F473440
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 363 | 660 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_816555_c1|nmdc:mga0n895_816555_c1_330_572 |
| Length | 80 |
| Sequence | MKNRLRVLRAERNWSQADLASHLGVSRQTVNSIENEKYDPSLPLAFDISRLFEQPIEAIFQPEPEPPGKAQQERSCDERQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 159 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 190 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 193 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 194 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 195 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 196 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 197 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 198 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 199 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 200 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 201 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 202 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 203 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 204 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 205 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 206 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 207 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 208 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 209 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 210 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 211 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 212 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 213 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 329 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 344 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 345 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 346 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 348 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 349 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 351 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 352 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 353 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 358 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 363 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.15 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.17 |
| Nodule | 0.61 |
| Rhizoplane | 1.21 |
| Rhizosphere | 83.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10024047 | 3300003320 | Bacteria | 6579 |
| 2 | Ga0055525_1000070 | 3300003759 | Bacteria | 183047 |
| 3 | Ga0055536_1001560 | 3300003781 | Bacteria | 13736 |
| 4 | Ga0055536_1005420 | 3300003781 | Bacteria | 6243 |
| 5 | Ga0055530_10000497 | 3300003791 | Bacteria | 34124 |
| 6 | Ga0055530_10002634 | 3300003791 | Bacteria | 11252 |
| 7 | Ga0055540_1014480 | 3300003792 | Bacteria | 2345 |
| 8 | Ga0055531_10010233 | 3300003794 | Bacteria | 4689 |
| 9 | Ga0065165_1000806 | 3300005262 | Bacteria | 41749 |
| 10 | Ga0065707_10854783 | 3300005295 | Bacteria | 575 |
| 11 | Ga0070658_10041757 | 3300005327 | Bacteria | 3701 |
| 12 | Ga0070658_10144065 | 3300005327 | Bacteria | 1991 |
| 13 | Ga0070658_10527030 | 3300005327 | Bacteria | 1022 |
| 14 | Ga0070676_10713696 | 3300005328 | Bacteria | 733 |
| 15 | Ga0070676_10840813 | 3300005328 | Bacteria | 680 |
| 16 | Ga0070683_101834240 | 3300005329 | Bacteria | 583 |
| 17 | Ga0070690_100047811 | 3300005330 | Bacteria | 2723 |
| 18 | Ga0070670_100077601 | 3300005331 | Bacteria | 2854 |
| 19 | Ga0070677_10421556 | 3300005333 | Bacteria | 708 |
| 20 | Ga0068869_100018317 | 3300005334 | Bacteria | 4765 |
| 21 | Ga0070680_100091889 | 3300005336 | Bacteria | 2513 |
| 22 | Ga0068868_100372121 | 3300005338 | Bacteria | 1228 |
| 23 | Ga0070660_100000511 | 3300005339 | Bacteria | 25935 |
| 24 | Ga0070660_100184949 | 3300005339 | Bacteria | 1687 |
| 25 | Ga0070660_101272861 | 3300005339 | Bacteria | 624 |
| 26 | Ga0070660_101797456 | 3300005339 | Bacteria | 522 |
| 27 | Ga0070689_100646074 | 3300005340 | Bacteria | 920 |
| 28 | Ga0070668_101529167 | 3300005347 | Bacteria | 610 |
| 29 | Ga0070669_102020223 | 3300005353 | Bacteria | 504 |
| 30 | Ga0070675_100174762 | 3300005354 | Bacteria | 1854 |
| 31 | Ga0070675_100908625 | 3300005354 | Bacteria | 807 |
| 32 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 33 | Ga0070659_101594428 | 3300005366 | Bacteria | 583 |
| 34 | Ga0070709_10555675 | 3300005434 | Unclassified | 879 |
| 35 | Ga0070714_100124662 | 3300005435 | Bacteria | 2295 |
| 36 | Ga0070714_100200072 | 3300005435 | Unclassified | 1827 |
| 37 | Ga0070713_100356448 | 3300005436 | Unclassified | 1358 |
