0337764 3300053078 Bacteria 679
391 Ga0500610_0161479 3300053079 Bacteria 1114
392 Ga0495655_0017250 3300053083 Bacteria 1569
393 Ga0495655_0055386 3300053083 Bacteria 1064
394 Ga0500651_0305257 3300053093 Bacteria 912
395 Ga0500592_033587 3300053116 Bacteria 828
396 Ga0500595_054366 3300053119 Bacteria 1229
397 Ga0500568_0000057 3300053139 Bacteria 109287
398 Ga0500568_0087590 3300053139 Bacteria 1177
399 Ga0500604_0038405 3300053151 Bacteria 1436
400 Ga0500616_0009586 3300053153 Bacteria 5877
401 Ga0500620_000902 3300053155 Bacteria 5155
402 Ga0500627_0234165 3300053158 Bacteria 816
403 Ga0501084_0119418 3300054114 Bacteria 2216
404 Ga0501082_0090998 3300060353 Bacteria 2634
405 Ga0501082_0266068 3300060353 Bacteria 1492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10652351 Ga0207648_106523512 128
2 iso_pu_bacteria 2876369609 2876377510 129
3 iso_pu_bacteria 2979793036 2979799935 132
4 3300009093 Ga0105240_10052161 Ga0105240_100521617 134
5 3300009093 Ga0105240_10235453 Ga0105240_102354532 134
6 3300009551 Ga0105238_10033517 Ga0105238_100335172 134
7 3300010375 Ga0105239_10237791 Ga0105239_102377915 134
8 3300013105 Ga0157369_10698446 Ga0157369_106984461 134
9 3300013307 Ga0157372_12884633 Ga0157372_128846331 134
10 3300048904 Ga0496101_0254401 Ga0496101_0254401_421_849 134
11 3300048907 Ga0496104_0061462 Ga0496104_0061462_494_922 134
12 3300048908 Ga0496105_0135868 Ga0496105_0135868_1053_1481 134
13 3300048910 Ga0496107_0311062 Ga0496107_0311062_183_611 134
14 3300048913 Ga0496110_0101699 Ga0496110_0101699_1929_2357 134
15 3300048914 Ga0496111_0035400 Ga0496111_0035400_2571_2999 134
16 3300048918 Ga0496115_0033294 Ga0496115_0033294_574_1002 134
17 3300005327 Ga0070658_10056630 Ga0070658_100566302 136
18 3300005339 Ga0070660_100120235 Ga0070660_1001202354 136
19 3300005614 Ga0068856_100354265 Ga0068856_1003542653 136
20 3300006173 Ga0070716_100722743 Ga0070716_1007227432 136
21 3300021384 Ga0213876_10077685 Ga0213876_100776852 136
22 3300025909 Ga0207705_10137232 Ga0207705_101372322 136
23 3300025913 Ga0207695_11310149 Ga0207695_113101492 136
24 3300025914 Ga0207671_10111742 Ga0207671_101117423 136
25 3300025919 Ga0207657_10113814 Ga0207657_101138142 136
26 3300025924 Ga0207694_10546943 Ga0207694_105469432 136
27 3300026078 Ga0207702_10459900 Ga0207702_104599002 136
28 3300039437 Ga0436365_0670560 Ga0436365_0670560_1836_2282 136
29 3300039447 Ga0436361_0440717 Ga0436361_0440717_248_694 136
30 3300048929 Ga0496126_0294869 Ga0496126_0294869_451_897 136
31 3300048929 Ga0496126_0426822 Ga0496126_0426822_278_724 136
32 3300039438 Ga0436360_1116737 Ga0436360_1116737_755_1180 137
33 3300048088 Ga0495602_0230939 Ga0495602_0230939_371_808 137
34 3300053078 Ga0495612_0337764 Ga0495612_0337764_60_497 137
35 iso_pu_bacteria 2738543024 2739307439 138
36 3300039438 Ga0436360_0252935 Ga0436360_0252935_127_576 139
37 3300039438 Ga0436360_1227354 Ga0436360_1227354_1315_1767 139
38 3300039447 Ga0436361_0405020 Ga0436361_0405020_965_1417 139
39 3300039447 Ga0436361_1041899 Ga0436361_1041899_4478_4930 139
40 3300039453 Ga0436362_0008493 Ga0436362_0008493_82_531 139
41 3300039453 Ga0436362_0703424 Ga0436362_0703424_1078_1530 139
42 3300039453 Ga0436362_1151281 Ga0436362_1151281_156_605 139
43 iso_pu_bacteria 2513237351 2514587618 139
44 iso_pu_bacteria 2643221551 2643776494 139
45 iso_pu_bacteria 2643221555 2643794941 139
46 3300005455 Ga0070663_100055541 Ga0070663_1000555413 140
47 3300009093 Ga0105240_10533814 Ga0105240_105338142 140
48 3300013102 Ga0157371_10533240 Ga0157371_105332402 140
49 3300013104 Ga0157370_10366886 Ga0157370_103668862 140
50 3300013307 Ga0157372_10277255 Ga0157372_102772552 140
51 3300013307 Ga0157372_11573882 Ga0157372_115738822 140
52 3300025909 Ga0207705_10748219 Ga0207705_107482191 140
53 3300025912 Ga0207707_10823678 Ga0207707_108236781 140
54 3300025913 Ga0207695_10389783 Ga0207695_103897832 140
55 3300026067 Ga0207678_10028677 Ga0207678_100286775 140
56 3300026116 Ga0207674_10219181 Ga0207674_102191813 140
57 3300049568 Ga0501031_0022248 Ga0501031_0022248_1011_1466 140
58 3300049568 Ga0501031_0376546 Ga0501031_0376546_443_877 140
59 3300049569 Ga0501032_0002249 Ga0501032_0002249_12930_13385 140
60 3300049569 Ga0501032_0051489 Ga0501032_0051489_2315_2749 140
61 3300049569 Ga0501032_0115491 Ga0501032_0115491_1310_1750 140
62 3300049569 Ga0501032_0236540 Ga0501032_0236540_143_583 140
63 3300049569 Ga0501032_0461226 Ga0501032_0461226_352_786 140
64 3300049569 Ga0501032_0491921 Ga0501032_0491921_154_609 140
65 3300049570 Ga0501033_0001706 Ga0501033_0001706_14876_15331 140
66 3300049570 Ga0501033_0023796 Ga0501033_0023796_1153_1587 140
67 3300049570 Ga0501033_0043151 Ga0501033_0043151_1330_1770 140
68 3300049570 Ga0501033_0048312 Ga0501033_0048312_2601_3041 140
69 3300049570 Ga0501033_0063627 Ga0501033_0063627_1785_2225 140
70 3300049570 Ga0501033_1072259 Ga0501033_1072259_91_525 140
71 3300049571 Ga0501034_0126028 Ga0501034_0126028_985_1419 140
72 3300049572 Ga0501036_0143062 Ga0501036_0143062_106_540 140
73 3300049572 Ga0501036_0217639 Ga0501036_0217639_14_454 140
74 3300049572 Ga0501036_0987196 Ga0501036_0987196_244_678 140
75 3300049573 Ga0501037_0000253 Ga0501037_0000253_15022_15477 140
76 3300049573 Ga0501037_0267513 Ga0501037_0267513_679_1113 140
77 3300049573 Ga0501037_0293177 Ga0501037_0293177_82_516 140
78 3300049573 Ga0501037_0572633 Ga0501037_0572633_139_579 140
79 3300049574 Ga0501038_0023575 Ga0501038_0023575_4847_5281 140
80 3300049574 Ga0501038_0055617 Ga0501038_0055617_1421_1861 140
81 3300049574 Ga0501038_0109664 Ga0501038_0109664_1794_2228 140
82 3300049574 Ga0501038_0210480 Ga0501038_0210480_1068_1523 140
83 3300049575 Ga0501039_0044629 Ga0501039_0044629_2312_2746 140
84 3300049578 Ga0501042_0047093 Ga0501042_0047093_142_576 140
85 3300049579 Ga0501043_0000100 Ga0501043_0000100_348_803 140
86 3300049579 Ga0501043_0066511 Ga0501043_0066511_2244_2684 140
87 3300049579 Ga0501043_0175181 Ga0501043_0175181_633_1073 140
88 3300049579 Ga0501043_0283835 Ga0501043_0283835_519_953 140
89 3300049580 Ga0501046_0052560 Ga0501046_0052560_1854_2294 140
90 3300049580 Ga0501046_0158486 Ga0501046_0158486_679_1113 140
91 3300049581 Ga0501047_0018555 Ga0501047_0018555_3561_4001 140
92 3300049581 Ga0501047_0056899 Ga0501047_0056899_2307_2747 140
93 3300049581 Ga0501047_0106859 Ga0501047_0106859_1741_2181 140
94 3300049581 Ga0501047_0260521 Ga0501047_0260521_263_718 140
95 3300049581 Ga0501047_0282191 Ga0501047_0282191_786_1220 140
96 3300049581 Ga0501047_0736114 Ga0501047_0736114_17_451 140
97 3300049582 Ga0501048_0032662 Ga0501048_0032662_2869_3303 140
98 3300049582 Ga0501048_0303176 Ga0501048_0303176_536_976 140
99 3300049583 Ga0501067_0021429 Ga0501067_0021429_1968_2423 140
100 3300049583 Ga0501067_0097282 Ga0501067_0097282_1159_1593 140
101 3300049584 Ga0501068_0052791 Ga0501068_0052791_78_518 140
102 3300049585 Ga0501069_0000020 Ga0501069_0000020_107260_107715 140
103 3300049585 Ga0501069_0013718 Ga0501069_0013718_3026_3466 140
104 3300049585 Ga0501069_0381434 Ga0501069_0381434_273_707 140
105 3300049586 Ga0501070_0000193 Ga0501070_0000193_24608_25063 140
106 3300049586 Ga0501070_0009764 Ga0501070_0009764_3007_3447 140
107 3300049586 Ga0501070_0023176 Ga0501070_0023176_3772_4212 140
108 3300049586 Ga0501070_0092794 Ga0501070_0092794_290_745 140
109 3300049586 Ga0501070_0098421 Ga0501070_0098421_171_611 140
110 3300049586 Ga0501070_0237097 Ga0501070_0237097_16_462 140
111 3300049586 Ga0501070_0486344 Ga0501070_0486344_219_653 140
112 3300049586 Ga0501070_0736921 Ga0501070_0736921_237_677 140
113 3300049587 Ga0501071_0027772 Ga0501071_0027772_537_992 140
114 3300049587 Ga0501071_0171726 Ga0501071_0171726_673_1113 140
115 3300049589 Ga0501073_0153758 Ga0501073_0153758_415_870 140
116 3300049589 Ga0501073_0978047 Ga0501073_0978047_80_514 140
117 3300049590 Ga0501074_0000063 Ga0501074_0000063_21226_21681 140
118 3300049590 Ga0501074_0020945 Ga0501074_0020945_4295_4729 140
119 3300049741 Ga0501079_0642222 Ga0501079_0642222_218_652 140
120 3300049742 Ga0501080_0001750 Ga0501080_0001750_3325_3780 140
121 3300049742 Ga0501080_0018243 Ga0501080_0018243_656_1096 140
122 3300049742 Ga0501080_0022814 Ga0501080_0022814_4194_4634 140
123 3300049742 Ga0501080_0208543 Ga0501080_0208543_1329_1763 140
124 3300049742 Ga0501080_0270006 Ga0501080_0270006_45_491 140
125 3300049744 Ga0501083_0000263 Ga0501083_0000263_1491_1946 140
126 3300049744 Ga0501083_0030291 Ga0501083_0030291_1650_2084 140
127 3300049822 Ga0501035_0000070 Ga0501035_0000070_14881_15336 140
128 3300049822 Ga0501035_0006500 Ga0501035_0006500_5473_5913 140
129 3300049822 Ga0501035_0007398 Ga0501035_0007398_7578_8033 140
130 3300049822 Ga0501035_0011331 Ga0501035_0011331_3143_3583 140
131 3300049822 Ga0501035_0021104 Ga0501035_0021104_1254_1694 140
132 3300049822 Ga0501035_0072325 Ga0501035_0072325_1721_2155 140
133 3300049822 Ga0501035_0097126 Ga0501035_0097126_1400_1834 140
134 3300049822 Ga0501035_0207133 Ga0501035_0207133_1164_1610 140
135 3300049822 Ga0501035_0315954 Ga0501035_0315954_635_1075 140
136 3300049822 Ga0501035_0895186 Ga0501035_0895186_98_532 140
137 3300049823 Ga0501044_0000037 Ga0501044_0000037_7529_7984 140
138 3300049823 Ga0501044_0006333 Ga0501044_0006333_2747_3187 140
139 3300049823 Ga0501044_0009272 Ga0501044_0009272_5385_5825 140
140 3300049823 Ga0501044_0012643 Ga0501044_0012643_7849_8295 140
141 3300049823 Ga0501044_0021240 Ga0501044_0021240_1289_1723 140
142 3300049823 Ga0501044_0077618 Ga0501044_0077618_2256_2696 140
143 3300049823 Ga0501044_0103649 Ga0501044_0103649_1248_1688 140
144 3300049823 Ga0501044_0117876 Ga0501044_0117876_110_565 140
145 3300049823 Ga0501044_0120624 Ga0501044_0120624_679_1113 140
146 3300049823 Ga0501044_0688600 Ga0501044_0688600_410_850 140
147 3300049824 Ga0501045_0040958 Ga0501045_0040958_680_1114 140
148 3300054114 Ga0501084_0119418 Ga0501084_0119418_1761_2201 140