| 38 | Ga0070705_101322456 | 3300005440 | Bacteria | 598 |
| 39 | Ga0070700_100834680 | 3300005441 | Unclassified | 745 |
| 40 | Ga0070694_100011869 | 3300005444 | Bacteria | 5404 |
| 41 | Ga0070708_100230586 | 3300005445 | Unclassified | 1737 |
| 42 | Ga0070678_100690117 | 3300005456 | Bacteria | 919 |
| 43 | Ga0070662_100594710 | 3300005457 | Bacteria | 930 |
| 44 | Ga0070681_10666649 | 3300005458 | Bacteria | 955 |
| 45 | Ga0068867_100083134 | 3300005459 | Bacteria | 2417 |
| 46 | Ga0068867_100282315 | 3300005459 | Bacteria | 1362 |
| 47 | Ga0070707_102229810 | 3300005468 | Unclassified | 515 |
| 48 | Ga0070698_100071714 | 3300005471 | Unclassified | 3473 |
| 49 | Ga0070684_100373980 | 3300005535 | Bacteria | 1312 |
| 50 | Ga0068853_100606598 | 3300005539 | Bacteria | 1040 |
| 51 | Ga0068853_101264286 | 3300005539 | Bacteria | 713 |
| 52 | Ga0070672_100414128 | 3300005543 | Bacteria | 1157 |
| 53 | Ga0070672_100620664 | 3300005543 | Bacteria | 943 |
| 54 | Ga0070696_101297291 | 3300005546 | Bacteria | 618 |
| 55 | Ga0070704_100030777 | 3300005549 | Unclassified | 3600 |
| 56 | Ga0070704_100646629 | 3300005549 | Bacteria | 933 |
| 57 | Ga0068855_100013193 | 3300005563 | Bacteria | 9968 |
| 58 | Ga0068855_100116656 | 3300005563 | Bacteria | 3060 |
| 59 | Ga0068855_100196722 | 3300005563 | Bacteria | 2271 |
| 60 | Ga0068855_100546955 | 3300005563 | Bacteria | 1254 |
| 61 | Ga0070664_100662898 | 3300005564 | Bacteria | 970 |
| 62 | Ga0068857_100212663 | 3300005577 | Bacteria | 1765 |
| 63 | Ga0068857_101104445 | 3300005577 | Bacteria | 766 |
| 64 | Ga0068856_100829647 | 3300005614 | Bacteria | 944 |
| 65 | Ga0068852_101788746 | 3300005616 | Bacteria | 637 |
| 66 | Ga0068859_101163573 | 3300005617 | Unclassified | 849 |
| 67 | Ga0068861_102246409 | 3300005719 | Bacteria | 547 |
| 68 | Ga0068861_102402597 | 3300005719 | Bacteria | 530 |
| 69 | Ga0068863_100044677 | 3300005841 | Bacteria | 4204 |
| 70 | Ga0068863_102038495 | 3300005841 | Bacteria | 584 |
| 71 | Ga0068860_100023746 | 3300005843 | Bacteria | 5928 |
| 72 | Ga0068860_100125586 | 3300005843 | Bacteria | 2459 |
| 73 | Ga0068862_101036340 | 3300005844 | Bacteria | 813 |
| 74 | Ga0070716_101170974 | 3300006173 | Bacteria | 616 |
| 75 | Ga0075366_10185123 | 3300006195 | Bacteria | 1265 |
| 76 | Ga0075366_10561221 | 3300006195 | Bacteria | 707 |
| 77 | Ga0075370_10917614 | 3300006353 | Bacteria | 536 |
| 78 | Ga0075428_101036436 | 3300006844 | Bacteria | 868 |
| 79 | Ga0075430_100193680 | 3300006846 | Bacteria | 1689 |
| 80 | Ga0075431_101113139 | 3300006847 | Bacteria | 754 |
| 81 | Ga0075429_100291085 | 3300006880 | Bacteria | 1430 |
| 82 | Ga0068865_100189477 | 3300006881 | Bacteria | 1589 |
| 83 | Ga0097620_101163354 | 3300006931 | Unclassified | 849 |
| 84 | Ga0079104_1022939 | 3300006946 | Bacteria | 1669 |
| 85 | Ga0079104_1038296 | 3300006946 | Bacteria | 1137 |
| 86 | Ga0075435_101381635 | 3300007076 | Bacteria | 617 |
| 87 | Ga0099794_10076507 | 3300007265 | Bacteria | 1645 |
| 88 | Ga0099794_10451681 | 3300007265 | Bacteria | 674 |
| 89 | Ga0105251_10038446 | 3300009011 | Bacteria | 2344 |
| 90 | Ga0105251_10057008 | 3300009011 | Bacteria | 1847 |
| 91 | Ga0105251_10116611 | 3300009011 | Bacteria | 1214 |
| 92 | Ga0105250_10001803 | 3300009092 | Bacteria | 11215 |
| 93 | Ga0105240_10065300 | 3300009093 | Bacteria | 4518 |
| 94 | Ga0105240_10195742 | 3300009093 | Bacteria | 2373 |
| 95 | Ga0105240_10427852 | 3300009093 | Bacteria | 1486 |
| 96 | Ga0105240_12414585 | 3300009093 | Bacteria | 544 |
| 97 | Ga0111539_10003004 | 3300009094 | Bacteria | 22363 |
| 98 | Ga0111539_12686020 | 3300009094 | Bacteria | 577 |
| 99 | Ga0105245_10063800 | 3300009098 | Bacteria | 3328 |
| 100 | Ga0105245_10355848 | 3300009098 | Bacteria | 1452 |
| 101 | Ga0105245_11201528 | 3300009098 | Bacteria | 806 |
| 102 | Ga0114129_10005995 | 3300009147 | Bacteria | 17223 |
| 103 | Ga0114129_10033069 | 3300009147 | Bacteria | 7309 |
| 104 | Ga0114129_12434619 | 3300009147 | Bacteria | 627 |
| 105 | Ga0105243_11092557 | 3300009148 | Bacteria | 805 |
| 106 | Ga0105242_10167926 | 3300009176 | Bacteria | 1926 |
| 107 | Ga0105242_11406385 | 3300009176 | Bacteria | 725 |
| 108 | Ga0105242_12716843 | 3300009176 | Bacteria | 545 |
| 109 | Ga0105237_10997139 | 3300009545 | Bacteria | 844 |
| 110 | Ga0105238_11190577 | 3300009551 | Bacteria | 786 |
| 111 | Ga0105238_11905137 | 3300009551 | Bacteria | 627 |
| 112 | Ga0105238_11915520 | 3300009551 | Bacteria | 626 |
| 113 | Ga0105238_12278678 | 3300009551 | Bacteria | 577 |
| 114 | Ga0105249_10421837 | 3300009553 | Bacteria | 1368 |
| 115 | Ga0105249_10906080 | 3300009553 | Bacteria | 949 |
| 116 | Ga0105249_12612958 | 3300009553 | Bacteria | 577 |