149 3300060353 Ga0501082_0090998 Ga0501082_0090998_1416_1871 140
150 3300060353 Ga0501082_0266068 Ga0501082_0266068_894_1349 140
151 iso_pu_bacteria 2503198000 2503200050 140
152 iso_pu_bacteria 2508501123 2509116797 140
153 iso_pu_bacteria 2509276018 2509369488 140
154 iso_pu_bacteria 2509276022 2509394955 140
155 iso_pu_bacteria 2510065059 2510319336 140
156 iso_pu_bacteria 2512875016 2512932480 140
157 iso_pu_bacteria 2512875024 2512960496 140
158 iso_pu_bacteria 2513237090 2513608597 140
159 iso_pu_bacteria 2513237164 2514036417 140
160 iso_pu_bacteria 2513237305 2514420808 140
161 iso_pu_bacteria 2588253730 2588518547 140
162 iso_pu_bacteria 2599185301 2599936355 140
163 iso_pu_bacteria 2643221550 2643774343 140
164 iso_pu_bacteria 2643221564 2643839130 140
165 iso_pu_bacteria 2643221595 2643984797 140
166 iso_pu_bacteria 2643221623 2644133169 140
167 iso_pu_bacteria 2643221627 2644153127 140
168 iso_pu_bacteria 2687453392 2688597292 140
169 iso_pu_bacteria 2693429783 2694628649 140
170 iso_pu_bacteria 2693429784 2694637437 140
171 iso_pu_bacteria 2721755686 2723574502 140
172 iso_pu_bacteria 2756170246 2756671579 140
173 iso_pu_bacteria 2844002411 2844008509 140
174 iso_pu_bacteria 2844009547 2844012672 140
175 iso_pu_bacteria 2847670302 2847675084 140
176 iso_pu_bacteria 2856314179 2856320802 140
177 iso_pu_bacteria 2856320880 2856323154 140
178 iso_pu_bacteria 2856328259 2856333947 140
179 iso_pu_bacteria 2856334872 2856341532 140
180 iso_pu_bacteria 2856356410 2856358156 140
181 iso_pu_bacteria 2856364286 2856368119 140
182 iso_pu_bacteria 2857349434 2857351737 140
183 iso_pu_bacteria 2857367948 2857368238 140
184 iso_pu_bacteria 2869169390 2869172138 140
185 iso_pu_bacteria 2869234852 2869241344 140
186 iso_pu_bacteria 2869242130 2869248494 140
187 iso_pu_bacteria 2869249662 2869256707 140
188 iso_pu_bacteria 2869256925 2869257389 140
189 iso_pu_bacteria 2869264136 2869271133 140
190 iso_pu_bacteria 2869271264 2869278343 140
191 iso_pu_bacteria 2869278585 2869282704 140
192 iso_pu_bacteria 2869285874 2869290262 140
193 iso_pu_bacteria 2871429161 2871432546 140
194 iso_pu_bacteria 2871435913 2871437711 140
195 iso_pu_bacteria 2871444079 2871448061 140
196 iso_pu_bacteria 2871451962 2871457721 140
197 iso_pu_bacteria 2871459585 2871464271 140
198 iso_pu_bacteria 2871466892 2871467468 140
199 iso_pu_bacteria 2871481445 2871485355 140
200 iso_pu_bacteria 2871488783 2871493170 140
201 iso_pu_bacteria 2871495908 2871496858 140
202 iso_pu_bacteria 2874102143 2874107683 140
203 iso_pu_bacteria 2874109183 2874110758 140
204 iso_pu_bacteria 2874116593 2874118999 140
205 iso_pu_bacteria 2874123672 2874124014 140
206 iso_pu_bacteria 2874131515 2874138376 140
207 iso_pu_bacteria 2874139085 2874142362 140
208 iso_pu_bacteria 2874146452 2874152513 140
209 iso_pu_bacteria 2874155637 2874159913 140
210 iso_pu_bacteria 2874162495 2874168575 140
211 iso_pu_bacteria 2874168670 2874173547 140
212 iso_pu_bacteria 2876363079 2876367486 140
213 iso_pu_bacteria 2876377896 2876379290 140
214 iso_pu_bacteria 2876386047 2876389782 140
215 iso_pu_bacteria 2876392853 2876398077 140
216 iso_pu_bacteria 2876399893 2876401990 140
217 iso_pu_bacteria 2876406927 2876409256 140
218 iso_pu_bacteria 2876413966 2876418429 140
219 iso_pu_bacteria 2876420981 2876426826 140
220 iso_pu_bacteria 2878035449 2878035864 140
221 iso_pu_bacteria 2878730984 2878737489 140
222 iso_pu_bacteria 2878738818 2878744453 140
223 iso_pu_bacteria 2878745973 2878750160 140
224 iso_pu_bacteria 2878753008 2878757215 140
225 iso_pu_bacteria 2878760144 2878761082 140
226 iso_pu_bacteria 2878767105 2878768046 140
227 iso_pu_bacteria 2878774303 2878778454 140
228 iso_pu_bacteria 2878781027 2878788377 140
229 iso_pu_bacteria 2881147464 2881149980 140
230 iso_pu_bacteria 2881155292 2881161122 140
231 iso_pu_bacteria 2881161766 2881166857 140
232 iso_pu_bacteria 2881845957 2881847449 140
233 iso_pu_bacteria 2881853255 2881856074 140
234 iso_pu_bacteria 2881861095 2881862884 140
235 iso_pu_bacteria 2882632389 2882632623 140
236 iso_pu_bacteria 2882912400 2882919489 140
237 iso_pu_bacteria 2885305155 2885308368 140
238 iso_pu_bacteria 2885318864 2885325461 140
239 iso_pu_bacteria 2885326080 2885331510 140
240 iso_pu_bacteria 2885334103 2885340680 140
241 iso_pu_bacteria 2885342637 2885347027 140
242 iso_pu_bacteria 2885350715 2885351005 140
243 iso_pu_bacteria 2888337043 2888338369 140
244 iso_pu_bacteria 2888350351 2888355213 140
245 iso_pu_bacteria 2889010040 2889010191 140
246 iso_pu_bacteria 2889016732 2889018138 140
247 iso_pu_bacteria 2903448605 2903450267 140
248 iso_pu_bacteria 2903492973 2903497850 140
249 iso_pu_bacteria 2903492973 2903500942 140
250 iso_pu_bacteria 2903513507 2903515087 140
251 iso_pu_bacteria 2903521522 2903521997 140
252 iso_pu_bacteria 2903528002 2903528374 140
253 iso_pu_bacteria 2903540706 2903541654 140
254 iso_pu_bacteria 2904659560 2904664728 140
255 iso_pu_bacteria 2906308376 2906312518 140
256 iso_pu_bacteria 2906321335 2906325227 140
257 iso_pu_bacteria 2906328253 2906330622 140
258 iso_pu_bacteria 2906363423 2906370023 140
259 iso_pu_bacteria 2906370794 2906374741 140
260 iso_pu_bacteria 2906378014 2906382464 140
261 iso_pu_bacteria 2906386501 2906389141 140
262 iso_pu_bacteria 2906393657 2906395393 140
263 iso_pu_bacteria 2906401398 2906408031 140
264 iso_pu_bacteria 2906408224 2906411954 140
265 iso_pu_bacteria 2906414383 2906419749 140
266 iso_pu_bacteria 2922130491 2922133873 140
267 iso_pu_bacteria 2922151315 2922156137 140
268 iso_pu_bacteria 2922158528 2922164856 140
269 iso_pu_bacteria 2922172374 2922174682 140
270 iso_pu_bacteria 2922185730 2922188694 140
271 iso_pu_bacteria 2924718760 2924722589 140
272 iso_pu_bacteria 2924726620 2924731219 140
273 iso_pu_bacteria 2924733363 2924737816 140
274 iso_pu_bacteria 2924741084 2924742473 140
275 iso_pu_bacteria 2924748358 2924750163 140
276 iso_pu_bacteria 2924762789 2924768198 140
277 iso_pu_bacteria 2924776078 2924782483 140
278 iso_pu_bacteria 2924784321 2924786520 140
279 iso_pu_bacteria 2937813078 2937819337 140
280 iso_pu_bacteria 2937822353 2937827897 140
281 iso_pu_bacteria 2937848649 2937851937 140
282 iso_pu_bacteria 2937861824 2937864929 140
283 iso_pu_bacteria 2937868953 2937870197 140
284 iso_pu_bacteria 2937877337 2937881124 140
285 iso_pu_bacteria 2937891427 2937892436 140
286 iso_pu_bacteria 2937972304 2937977218 140
287 iso_pu_bacteria 2937980651 2937983173 140
288 iso_pu_bacteria 2937994558 2937995511 140
289 iso_pu_bacteria 2938014810 2938021204 140
290 iso_pu_bacteria 2958034702 2958039487 140
291 iso_pu_bacteria 2958041894 2958052884 140
292 iso_pu_bacteria 2958041894 2958056540 140
293 iso_pu_bacteria 2958064165 2958064994 140
294 iso_pu_bacteria 2958084443 2958088319 140
295 iso_pu_bacteria 2958092219 2958097908 140
296 iso_pu_bacteria 2958100919 2958101422 140
297 iso_pu_bacteria 2958108152 2958110711 140
298 iso_pu_bacteria 2958115193 2958115573 140
299 iso_pu_bacteria 2958122699 2958128503 140
300 iso_pu_bacteria 2958130278 2958134650 140
301 iso_pu_bacteria 2958137437 2958143471 140
302 iso_pu_bacteria 2958144490 2958146460 140
303 iso_pu_bacteria 2958158011 2958163055 140
304 iso_pu_bacteria 2958165035 2958165984 140
305 iso_pu_bacteria 2958172287 2958178435 140
306 iso_pu_bacteria 2958179912 2958186595 140
307 iso_pu_bacteria 2961077736 2961085094 140
308 iso_pu_bacteria 2961114664 2961119726 140
309 iso_pu_bacteria 2961127735 2961135327 140
310 iso_pu_bacteria 2961136820 2961142681 140
311 iso_pu_bacteria 2961163497 2961164447 140
312 iso_pu_bacteria 2961170736 2961175456 140
313 iso_pu_bacteria 2961183825 2961189369 140
314 iso_pu_bacteria 2963644680 2963646723 140
315 iso_pu_bacteria 2965018300 2965019433 140
316 iso_pu_bacteria 2965025482 2965027669 140
317 iso_pu_bacteria 2965032056 2965035677 140
318 iso_pu_bacteria 2965040258 2965041890 140
319 iso_pu_bacteria 2965047637 2965052707 140
320 iso_pu_bacteria 2965062239 2965069670 140
321 iso_pu_bacteria 2965089291 2965090835 140
322 iso_pu_bacteria 2965102966 2965106285 140
323 iso_pu_bacteria 2965119406 2965125786 140
324 iso_pu_bacteria 2967996073 2967999542 140
325 iso_pu_bacteria 2968003550 2968007900 140
326 iso_pu_bacteria 2968016561 2968020814 140
327 iso_pu_bacteria 2968083720 2968090485 140
328 iso_pu_bacteria 2968091066 2968094831 140
329 iso_pu_bacteria 2968097103 2968099257 140
330 iso_pu_bacteria 2968110612 2968115981 140
331 iso_pu_bacteria 2968117919 2968119370 140
332 iso_pu_bacteria 2968128360 2968133598 140
333 iso_pu_bacteria 2968138860 2968142161 140
334 iso_pu_bacteria 2968171901 2968172848 140
335 iso_pu_bacteria 2970469710 2970474111 140
336 iso_pu_bacteria 2970489779 2970495138 140
337 iso_pu_bacteria 2970503327 2970508044 140
338 iso_pu_bacteria 2970510686 2970512332 140
339 iso_pu_bacteria 2970532167 2970535891 140
340 iso_pu_bacteria 2970547951 2970548365 140
341 iso_pu_bacteria 2970554993 2970555940 140
342 iso_pu_bacteria 2970593180 2970597313 140
343 iso_pu_bacteria 2970619444 2970621869 140
344 iso_pu_bacteria 2970627176 2970634123 140
345 iso_pu_bacteria 2977821940 2977826374 140
346 iso_pu_bacteria 2977828996 2977829376 140
347 iso_pu_bacteria 2977843712 2977848306 140
348 iso_pu_bacteria 2977851361 2977855395 140
349 iso_pu_bacteria 2977864932 2977865218 140
350 iso_pu_bacteria 2977872689 2977878333 140
351 iso_pu_bacteria 2977898635 2977899533 140
352 iso_pu_bacteria 2977907340 2977913531 140
353 iso_pu_bacteria 2977915119 2977920102 140
354 iso_pu_bacteria 2977922695 2977925080 140
355 iso_pu_bacteria 2977935797 2977938165 140
356 iso_pu_bacteria 2977942078 2977944683 140
357 iso_pu_bacteria 2977950692 2977951754 140
358 iso_pu_bacteria 2977957713 2977959286 140
359 iso_pu_bacteria 2977971508 2977972245 140
360 iso_pu_bacteria 2977986579 2977990402 140
361 iso_pu_bacteria 2979710463 2979710797 140