| 117 | Ga0105239_10219490 | 3300010375 | Bacteria | 2132 |
| 118 | Ga0105239_10638183 | 3300010375 | Bacteria | 1216 |
| 119 | Ga0105239_11900377 | 3300010375 | Bacteria | 690 |
| 120 | Ga0105246_10047321 | 3300011119 | Bacteria | 2937 |
| 121 | Ga0105246_11782373 | 3300011119 | Bacteria | 588 |
| 122 | Ga0157345_1000004 | 3300012498 | Bacteria | 80365 |
| 123 | Ga0157373_10592543 | 3300013100 | Bacteria | 806 |
| 124 | Ga0157373_11105377 | 3300013100 | Bacteria | 595 |
| 125 | Ga0157371_10100965 | 3300013102 | Bacteria | 2047 |
| 126 | Ga0157371_10151186 | 3300013102 | Bacteria | 1656 |
| 127 | Ga0157371_10410373 | 3300013102 | Bacteria | 992 |
| 128 | Ga0157371_10800311 | 3300013102 | Bacteria | 710 |
| 129 | Ga0157370_10070925 | 3300013104 | Bacteria | 3288 |
| 130 | Ga0157370_10085403 | 3300013104 | Bacteria | 2965 |
| 131 | Ga0157370_10266574 | 3300013104 | Bacteria | 1582 |
| 132 | Ga0157370_10480058 | 3300013104 | Bacteria | 1142 |
| 133 | Ga0157370_10693578 | 3300013104 | Bacteria | 929 |
| 134 | Ga0157370_10745089 | 3300013104 | Bacteria | 893 |
| 135 | Ga0157370_11524983 | 3300013104 | Bacteria | 601 |
| 136 | Ga0157369_10000286 | 3300013105 | Bacteria | 67677 |
| 137 | Ga0157369_10045234 | 3300013105 | Bacteria | 4789 |
| 138 | Ga0157369_10226243 | 3300013105 | Bacteria | 1957 |
| 139 | Ga0157369_11987240 | 3300013105 | Bacteria | 590 |
| 140 | Ga0157374_10001026 | 3300013296 | Bacteria | 24241 |
| 141 | Ga0157374_11733915 | 3300013296 | Bacteria | 649 |
| 142 | Ga0157378_10094847 | 3300013297 | Bacteria | 2717 |
| 143 | Ga0163162_10472910 | 3300013306 | Bacteria | 1385 |
| 144 | Ga0163162_11279787 | 3300013306 | Bacteria | 833 |
| 145 | Ga0157375_10098142 | 3300013308 | Bacteria | 3005 |
| 146 | Ga0157375_10228060 | 3300013308 | Bacteria | 2021 |
| 147 | Ga0157375_10824280 | 3300013308 | Bacteria | 1076 |
| 148 | Ga0163163_10051008 | 3300014325 | Bacteria | 4078 |
| 149 | Ga0157380_10084749 | 3300014326 | Bacteria | 2599 |
| 150 | Ga0157380_11316911 | 3300014326 | Bacteria | 770 |
| 151 | Ga0182008_10015262 | 3300014497 | Bacteria | 4010 |
| 152 | Ga0157377_10323589 | 3300014745 | Bacteria | 1025 |
| 153 | Ga0157377_11467735 | 3300014745 | Bacteria | 541 |
| 154 | Ga0157377_11619666 | 3300014745 | Bacteria | 519 |
| 155 | Ga0157376_11378395 | 3300014969 | Bacteria | 736 |
| 156 | Ga0182005_1008233 | 3300015265 | Bacteria | 3083 |
| 157 | Ga0163161_10059022 | 3300017792 | Bacteria | 2789 |
| 158 | Ga0163161_10123333 | 3300017792 | Bacteria | 1949 |
| 159 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 160 | Ga0209677_101505 | 3300025253 | Bacteria | 10000 |
| 161 | Ga0209676_1000138 | 3300025292 | Bacteria | 178932 |
| 162 | Ga0209676_1000832 | 3300025292 | Bacteria | 39998 |
| 163 | Ga0209564_1018162 | 3300025295 | Bacteria | 2696 |
| 164 | Ga0209758_1024949 | 3300025297 | Bacteria | 2643 |
| 165 | Ga0209050_1000121 | 3300025298 | Bacteria | 196019 |
| 166 | Ga0209050_1001184 | 3300025298 | Bacteria | 30681 |
| 167 | Ga0209050_1089822 | 3300025298 | Bacteria | 632 |
| 168 | Ga0207426_1068343 | 3300025302 | Bacteria | 999 |
| 169 | Ga0209051_1003081 | 3300025303 | Bacteria | 11251 |
| 170 | Ga0209257_1000125 | 3300025304 | Bacteria | 218126 |
| 171 | Ga0209257_1004893 | 3300025304 | Bacteria | 9889 |
| 172 | Ga0207696_1001491 | 3300025711 | Bacteria | 12591 |
| 173 | Ga0207696_1001893 | 3300025711 | Bacteria | 10684 |
| 174 | Ga0207655_1017725 | 3300025728 | Bacteria | 3826 |
| 175 | Ga0207713_1011282 | 3300025735 | Bacteria | 4872 |
| 176 | Ga0207688_10093713 | 3300025901 | Bacteria | 1727 |
| 177 | Ga0207680_10333177 | 3300025903 | Bacteria | 1063 |
| 178 | Ga0207645_10598417 | 3300025907 | Bacteria | 749 |
| 179 | Ga0207705_10131851 | 3300025909 | Bacteria | 1860 |
| 180 | Ga0207705_10666327 | 3300025909 | Bacteria | 809 |
| 181 | Ga0207695_10021692 | 3300025913 | Bacteria | 7321 |
| 182 | Ga0207695_10273993 | 3300025913 | Bacteria | 1582 |
| 183 | Ga0207649_10521825 | 3300025920 | Bacteria | 906 |
| 184 | Ga0207659_10806204 | 3300025926 | Bacteria | 807 |
| 185 | Ga0207687_10168964 | 3300025927 | Bacteria | 1685 |
| 186 | Ga0207687_11890201 | 3300025927 | Bacteria | 510 |
| 187 | Ga0207700_11411762 | 3300025928 | Unclassified | 619 |
| 188 | Ga0207664_10537005 | 3300025929 | Bacteria | 1049 |
| 189 | Ga0207664_11394254 | 3300025929 | Bacteria | 621 |
| 190 | Ga0207690_10542574 | 3300025932 | Bacteria | 945 |
| 191 | Ga0207690_10775006 | 3300025932 | Bacteria | 792 |
| 192 | Ga0207690_11402617 | 3300025932 | Bacteria | 584 |
| 193 | Ga0207706_10051270 | 3300025933 | Bacteria | 3644 |
| 194 | Ga0207706_10509011 | 3300025933 | Bacteria | 1039 |