362 iso_pu_bacteria 2979742915 2979749370 140
363 iso_pu_bacteria 2979764755 2979765909 140
364 iso_pu_bacteria 2979772303 2979778884 140
365 iso_pu_bacteria 2979779861 2979783958 140
366 iso_pu_bacteria 2979808191 2979813228 140
367 iso_pu_bacteria 2987636660 2987638921 140
368 iso_pu_bacteria 2987645492 2987646098 140
369 iso_pu_bacteria 2987652177 2987653803 140
370 iso_pu_bacteria 2987659509 2987660451 140
371 iso_pu_bacteria 2987666974 2987671382 140
372 iso_pu_bacteria 2987673487 2987676638 140
373 iso_pu_bacteria 2996310559 2996312038 140
374 iso_pu_bacteria 2996336353 2996339772 140
375 iso_pu_bacteria 2996341866 2996344522 140
376 iso_pu_bacteria 2996348954 2996352568 140
377 iso_pu_bacteria 2996386984 2996390086 140
378 iso_pu_bacteria 3000135777 3000139675 140
379 iso_pu_bacteria 3004167301 3004167713 140
380 iso_pu_bacteria 3004188549 3004189502 140
381 iso_pu_bacteria 3004203850 3004204836 140
382 iso_pu_bacteria 3004211236 3004218125 140
383 iso_pu_bacteria 3004218560 3004220828 140
384 iso_pu_bacteria 3004232784 3004237502 140
385 iso_pu_bacteria 3004248173 3004255380 140
386 iso_pu_bacteria 3004268573 3004271118 140
387 iso_pu_bacteria 3004275668 3004279250 140
388 iso_pu_bacteria 3004289098 3004291293 140
389 iso_pu_bacteria 3004334049 3004335673 140
390 iso_pu_bacteria 637000159 637075577 140
391 iso_pu_bacteria 649633066 649871845 140
392 iso_pu_bacteria 8002285264 8002291715 140
393 iso_pu_bacteria 8004300914 8004302054 140
394 iso_pu_bacteria 8004312739 8004320699 140
395 iso_pu_bacteria 8004361976 8004367623 140
396 iso_pu_bacteria 8004374579 8004378790 140
397 iso_pu_bacteria 8004387939 8004392468 140
398 iso_pu_bacteria 8004640170 8004645067 140
399 iso_pu_bacteria 8004703790 8004711995 140
400 iso_pu_bacteria 8004714634 8004718777 140
401 iso_pu_bacteria 8004727605 8004733719 140
402 3300021361 Ga0213872_10030578 Ga0213872_100305785 142
403 3300028381 Ga0268264_11638593 Ga0268264_116385931 142
404 3300039447 Ga0436361_0417337 Ga0436361_0417337_194_706 142
405 3300037312 Ga0395899_0381126 Ga0395899_0381126_325_756 143
406 3300037418 Ga0395900_0067751 Ga0395900_0067751_1286_1717 143
407 3300037466 Ga0395898_0071353 Ga0395898_0071353_743_1174 143
408 3300037471 Ga0395905_0237623 Ga0395905_0237623_942_1373 143
409 3300038443 Ga0395901_0016852 Ga0395901_0016852_4401_4832 143
410 3300049568 Ga0501031_0003478 Ga0501031_0003478_7114_7548 143
411 3300049569 Ga0501032_0000042 Ga0501032_0000042_30467_30901 143
412 3300049570 Ga0501033_0000153 Ga0501033_0000153_37240_37674 143
413 3300049571 Ga0501034_0000446 Ga0501034_0000446_37300_37734 143
414 3300049571 Ga0501034_0038152 Ga0501034_0038152_831_1262 143
415 3300049572 Ga0501036_0003573 Ga0501036_0003573_9200_9634 143
416 3300049574 Ga0501038_0000315 Ga0501038_0000315_30609_31043 143
417 3300049575 Ga0501039_0000088 Ga0501039_0000088_30609_31043 143
418 3300049579 Ga0501043_0001190 Ga0501043_0001190_1230_1664 143
419 3300049580 Ga0501046_0016925 Ga0501046_0016925_1394_1828 143
420 3300049822 Ga0501035_0000220 Ga0501035_0000220_30567_31001 143
421 3300049823 Ga0501044_0007398 Ga0501044_0007398_9267_9701 143
422 3300049823 Ga0501044_0601162 Ga0501044_0601162_412_843 143
423 3300001979 JGI24740J21852_10017014 JGI24740J21852_100170143 144
424 3300003214 JGI25165J46597_1000042 JGI25165J46597_1000042218 144
425 3300003322 rootL2_10197691 rootL2_101976912 144
426 3300003762 Ga0055542_1000337 Ga0055542_100033717 144
427 3300003763 Ga0055529_1002099 Ga0055529_10020995 144
428 3300005339 Ga0070660_100851998 Ga0070660_1008519981 144
429 3300005344 Ga0070661_100639665 Ga0070661_1006396652 144
430 3300005356 Ga0070674_100303075 Ga0070674_1003030751 144
431 3300005356 Ga0070674_101571677 Ga0070674_1015716771 144
432 3300005367 Ga0070667_100731193 Ga0070667_1007311932 144
433 3300005456 Ga0070678_101773709 Ga0070678_1017737091 144
434 3300005456 Ga0070678_102096727 Ga0070678_1020967271 144
435 3300005457 Ga0070662_100805505 Ga0070662_1008055051 144
436 3300005459 Ga0068867_100120280 Ga0068867_1001202803 144
437 3300005539 Ga0068853_100095026 Ga0068853_1000950263 144
438 3300005539 Ga0068853_100204578 Ga0068853_1002045781 144
439 3300005539 Ga0068853_100781203 Ga0068853_1007812031 144
440 3300005548 Ga0070665_100020512 Ga0070665_1000205123 144
441 3300005548 Ga0070665_100373209 Ga0070665_1003732093 144
442 3300005549 Ga0070704_101504430 Ga0070704_1015044301 144
443 3300005563 Ga0068855_100800996 Ga0068855_1008009962 144
444 3300005577 Ga0068857_100065733 Ga0068857_1000657332 144
445 3300005577 Ga0068857_100250044 Ga0068857_1002500442 144
446 3300005578 Ga0068854_100112979 Ga0068854_1001129791 144
447 3300005578 Ga0068854_101283998 Ga0068854_1012839982 144
448 3300005616 Ga0068852_100355992 Ga0068852_1003559922 144
449 3300006038 Ga0075365_10006675 Ga0075365_100066751 144
450 3300006038 Ga0075365_10007215 Ga0075365_100072158 144
451 3300006038 Ga0075365_10053488 Ga0075365_100534884 144
452 3300006038 Ga0075365_10061131 Ga0075365_100611313 144
453 3300006038 Ga0075365_10318811 Ga0075365_103188112 144
454 3300006042 Ga0075368_10053131 Ga0075368_100531313 144
455 3300006042 Ga0075368_10143577 Ga0075368_101435772 144
456 3300006048 Ga0075363_100023691 Ga0075363_1000236913 144
457 3300006048 Ga0075363_100184628 Ga0075363_1001846282 144
458 3300006051 Ga0075364_10063305 Ga0075364_100633053 144
459 3300006051 Ga0075364_10071412 Ga0075364_100714123 144
460 3300006051 Ga0075364_10369227 Ga0075364_103692272 144
461 3300006177 Ga0075362_10018384 Ga0075362_100183843 144
462 3300006177 Ga0075362_10035102 Ga0075362_100351022 144
463 3300006177 Ga0075362_10199916 Ga0075362_101999162 144
464 3300006178 Ga0075367_10026956 Ga0075367_100269565 144
465 3300006178 Ga0075367_10122896 Ga0075367_101228963 144
466 3300006178 Ga0075367_10163518 Ga0075367_101635182 144
467 3300006178 Ga0075367_10350634 Ga0075367_103506342 144
468 3300006178 Ga0075367_10584619 Ga0075367_105846192 144
469 3300006186 Ga0075369_10054573 Ga0075369_100545733 144
470 3300006186 Ga0075369_10203743 Ga0075369_102037432 144
471 3300006195 Ga0075366_10273036 Ga0075366_102730362 144
472 3300006353 Ga0075370_10033211 Ga0075370_100332112 144
473 3300006881 Ga0068865_100813886 Ga0068865_1008138862 144
474 3300009093 Ga0105240_10100603 Ga0105240_101006033 144
475 3300009093 Ga0105240_11180908 Ga0105240_111809082 144
476 3300009093 Ga0105240_11357835 Ga0105240_113578352 144
477 3300009093 Ga0105240_11875839 Ga0105240_118758392 144
478 3300009098 Ga0105245_10725350 Ga0105245_107253502 144
479 3300009148 Ga0105243_11301925 Ga0105243_113019252 144
480 3300009174 Ga0105241_10054943 Ga0105241_100549434 144
481 3300009177 Ga0105248_10079642 Ga0105248_100796422 144
482 3300009545 Ga0105237_10405062 Ga0105237_104050622 144
483 3300009545 Ga0105237_11630180 Ga0105237_116301801 144
484 3300009551 Ga0105238_10054721 Ga0105238_100547215 144
485 3300009551 Ga0105238_11586590 Ga0105238_115865901 144
486 3300009551 Ga0105238_11955899 Ga0105238_119558991 144
487 3300009551 Ga0105238_12164644 Ga0105238_121646441 144
488 3300009553 Ga0105249_10456832 Ga0105249_104568322 144
489 3300010375 Ga0105239_10694284 Ga0105239_106942842 144
490 3300010375 Ga0105239_11038084 Ga0105239_110380842 144
491 3300010375 Ga0105239_11110761 Ga0105239_111107611 144
492 3300013104 Ga0157370_10245507 Ga0157370_102455072 144
493 3300013105 Ga0157369_10025374 Ga0157369_100253746 144
494 3300013297 Ga0157378_10498618 Ga0157378_104986182 144
495 3300013297 Ga0157378_10717849 Ga0157378_107178492 144
496 3300013306 Ga0163162_11233921 Ga0163162_112339211 144
497 3300013307 Ga0157372_11288982 Ga0157372_112889822 144
498 3300013308 Ga0157375_10613867 Ga0157375_106138671 144
499 3300013308 Ga0157375_12907536 Ga0157375_129075361 144
500 3300014497 Ga0182008_10095358 Ga0182008_100953582 144
501 3300015261 Ga0182006_1064211 Ga0182006_10642112 144
502 3300015265 Ga0182005_1014315 Ga0182005_10143153 144
503 3300017792 Ga0163161_10616612 Ga0163161_106166122 144
504 3300025250 Ga0209026_1000029 Ga0209026_1000029243 144
505 3300025254 Ga0209148_1000080 Ga0209148_1000080190 144
506 3300025256 Ga0209759_1000040 Ga0209759_100004097 144
507 3300025256 Ga0209759_1050001 Ga0209759_10500012 144
508 3300025261 Ga0209233_1000028 Ga0209233_1000028510 144
509 3300025261 Ga0209233_1095943 Ga0209233_10959431 144
510 3300025272 Ga0209455_1000239 Ga0209455_100023937 144
511 3300025297 Ga0209758_1024974 Ga0209758_10249743 144
512 3300025901 Ga0207688_10368233 Ga0207688_103682331 144
513 3300025904 Ga0207647_10000898 Ga0207647_1000089820 144
514 3300025904 Ga0207647_10182518 Ga0207647_101825182 144
515 3300025907 Ga0207645_10094671 Ga0207645_100946713 144
516 3300025911 Ga0207654_10076831 Ga0207654_100768312 144
517 3300025913 Ga0207695_10234005 Ga0207695_102340053 144
518 3300025913 Ga0207695_10351691 Ga0207695_103516912 144
519 3300025914 Ga0207671_10123146 Ga0207671_101231462 144
520 3300025914 Ga0207671_10141504 Ga0207671_101415041 144
521 3300025919 Ga0207657_10153129 Ga0207657_101531293 144
522 3300025920 Ga0207649_10873721 Ga0207649_108737211 144
523 3300025924 Ga0207694_10453624 Ga0207694_104536242 144
524 3300025932 Ga0207690_10301427 Ga0207690_103014271 144
525 3300025933 Ga0207706_10513379 Ga0207706_105133791 144
526 3300025935 Ga0207709_10372481 Ga0207709_103724812 144
527 3300025937 Ga0207669_10738425 Ga0207669_107384251 144
528 3300025941 Ga0207711_10972287 Ga0207711_109722872 144
529 3300025945 Ga0207679_10332298 Ga0207679_103322982 144
530 3300025949 Ga0207667_10476858 Ga0207667_104768582 144
531 3300025961 Ga0207712_10485560 Ga0207712_104855602 144
532 3300025972 Ga0207668_10783772 Ga0207668_107837722 144
533 3300025986 Ga0207658_10901982 Ga0207658_109019822 144
534 3300026023 Ga0207677_10535354 Ga0207677_105353542 144
535 3300026041 Ga0207639_10019956 Ga0207639_100199565 144
536 3300026041 Ga0207639_10804845 Ga0207639_108048452 144