| 195 | Ga0207686_10014800 | 3300025934 | Bacteria | 4352 |
| 196 | Ga0207709_10855210 | 3300025935 | Bacteria | 737 |
| 197 | Ga0207670_10035207 | 3300025936 | Bacteria | 3245 |
| 198 | Ga0207691_10347548 | 3300025940 | Bacteria | 1269 |
| 199 | Ga0207689_10014590 | 3300025942 | Bacteria | 6680 |
| 200 | Ga0207679_10487440 | 3300025945 | Bacteria | 1098 |
| 201 | Ga0207667_10027912 | 3300025949 | Bacteria | 6135 |
| 202 | Ga0207667_10122051 | 3300025949 | Bacteria | 2685 |
| 203 | Ga0207668_11822885 | 3300025972 | Bacteria | 549 |
| 204 | Ga0207640_10760949 | 3300025981 | Bacteria | 836 |
| 205 | Ga0207640_10834947 | 3300025981 | Bacteria | 801 |
| 206 | Ga0207658_10057884 | 3300025986 | Bacteria | 2882 |
| 207 | Ga0207677_11217232 | 3300026023 | Bacteria | 690 |
| 208 | Ga0207639_11665174 | 3300026041 | Bacteria | 598 |
| 209 | Ga0207678_11042401 | 3300026067 | Bacteria | 724 |
| 210 | Ga0207648_10145160 | 3300026089 | Bacteria | 2093 |
| 211 | Ga0207648_10306461 | 3300026089 | Bacteria | 1425 |
| 212 | Ga0207648_11901496 | 3300026089 | Bacteria | 557 |
| 213 | Ga0207674_10112152 | 3300026116 | Bacteria | 2701 |
| 214 | Ga0207674_10160449 | 3300026116 | Bacteria | 2203 |
| 215 | Ga0207674_12126336 | 3300026116 | Bacteria | 525 |
| 216 | Ga0207675_102093909 | 3300026118 | Bacteria | 582 |
| 217 | Ga0207698_10324361 | 3300026142 | Bacteria | 1444 |
| 218 | Ga0209281_1002352 | 3300027111 | Bacteria | 7794 |
| 219 | Ga0209281_1020171 | 3300027111 | Bacteria | 1307 |
| 220 | Ga0207428_10007515 | 3300027907 | Bacteria | 9928 |
| 221 | Ga0268266_12292251 | 3300028379 | Bacteria | 511 |
| 222 | Ga0268265_10456238 | 3300028380 | Bacteria | 1195 |
| 223 | Ga0268265_10772792 | 3300028380 | Bacteria | 934 |
| 224 | Ga0268264_10027029 | 3300028381 | Bacteria | 4687 |
| 225 | Ga0268264_10961468 | 3300028381 | Bacteria | 859 |
| 226 | Ga0265334_10120105 | 3300028573 | Bacteria | 939 |
| 227 | Ga0307515_10143053 | 3300028794 | Bacteria | 2552 |
| 228 | Ga0307515_10725384 | 3300028794 | Bacteria | 611 |
| 229 | Ga0265338_10017848 | 3300028800 | Bacteria | 7628 |
| 230 | Ga0265338_10024196 | 3300028800 | Bacteria | 6213 |
| 231 | Ga0265338_10248139 | 3300028800 | Bacteria | 1315 |
| 232 | Ga0265760_10082623 | 3300031090 | Bacteria | 997 |
| 233 | Ga0265330_10132270 | 3300031235 | Bacteria | 1062 |
| 234 | Ga0265332_10324326 | 3300031238 | Bacteria | 635 |
| 235 | Ga0265328_10099047 | 3300031239 | Bacteria | 1079 |
| 236 | Ga0265325_10435894 | 3300031241 | Unclassified | 572 |
| 237 | Ga0265340_10382617 | 3300031247 | Viruses | 621 |
| 238 | Ga0265339_10000687 | 3300031249 | Bacteria | 26098 |
| 239 | Ga0265331_10137810 | 3300031250 | Bacteria | 1111 |
| 240 | Ga0265316_10005832 | 3300031344 | Bacteria | 11874 |
| 241 | Ga0265316_10006068 | 3300031344 | Bacteria | 11599 |
| 242 | Ga0307408_100186082 | 3300031548 | Bacteria | 1669 |
| 243 | Ga0265313_10176595 | 3300031595 | Bacteria | 899 |
| 244 | Ga0316579_10140335 | 3300031691 | Bacteria | 1165 |
| 245 | Ga0265314_10312354 | 3300031711 | Bacteria | 877 |
| 246 | Ga0265342_10006636 | 3300031712 | Bacteria | 8589 |
| 247 | Ga0265342_10189658 | 3300031712 | Bacteria | 1122 |
| 248 | Ga0316576_10034516 | 3300031727 | Bacteria | 3605 |
| 249 | Ga0316576_10404515 | 3300031727 | Bacteria | 1011 |
| 250 | Ga0316578_10728232 | 3300031728 | Unclassified | 577 |
| 251 | Ga0307516_10053106 | 3300031730 | Bacteria | 3964 |
| 252 | Ga0307405_10158536 | 3300031731 | Bacteria | 1600 |
| 253 | Ga0307405_10447808 | 3300031731 | Unclassified | 1023 |
| 254 | Ga0316577_10174379 | 3300031733 | Bacteria | 1214 |
| 255 | Ga0307413_11382408 | 3300031824 | Unclassified | 619 |
| 256 | Ga0307406_10503824 | 3300031901 | Bacteria | 982 |
| 257 | Ga0307406_10524753 | 3300031901 | Bacteria | 964 |
| 258 | Ga0307407_10071060 | 3300031903 | Bacteria | 2071 |
| 259 | Ga0307407_11284157 | 3300031903 | Bacteria | 574 |
| 260 | Ga0307412_10231256 | 3300031911 | Unclassified | 1424 |
| 261 | Ga0307412_10295882 | 3300031911 | Bacteria | 1277 |
| 262 | Ga0307412_10679188 | 3300031911 | Bacteria | 881 |
| 263 | Ga0307412_11662562 | 3300031911 | Bacteria | 584 |
| 264 | Ga0307409_100561794 | 3300031995 | Bacteria | 1122 |
| 265 | Ga0307409_102392622 | 3300031995 | Bacteria | 557 |
| 266 | Ga0307409_102469495 | 3300031995 | Bacteria | 548 |
| 267 | Ga0307416_100606929 | 3300032002 | Unclassified | 1175 |
| 268 | Ga0307414_10104491 | 3300032004 | Bacteria | 2139 |
| 269 | Ga0307414_10365980 | 3300032004 | Bacteria | 1242 |
| 270 | Ga0307414_10617061 | 3300032004 | Bacteria | 974 |
| 271 | Ga0307411_10009261 | 3300032005 | Bacteria | 5163 |
| 272 | Ga0307411_10567117 | 3300032005 | Bacteria | 971 |
| 273 | Ga0307415_100850887 | 3300032126 | Bacteria | 837 |