537 3300026041 Ga0207639_12165594 Ga0207639_121655941 144
538 3300026067 Ga0207678_10225549 Ga0207678_102255492 144
539 3300026067 Ga0207678_10526647 Ga0207678_105266472 144
540 3300026089 Ga0207648_10936105 Ga0207648_109361052 144
541 3300026116 Ga0207674_10335070 Ga0207674_103350702 144
542 3300027866 Ga0209813_10008953 Ga0209813_100089531 144
543 3300028379 Ga0268266_10024991 Ga0268266_100249913 144
544 3300028379 Ga0268266_10296585 Ga0268266_102965852 144
545 3300028379 Ga0268266_11199684 Ga0268266_111996841 144
546 3300028786 Ga0307517_10261356 Ga0307517_102613561 144
547 3300028794 Ga0307515_10501689 Ga0307515_105016892 144
548 3300031548 Ga0307408_101306557 Ga0307408_1013065572 144
549 3300031731 Ga0307405_11176431 Ga0307405_111764312 144
550 3300031852 Ga0307410_10961591 Ga0307410_109615912 144
551 3300032002 Ga0307416_101500952 Ga0307416_1015009522 144
552 3300032126 Ga0307415_100703283 Ga0307415_1007032832 144
553 3300035692 Ga0373935_0537437 Ga0373935_0537437_202_636 144
554 3300037312 Ga0395899_0074339 Ga0395899_0074339_580_1017 144
555 3300037312 Ga0395899_0784289 Ga0395899_0784289_56_493 144
556 3300037418 Ga0395900_0000042 Ga0395900_0000042_196002_196457 144
557 3300037418 Ga0395900_0134575 Ga0395900_0134575_90_527 144
558 3300037418 Ga0395900_0209947 Ga0395900_0209947_901_1338 144
559 3300037418 Ga0395900_0459661 Ga0395900_0459661_163_600 144
560 3300037418 Ga0395900_0521811 Ga0395900_0521811_383_817 144
561 3300037466 Ga0395898_0000080 Ga0395898_0000080_196002_196457 144
562 3300037466 Ga0395898_0100416 Ga0395898_0100416_1320_1757 144
563 3300037466 Ga0395898_0448174 Ga0395898_0448174_48_485 144
564 3300037471 Ga0395905_0000044 Ga0395905_0000044_46460_46915 144
565 3300037471 Ga0395905_0025968 Ga0395905_0025968_3214_3651 144
566 3300037471 Ga0395905_0170820 Ga0395905_0170820_1371_1808 144
567 3300037471 Ga0395905_0571850 Ga0395905_0571850_360_794 144
568 3300037471 Ga0395905_1002028 Ga0395905_1002028_79_513 144
569 3300037471 Ga0395905_1399582 Ga0395905_1399582_113_550 144
570 3300038443 Ga0395901_0000027 Ga0395901_0000027_46426_46881 144
571 3300038443 Ga0395901_0070966 Ga0395901_0070966_3175_3609 144
572 3300038443 Ga0395901_0802578 Ga0395901_0802578_58_492 144
573 3300038443 Ga0395901_0909233 Ga0395901_0909233_164_601 144
574 3300038443 Ga0395901_1012430 Ga0395901_1012430_234_671 144
575 3300041413 Ga0439465_0067865 Ga0439465_0067865_439_876 144
576 3300041443 Ga0451789_0670054 Ga0451789_0670054_167_604 144
577 3300041451 Ga0451791_0521251 Ga0451791_0521251_104_541 144
578 3300041498 Ga0451841_1448958 Ga0451841_1448958_98_535 144
579 3300041509 Ga0451843_1299145 Ga0451843_1299145_153_590 144
580 3300044658 Ga0466972_0081604 Ga0466972_0081604_928_1365 144
581 3300044658 Ga0466972_0084075 Ga0466972_0084075_929_1366 144
582 3300044901 Ga0466960_0103944 Ga0466960_0103944_343_780 144
583 3300045976 Ga0466967_0146013 Ga0466967_0146013_948_1385 144
584 3300046453 Ga0495627_079469 Ga0495627_079469_54_491 144
585 3300046460 Ga0495638_0020514 Ga0495638_0020514_459_893 144
586 3300046460 Ga0495638_0149097 Ga0495638_0149097_600_1037 144
587 3300046500 Ga0495596_0063053 Ga0495596_0063053_71_508 144
588 3300046515 Ga0495620_0155063 Ga0495620_0155063_161_598 144
589 3300046522 Ga0495643_0027101 Ga0495643_0027101_1754_2191 144
590 3300046524 Ga0495648_0263760 Ga0495648_0263760_224_661 144
591 3300046542 Ga0495597_0091470 Ga0495597_0091470_496_933 144
592 3300046616 Ga0495668_0480587 Ga0495668_0480587_88_525 144
593 3300046660 Ga0495625_0136982 Ga0495625_0136982_108_545 144
594 3300046665 Ga0495661_0074718 Ga0495661_0074718_678_1115 144
595 3300046692 Ga0495671_0237529 Ga0495671_0237529_257_694 144
596 3300047443 Ga0495687_036895 Ga0495687_036895_993_1430 144
597 3300047470 Ga0495681_0036625 Ga0495681_0036625_1315_1752 144
598 3300047472 Ga0495686_0502497 Ga0495686_0502497_45_482 144
599 3300048091 Ga0495626_0072888 Ga0495626_0072888_663_1100 144
600 3300048905 Ga0496102_0478895 Ga0496102_0478895_462_899 144
601 3300048905 Ga0496102_1309794 Ga0496102_1309794_192_626 144
602 3300048907 Ga0496104_0247446 Ga0496104_0247446_1213_1650 144
603 3300048908 Ga0496105_0150957 Ga0496105_0150957_387_824 144
604 3300048909 Ga0496106_0631278 Ga0496106_0631278_15_449 144
605 3300048915 Ga0496112_0508702 Ga0496112_0508702_94_528 144
606 3300048917 Ga0496114_0665698 Ga0496114_0665698_258_692 144
607 3300048918 Ga0496115_0622263 Ga0496115_0622263_60_494 144
608 3300048918 Ga0496115_1074922 Ga0496115_1074922_159_593 144
609 3300048921 Ga0496118_0055294 Ga0496118_0055294_1647_2081 144
610 3300048921 Ga0496118_0320634 Ga0496118_0320634_387_824 144
611 3300048922 Ga0496119_0019845 Ga0496119_0019845_1797_2234 144
612 3300048923 Ga0496120_0000615 Ga0496120_0000615_4008_4445 144
613 3300048924 Ga0496121_0540067 Ga0496121_0540067_148_582 144
614 3300048927 Ga0496124_0389764 Ga0496124_0389764_113_598 144
615 3300048929 Ga0496126_0199740 Ga0496126_0199740_842_1276 144
616 3300048929 Ga0496126_0343994 Ga0496126_0343994_116_550 144
617 3300049568 Ga0501031_0000007 Ga0501031_0000007_88442_88897 144
618 3300049569 Ga0501032_0000007 Ga0501032_0000007_77112_77567 144
619 3300049570 Ga0501033_0000040 Ga0501033_0000040_65020_65475 144
620 3300049571 Ga0501034_0000029 Ga0501034_0000029_176315_176770 144
621 3300049572 Ga0501036_0000004 Ga0501036_0000004_176315_176770 144
622 3300049573 Ga0501037_0000004 Ga0501037_0000004_77112_77567 144
623 3300049574 Ga0501038_0000005 Ga0501038_0000005_176315_176770 144
624 3300049575 Ga0501039_0000009 Ga0501039_0000009_176315_176770 144
625 3300049576 Ga0501040_0028623 Ga0501040_0028623_767_1222 144
626 3300049579 Ga0501043_0000595 Ga0501043_0000595_4816_5271 144
627 3300049580 Ga0501046_0059649 Ga0501046_0059649_454_909 144
628 3300049581 Ga0501047_0000393 Ga0501047_0000393_11390_11845 144
629 3300049586 Ga0501070_0101302 Ga0501070_0101302_1010_1465 144
630 3300049589 Ga0501073_0482926 Ga0501073_0482926_379_816 144
631 3300049822 Ga0501035_0000014 Ga0501035_0000014_176315_176770 144
632 3300049823 Ga0501044_0000012 Ga0501044_0000012_77112_77567 144
633 3300050489 nmdc:mga03683_174722_c1 nmdc:mga03683_174722_c1_533_967 144
634 3300050491 nmdc:mga00v17_177058_c1 nmdc:mga00v17_177058_c1_88_522 144
635 3300050491 nmdc:mga00v17_185368_c1 nmdc:mga00v17_185368_c1_232_669 144
636 3300050491 nmdc:mga00v17_95938_c1 nmdc:mga00v17_95938_c1_652_1086 144
637 3300050492 nmdc:mga0yw44_101105_c1 nmdc:mga0yw44_101105_c1_683_1120 144
638 3300050492 nmdc:mga0yw44_13235_c1 nmdc:mga0yw44_13235_c1_3751_4185 144
639 3300050492 nmdc:mga0yw44_157954_c1 nmdc:mga0yw44_157954_c1_162_596 144
640 3300050492 nmdc:mga0yw44_16176_c2 nmdc:mga0yw44_16176_c2_1720_2157 144
641 3300050492 nmdc:mga0yw44_496569_c1 nmdc:mga0yw44_496569_c1_350_784 144
642 3300050494 nmdc:mga06z11_117306_c1 nmdc:mga06z11_117306_c1_156_590 144
643 3300050494 nmdc:mga06z11_176488_c1 nmdc:mga06z11_176488_c1_448_885 144
644 3300050494 nmdc:mga06z11_327069_c1 nmdc:mga06z11_327069_c1_148_582 144
645 3300050494 nmdc:mga06z11_801948_c1 nmdc:mga06z11_801948_c1_120_557 144
646 3300050495 nmdc:mga04h51_217272_c1 nmdc:mga04h51_217272_c1_209_643 144
647 3300050496 nmdc:mga07m45_445859_c1 nmdc:mga07m45_445859_c1_162_596 144
648 3300050496 nmdc:mga07m45_534137_c1 nmdc:mga07m45_534137_c1_40_477 144
649 3300050516 nmdc:mga0sz30_194579_c1 nmdc:mga0sz30_194579_c1_346_780 144
650 3300050516 nmdc:mga0sz30_78840_c1 nmdc:mga0sz30_78840_c1_588_1025 144
651 3300053079 Ga0500610_0161479 Ga0500610_0161479_139_576 144
652 3300053083 Ga0495655_0017250 Ga0495655_0017250_893_1330 144
653 3300053083 Ga0495655_0055386 Ga0495655_0055386_258_692 144
654 3300053093 Ga0500651_0305257 Ga0500651_0305257_34_471 144
655 3300053116 Ga0500592_033587 Ga0500592_033587_49_486 144
656 3300053119 Ga0500595_054366 Ga0500595_054366_71_505 144
657 3300053139 Ga0500568_0000057 Ga0500568_0000057_72966_73403 144
658 3300053139 Ga0500568_0087590 Ga0500568_0087590_390_824 144
659 3300053151 Ga0500604_0038405 Ga0500604_0038405_579_1016 144
660 3300053153 Ga0500616_0009586 Ga0500616_0009586_3719_4153 144
661 3300053155 Ga0500620_000902 Ga0500620_000902_950_1387 144
662 3300053158 Ga0500627_0234165 Ga0500627_0234165_112_546 144

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpr-assembly1.cif.gz_A crystal structure of a luciferase domain from the dinoflagellate lingulodinium polyedrum 0.6799 75 113
1zwy-assembly3.cif.gz_B crystal structure of protein vc0702 from vibrio cholerae 0.6611 81 116
1zno-assembly1.cif.gz_A crystal structure of vc702 from vibrio cholerae, northeast structural genomics consortium target: vcp1 0.6583 81 116
1zwy-assembly2.cif.gz_C crystal structure of protein vc0702 from vibrio cholerae 0.6494 81 116
6k7d-assembly1.cif.gz_A crystal structure of mbpapo-tim21 fusion protein with a 16-residue helical linker 0.6445 68 113
ID Description Score Start End Superfamily
af_Q9SJ75_1_301_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8282 60 100 2.130.10.10
af_Q9LZQ2_16_265_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7622 77 120 2.120.10.80
af_A0A2R8Y4Y8_8_104_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.6982 67 100 2.60.40.3210
af_Q9VW10_141_673_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6717 61 110 2.130.10.10
af_Q9TXR7_108_213_3.10.450.320 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Mitochondrial import inner membrane translocase subunit Tim21 0.6593 67 111 3.10.450.320
ID Description Score Start End GO Terms
AF-A0A7U8PW94-F1-model_v4 Uncharacterized protein 0.9819 7 137
AF-A0A1H4ZGS8-F1-model_v4 Uncharacterized protein 0.979 7 137
AF-A0A256EYJ7-F1-model_v4 Uncharacterized protein 0.9755 7 141
AF-A0A1X0T2X6-F1-model_v4 Uncharacterized protein 0.9714 10 140
AF-A0A5P9K674-F1-model_v4 Uncharacterized protein 0.971 9 142

Feature Viewer

pLDDT pTM Quality
88.86 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map