| 274 | Ga0316580_10003837 | 3300032139 | Bacteria | 4309 |
| 275 | Ga0307510_10010763 | 3300033180 | Bacteria | 10879 |
| 276 | Ga0316212_1051398 | 3300033547 | Bacteria | 587 |
| 277 | Ga0373934_0026017 | 3300035086 | Bacteria | 2269 |
| 278 | Ga0373956_0045320 | 3300035119 | Unclassified | 1962 |
| 279 | Ga0373957_0041997 | 3300035120 | Unclassified | 1724 |
| 280 | Ga0373955_0287772 | 3300035172 | Bacteria | 989 |
| 281 | Ga0373961_0000144 | 3300035241 | Bacteria | 34810 |
| 282 | Ga0316574_0087492 | 3300035398 | Bacteria | 1984 |
| 283 | Ga0373924_0018038 | 3300035410 | Bacteria | 2716 |
| 284 | Ga0373935_0011040 | 3300035692 | Bacteria | 5427 |
| 285 | Ga0373935_0069521 | 3300035692 | Bacteria | 2268 |
| 286 | Ga0373927_0373784 | 3300035695 | Bacteria | 940 |
| 287 | Ga0373927_0589543 | 3300035695 | Bacteria | 735 |
| 288 | Ga0373937_0002374 | 3300036401 | Bacteria | 15671 |
| 289 | Ga0316582_0668945 | 3300036647 | Unclassified | 714 |
| 290 | Ga0316584_0133892 | 3300036712 | Bacteria | 1851 |
| 291 | Ga0316584_0459503 | 3300036712 | Bacteria | 899 |
| 292 | Ga0395905_1032376 | 3300037471 | Bacteria | 725 |
| 293 | Ga0395905_1192681 | 3300037471 | Bacteria | 665 |
| 294 | Ga0436360_0809450 | 3300039438 | Bacteria | 1088 |
| 295 | Ga0436360_0822581 | 3300039438 | Bacteria | 1241 |
| 296 | Ga0436362_0544016 | 3300039453 | Bacteria | 842 |
| 297 | Ga0439438_006478 | 3300041405 | Bacteria | 4120 |
| 298 | Ga0439447_023816 | 3300041407 | Bacteria | 1591 |
| 299 | Ga0451807_0089940 | 3300041486 | Bacteria | 1582 |
| 300 | Ga0451835_0461422 | 3300041492 | Bacteria | 905 |
| 301 | Ga0451837_0202422 | 3300041494 | Bacteria | 738 |
| 302 | Ga0451841_0847936 | 3300041498 | Bacteria | 618 |
| 303 | Ga0451847_0762432 | 3300041503 | Bacteria | 1390 |
| 304 | Ga0451851_0935334 | 3300041507 | Bacteria | 746 |
| 305 | Ga0451855_1322555 | 3300041511 | Bacteria | 728 |
| 306 | Ga0451855_1732057 | 3300041511 | Bacteria | 503 |
| 307 | Ga0451853_0449395 | 3300041512 | Bacteria | 507 |
| 308 | Ga0451853_2292328 | 3300041512 | Bacteria | 1556 |
| 309 | Ga0439445_0045000 | 3300042004 | Bacteria | 1180 |
| 310 | Ga0439432_028822 | 3300042006 | Bacteria | 1806 |
| 311 | Ga0439432_040469 | 3300042006 | Bacteria | 1478 |
| 312 | Ga0439452_028068 | 3300042010 | Bacteria | 1407 |
| 313 | Ga0439456_020350 | 3300042013 | Bacteria | 1399 |
| 314 | Ga0439463_058242 | 3300042016 | Bacteria | 987 |
| 315 | Ga0450911_016424 | 3300042115 | Bacteria | 977 |
| 316 | Ga0450900_001423 | 3300042136 | Bacteria | 2329 |
| 317 | Ga0450902_006363 | 3300042137 | Bacteria | 1809 |
| 318 | Ga0450903_007678 | 3300042138 | Bacteria | 1770 |
| 319 | Ga0450905_021159 | 3300042142 | Bacteria | 960 |
| 320 | Ga0450889_017003 | 3300042144 | Bacteria | 788 |
| 321 | Ga0450907_006503 | 3300042146 | Bacteria | 1954 |
| 322 | Ga0450916_019682 | 3300042530 | Bacteria | 918 |
| 323 | Ga0450893_0009319 | 3300042532 | Bacteria | 1602 |
| 324 | Ga0450893_0122840 | 3300042532 | Bacteria | 543 |
| 325 | Ga0453683_0943569 | 3300044673 | Bacteria | 571 |
| 326 | Ga0466965_0054912 | 3300044683 | Bacteria | 1981 |
| 327 | Ga0466966_0011392 | 3300044684 | Bacteria | 5897 |
| 328 | Ga0466966_0116555 | 3300044684 | Bacteria | 1644 |
| 329 | Ga0466961_0075938 | 3300044693 | Bacteria | 2129 |
| 330 | Ga0466964_0010049 | 3300044706 | Bacteria | 3565 |
| 331 | Ga0453684_0023941 | 3300044712 | Bacteria | 8954 |
| 332 | Ga0453684_0179887 | 3300044712 | Bacteria | 2483 |
| 333 | Ga0466971_0216582 | 3300044719 | Bacteria | 906 |
| 334 | Ga0466968_0023356 | 3300044735 | Bacteria | 2518 |
| 335 | Ga0466970_0515347 | 3300044765 | Bacteria | 689 |
| 336 | Ga0466957_0106104 | 3300044842 | Bacteria | 1776 |
| 337 | Ga0466957_0176931 | 3300044842 | Bacteria | 1392 |
| 338 | Ga0466960_0339170 | 3300044901 | Bacteria | 855 |
| 339 | Ga0466959_0039972 | 3300045049 | Bacteria | 3466 |
| 340 | Ga0466959_0769367 | 3300045049 | Bacteria | 644 |
| 341 | Ga0451576_0213695 | 3300045051 | Bacteria | 2014 |
| 342 | Ga0451576_1215356 | 3300045051 | Bacteria | 787 |
| 343 | Ga0451576_1870407 | 3300045051 | Bacteria | 620 |
| 344 | Ga0451576_2314195 | 3300045051 | Unclassified | 550 |
| 345 | Ga0451576_2321386 | 3300045051 | Unclassified | 550 |
| 346 | Ga0466958_0890514 | 3300045836 | Bacteria | 580 |
| 347 | Ga0466967_0009535 | 3300045976 | Bacteria | 7210 |
| 348 | Ga0466967_1607267 | 3300045976 | Unclassified | 647 |
| 349 | Ga0466967_2151676 | 3300045976 | Bacteria | 554 |
| 350 | Ga0495617_000484 | 3300046452 | Bacteria | 21177 |
| 351 | Ga0495617_061067 | 3300046452 | Bacteria | 1246 |
| 352 | Ga0495617_086658 | 3300046452 | Bacteria | 1024 |
| 353 | Ga0495617_097426 | 3300046452 | Bacteria | 957 |
| 354 | Ga0495627_000101 | 3300046453 | Bacteria | 105414 |
| 355 | Ga0495627_000256 | 3300046453 | Bacteria | 54510 |
| 356 | Ga0495627_005742 | 3300046453 | Bacteria | 4953 |
| 357 | Ga0495627_010736 | 3300046453 | Bacteria | 3315 |
| 358 | Ga0495592_0063081 | 3300046454 | Bacteria | 2718 |
| 359 | Ga0495603_0068327 | 3300046455 | Unclassified | 2091 |
| 360 | Ga0495603_0561847 | 3300046455 | Bacteria | 653 |
| 361 | Ga0495590_0005196 | 3300046457 | Bacteria | 5173 |
| 362 | Ga0495590_0044692 | 3300046457 | Bacteria | 1544 |
| 363 | Ga0495590_0195284 | 3300046457 | Bacteria | 742 |
| 364 | Ga0495591_000032 | 3300046458 | Bacteria | 176337 |
| 365 | Ga0495591_000082 | 3300046458 | Bacteria | 107579 |
| 366 | Ga0495591_000120 | 3300046458 | Bacteria | 86214 |
| 367 | Ga0495591_017809 | 3300046458 | Bacteria | 2427 |
| 368 | Ga0495591_037727 | 3300046458 | Bacteria | 1396 |
| 369 | Ga0495591_147101 | 3300046458 | Bacteria | 566 |
| 370 | Ga0495591_163458 | 3300046458 | Bacteria | 532 |
| 371 | Ga0495638_0000387 | 3300046460 | Bacteria | 54475 |
| 372 | Ga0495638_0000449 | 3300046460 | Bacteria | 49303 |
| 373 | Ga0495638_0005523 | 3300046460 | Bacteria | 9389 |
| 374 | Ga0495638_0035510 | 3300046460 | Bacteria | 3177 |
| 375 | Ga0495638_0043562 | 3300046460 | Bacteria | 2830 |
| 376 | Ga0495638_0167622 | 3300046460 | Bacteria | 1262 |
| 377 | Ga0495638_0604717 | 3300046460 | Bacteria | 538 |
| 378 | Ga0495653_0035570 | 3300046463 | Bacteria | 3928 |
| 379 | Ga0495653_0109156 | 3300046463 | Bacteria | 1991 |
| 380 | Ga0495650_0000940 | 3300046471 | Bacteria | 33781 |
| 381 | Ga0495650_0009217 | 3300046471 | Bacteria | 5645 |
| 382 | Ga0495650_0022904 | 3300046471 | Bacteria | 2985 |
| 383 | Ga0495650_0025311 | 3300046471 | Bacteria | 2785 |
| 384 | Ga0495650_0043435 | 3300046471 | Bacteria | 1907 |
| 385 | Ga0495650_0135911 | 3300046471 | Bacteria | 893 |
| 386 | Ga0495580_0437056 | 3300046472 | Bacteria | 879 |
| 387 | Ga0495582_0096427 | 3300046473 | Unclassified | 1653 |
| 388 | Ga0495605_0000147 | 3300046474 | Bacteria | 90988 |
| 389 | Ga0495605_0034354 | 3300046474 | Bacteria | 2567 |
| 390 | Ga0495605_0418719 | 3300046474 | Bacteria | 555 |
| 391 | Ga0495639_0403076 | 3300046475 | Bacteria | 691 |
| 392 | Ga0495662_0679486 | 3300046476 | Bacteria | 502 |
| 393 | Ga0495584_0014100 | 3300046491 | Bacteria | 4072 |
| 394 | Ga0495585_0000234 | 3300046492 | Bacteria | 57324 |
| 395 | Ga0495585_0003811 | 3300046492 | Bacteria | 10041 |
| 396 | Ga0495585_0020869 | 3300046492 | Bacteria | 3764 |
| 397 | Ga0495585_0369397 | 3300046492 | Bacteria | 694 |
| 398 | Ga0495585_0464591 | 3300046492 | Bacteria | 604 |
| 399 | Ga0495594_0065163 | 3300046499 | Unclassified | 2021 |
| 400 | Ga0495596_0051284 | 3300046500 | Bacteria | 1616 |
| 401 | Ga0495596_0250547 | 3300046500 | Bacteria | 687 |
| 402 | Ga0495607_0000603 | 3300046501 | Bacteria | 35007 |
| 403 | Ga0495607_0053808 | 3300046501 | Bacteria | 2323 |
| 404 | Ga0495607_0123450 | 3300046501 | Bacteria | 1356 |
| 405 | Ga0495583_0000018 | 3300046506 | Bacteria | 306541 |
| 406 | Ga0495583_0014877 | 3300046506 | Bacteria | 4260 |
| 407 | Ga0495583_0198120 | 3300046506 | Bacteria | 817 |
| 408 | Ga0495606_0003207 | 3300046507 | Bacteria | 17626 |
| 409 | Ga0495606_0006281 | 3300046507 | Bacteria | 11021 |
| 410 | Ga0495606_0007373 | 3300046507 | Bacteria | 9870 |
| 411 | Ga0495606_0164399 | 3300046507 | Bacteria | 1292 |
| 412 | Ga0495606_0183965 | 3300046507 | Bacteria | 1202 |
| 413 | Ga0495606_0261848 | 3300046507 | Bacteria | 954 |
| 414 | Ga0495606_0314617 | 3300046507 | Bacteria | 843 |
| 415 | Ga0495608_0199814 | 3300046511 | Bacteria | 1260 |
| 416 | Ga0495610_0000056 | 3300046512 | Bacteria | 138703 |
| 417 | Ga0495610_0000133 | 3300046512 | Bacteria | 82356 |
| 418 | Ga0495610_0000173 | 3300046512 | Bacteria | 72402 |
| 419 | Ga0495610_0000220 | 3300046512 | Bacteria | 61190 |
| 420 | Ga0495610_0002390 | 3300046512 | Bacteria | 15805 |
| 421 | Ga0495610_0003946 | 3300046512 | Bacteria | 11235 |
| 422 | Ga0495610_0115398 | 3300046512 | Bacteria | 1184 |
| 423 | Ga0495616_0001757 | 3300046513 | Bacteria | 14739 |
| 424 | Ga0495616_0009481 | 3300046513 | Bacteria | 5686 |
| 425 | Ga0495616_0126042 | 3300046513 | Bacteria | 1177 |
| 426 | Ga0495616_0272256 | 3300046513 | Bacteria | 721 |
| 427 | Ga0495620_0011877 | 3300046515 | Bacteria | 4526 |
| 428 | Ga0495620_0020652 | 3300046515 | Bacteria | 3214 |
| 429 | Ga0495620_0026416 | 3300046515 | Bacteria | 2731 |
| 430 | Ga0495620_0121396 | 3300046515 | Bacteria | 1029 |
| 431 | Ga0495620_0351896 | 3300046515 | Bacteria | 558 |
| 432 | Ga0495620_0389876 | 3300046515 | Bacteria | 527 |
| 433 | Ga0495630_0847632 | 3300046517 | Bacteria | 697 |
| 434 | Ga0495631_0000013 | 3300046518 | Bacteria | 109794 |
| 435 | Ga0495631_0005679 | 3300046518 | Bacteria | 6509 |
| 436 | Ga0495631_0020958 | 3300046518 | Bacteria | 3047 |
| 437 | Ga0495632_0002535 | 3300046519 | Bacteria | 13843 |
| 438 | Ga0495632_0023186 | 3300046519 | Bacteria | 3317 |
| 439 | Ga0495632_0045071 | 3300046519 | Bacteria | 2198 |
| 440 | Ga0495632_0073255 | 3300046519 | Bacteria | 1642 |
| 441 | Ga0495632_0232721 | 3300046519 | Bacteria | 830 |
| 442 | Ga0495637_0000855 | 3300046520 | Bacteria | 19898 |
| 443 | Ga0495637_0004752 | 3300046520 | Bacteria | 7005 |
| 444 | Ga0495637_0026055 | 3300046520 | Bacteria | 2630 |
| 445 | Ga0495643_0000396 | 3300046522 | Bacteria | 57359 |
| 446 | Ga0495643_0042273 | 3300046522 | Bacteria | 2483 |
| 447 | Ga0495643_0062766 | 3300046522 | Bacteria | 1966 |
| 448 | Ga0495644_0005850 | 3300046523 | Bacteria | 4804 |
| 449 | Ga0495648_0000259 | 3300046524 | Bacteria | 59999 |
| 450 | Ga0495648_0006035 | 3300046524 | Bacteria | 9942 |
| 451 | Ga0495648_0127771 | 3300046524 | Bacteria | 1355 |
| 452 | Ga0495648_0210936 | 3300046524 | Bacteria | 965 |
| 453 | Ga0495666_0022607 | 3300046526 | Bacteria | 3114 |
| 454 | Ga0495652_0319289 | 3300046529 | Bacteria | 1123 |
| 455 | Ga0495654_0000104 | 3300046530 | Bacteria | 95266 |
| 456 | Ga0495654_0009881 | 3300046530 | Bacteria | 5214 |
| 457 | Ga0495654_0105705 | 3300046530 | Bacteria | 1290 |
| 458 | Ga0495654_0106165 | 3300046530 | Bacteria | 1286 |
| 459 | Ga0495654_0106167 | 3300046530 | Bacteria | 1286 |
| 460 | Ga0495586_0518481 | 3300046535 | Bacteria | 688 |
| 461 | Ga0495587_0202399 | 3300046536 | Bacteria | 1123 |
| 462 | Ga0495609_0000879 | 3300046538 | Bacteria | 21988 |
| 463 | Ga0495609_0007370 | 3300046538 | Bacteria | 5500 |
| 464 | Ga0495609_0007402 | 3300046538 | Bacteria | 5485 |
| 465 | Ga0495609_0019094 | 3300046538 | Bacteria | 3173 |
| 466 | Ga0495609_0428857 | 3300046538 | Bacteria | 527 |
| 467 | Ga0495597_0000965 | 3300046542 | Bacteria | 22210 |
| 468 | Ga0495597_0080344 | 3300046542 | Bacteria | 1395 |
| 469 | Ga0495622_0000047 | 3300046557 | Bacteria | 109638 |
| 470 | Ga0495633_0000304 | 3300046558 | Bacteria | 55996 |
| 471 | Ga0495668_0002358 | 3300046616 | Bacteria | 15711 |
| 472 | Ga0495668_0004517 | 3300046616 | Bacteria | 9846 |
| 473 | Ga0495668_0019393 | 3300046616 | Bacteria | 3921 |
| 474 | Ga0495668_0037958 | 3300046616 | Bacteria | 2693 |
| 475 | Ga0495668_0464086 | 3300046616 | Bacteria | 697 |
| 476 | Ga0495634_0043669 | 3300046642 | Bacteria | 3037 |
| 477 | Ga0495634_0653411 | 3300046642 | Bacteria | 607 |
| 478 | Ga0495611_0000024 | 3300046648 | Bacteria | 118898 |
| 479 | Ga0495611_0064734 | 3300046648 | Bacteria | 1665 |
| 480 | Ga0495611_0085640 | 3300046648 | Bacteria | 1453 |
| 481 | Ga0495625_0000103 | 3300046660 | Bacteria | 136109 |
| 482 | Ga0495625_0002403 | 3300046660 | Bacteria | 20297 |
| 483 | Ga0495625_0012052 | 3300046660 | Bacteria | 7015 |
| 484 | Ga0495625_0026327 | 3300046660 | Bacteria | 4396 |
| 485 | Ga0495625_0028552 | 3300046660 | Bacteria | 4183 |
| 486 | Ga0495625_0175376 | 3300046660 | Bacteria | 1429 |
| 487 | Ga0495625_0250952 | 3300046660 | Bacteria | 1148 |
| 488 | Ga0495625_0407322 | 3300046660 | Bacteria | 848 |
| 489 | Ga0495635_0798414 | 3300046663 | Bacteria | 608 |
| 490 | Ga0495661_0059049 | 3300046665 | Bacteria | 2284 |
| 491 | Ga0495661_0099410 | 3300046665 | Bacteria | 1640 |
| 492 | Ga0495588_0009849 | 3300046674 | Bacteria | 4431 |
| 493 | Ga0495647_0012185 | 3300046681 | Unclassified | 2958 |
| 494 | Ga0495669_0009409 | 3300046684 | Bacteria | 4119 |
| 495 | Ga0495613_0001739 | 3300046689 | Bacteria | 16574 |
| 496 | Ga0495624_0097110 | 3300046690 | Bacteria | 1815 |
| 497 | Ga0495671_0000541 | 3300046692 | Bacteria | 28528 |
| 498 | Ga0495671_0000799 | 3300046692 | Bacteria | 22506 |
| 499 | Ga0495671_0008285 | 3300046692 | Bacteria | 5853 |
| 500 | Ga0495671_0082623 | 3300046692 | Bacteria | 1574 |
| 501 | Ga0495671_0139594 | 3300046692 | Bacteria | 1181 |
| 502 | Ga0495649_0001823 | 3300046694 | Bacteria | 15652 |
| 503 | Ga0495649_0002309 | 3300046694 | Bacteria | 13533 |
| 504 | Ga0495649_0005390 | 3300046694 | Bacteria | 8143 |
| 505 | Ga0495649_0007150 | 3300046694 | Bacteria | 6854 |
| 506 | Ga0495649_0096780 | 3300046694 | Bacteria | 1570 |
| 507 | Ga0495589_0016461 | 3300046794 | Bacteria | 3801 |
| 508 | Ga0495589_0161687 | 3300046794 | Bacteria | 1066 |
| 509 | Ga0495589_0589663 | 3300046794 | Bacteria | 506 |
| 510 | Ga0495600_0017941 | 3300046809 | Bacteria | 4505 |
| 511 | Ga0495660_0000785 | 3300046810 | Bacteria | 23782 |
| 512 | Ga0495660_0002576 | 3300046810 | Bacteria | 11514 |
| 513 | Ga0495660_0012681 | 3300046810 | Bacteria | 4891 |
| 514 | Ga0495660_0108915 | 3300046810 | Bacteria | 1415 |
| 515 | Ga0495660_0200672 | 3300046810 | Bacteria | 952 |
| 516 | Ga0495660_0369883 | 3300046810 | Bacteria | 634 |
| 517 | Ga0495581_0053318 | 3300047315 | Unclassified | 2336 |
| 518 | Ga0495604_0026516 | 3300047317 | Bacteria | 4612 |
| 519 | Ga0495672_0003554 | 3300047320 | Bacteria | 13271 |
| 520 | Ga0495672_0003653 | 3300047320 | Bacteria | 13028 |
| 521 | Ga0495672_0015739 | 3300047320 | Bacteria | 5124 |
| 522 | Ga0495672_0034996 | 3300047320 | Bacteria | 3096 |
| 523 | Ga0495676_0002653 | 3300047321 | Bacteria | 16007 |
| 524 | Ga0495676_0024971 | 3300047321 | Bacteria | 5164 |
| 525 | Ga0495680_0005627 | 3300047322 | Bacteria | 11740 |
| 526 | Ga0495683_0011172 | 3300047323 | Bacteria | 4732 |
| 527 | Ga0495683_0097371 | 3300047323 | Bacteria | 1418 |
| 528 | Ga0495683_0410447 | 3300047323 | Bacteria | 561 |
| 529 | Ga0495679_000612 | 3300047446 | Bacteria | 24130 |
| 530 | Ga0495679_004870 | 3300047446 | Bacteria | 6061 |
| 531 | Ga0495679_007852 | 3300047446 | Bacteria | 4398 |
| 532 | Ga0495679_165567 | 3300047446 | Bacteria | 589 |
| 533 | Ga0495673_0002039 | 3300047469 | Bacteria | 14802 |
| 534 | Ga0495673_0007069 | 3300047469 | Bacteria | 6510 |
| 535 | Ga0495673_0008887 | 3300047469 | Bacteria | 5601 |
| 536 | Ga0495673_0010193 | 3300047469 | Bacteria | 5132 |
| 537 | Ga0495673_0036415 | 3300047469 | Bacteria | 2258 |
| 538 | Ga0495673_0045651 | 3300047469 | Bacteria | 1946 |
| 539 | Ga0495681_0000065 | 3300047470 | Bacteria | 97979 |
| 540 | Ga0495681_0000231 | 3300047470 | Bacteria | 46423 |
| 541 | Ga0495684_0010927 | 3300047471 | Bacteria | 7018 |
| 542 | Ga0495686_0002204 | 3300047472 | Bacteria | 18924 |
| 543 | Ga0495686_0014125 | 3300047472 | Bacteria | 5507 |
| 544 | Ga0495686_0014265 | 3300047472 | Bacteria | 5474 |
| 545 | Ga0495686_0325028 | 3300047472 | Bacteria | 842 |
| 546 | Ga0495686_0465101 | 3300047472 | Bacteria | 670 |
| 547 | Ga0495593_0514495 | 3300047673 | Bacteria | 600 |
| 548 | Ga0495602_0121621 | 3300048088 | Bacteria | 2099 |
| 549 | Ga0495626_0000074 | 3300048091 | Bacteria | 132552 |
| 550 | Ga0495626_0007211 | 3300048091 | Bacteria | 6212 |
| 551 | Ga0495626_0010037 | 3300048091 | Bacteria | 5079 |
| 552 | Ga0495626_0076279 | 3300048091 | Bacteria | 1496 |
| 553 | Ga0495626_0096151 | 3300048091 | Bacteria | 1296 |
| 554 | Ga0496105_1402681 | 3300048908 | Bacteria | 506 |
| 555 | Ga0496106_0145361 | 3300048909 | Bacteria | 1867 |
| 556 | Ga0496106_0193863 | 3300048909 | Bacteria | 1616 |
| 557 | Ga0496107_0000073 | 3300048910 | Bacteria | 48489 |
| 558 | Ga0496110_0208449 | 3300048913 | Bacteria | 1776 |
| 559 | Ga0496115_0340473 | 3300048918 | Bacteria | 1224 |
| 560 | Ga0496115_0484381 | 3300048918 | Bacteria | 996 |
| 561 | Ga0496116_0001015 | 3300048919 | Bacteria | 34238 |
| 562 | Ga0496117_0000475 | 3300048920 | Bacteria | 66690 |
| 563 | Ga0496117_0067429 | 3300048920 | Bacteria | 2421 |
| 564 | Ga0496118_0000482 | 3300048921 | Bacteria | 66218 |
| 565 | Ga0496118_0074693 | 3300048921 | Bacteria | 2421 |
| 566 | Ga0496118_0325142 | 3300048921 | Bacteria | 832 |
| 567 | Ga0496119_0072833 | 3300048922 | Bacteria | 2005 |
| 568 | Ga0496120_0247487 | 3300048923 | Bacteria | 838 |
| 569 | Ga0496121_0002640 | 3300048924 | Bacteria | 26981 |
| 570 | Ga0496121_0062032 | 3300048924 | Bacteria | 3064 |
| 571 | Ga0496122_0009192 | 3300048925 | Bacteria | 10466 |
| 572 | Ga0496122_0130664 | 3300048925 | Bacteria | 1596 |
| 573 | Ga0496123_0003395 | 3300048926 | Bacteria | 17945 |
| 574 | Ga0496123_0197762 | 3300048926 | Bacteria | 1033 |
| 575 | Ga0496123_0509238 | 3300048926 | Bacteria | 524 |
| 576 | Ga0496124_0039692 | 3300048927 | Bacteria | 4077 |
| 577 | Ga0496124_0122912 | 3300048927 | Bacteria | 2071 |
| 578 | Ga0496124_0280677 | 3300048927 | Bacteria | 1214 |
| 579 | Ga0496125_0094137 | 3300048928 | Bacteria | 2233 |
| 580 | Ga0496125_0179600 | 3300048928 | Bacteria | 1412 |
| 581 | Ga0496125_0204869 | 3300048928 | Bacteria | 1287 |
| 582 | Ga0496126_0132330 | 3300048929 | Bacteria | 2154 |
| 583 | Ga0496126_0249014 | 3300048929 | Bacteria | 1481 |
| 584 | Ga0496126_0575706 | 3300048929 | Bacteria | 890 |
| 585 | Ga0495678_001994 | 3300049459 | Bacteria | 14674 |
| 586 | Ga0495678_008180 | 3300049459 | Bacteria | 5312 |
| 587 | Ga0495678_008789 | 3300049459 | Bacteria | 5059 |
| 588 | Ga0495678_048215 | 3300049459 | Bacteria | 1662 |
| 589 | Ga0495678_102005 | 3300049459 | Bacteria | 992 |
| 590 | Ga0495678_163879 | 3300049459 | Bacteria | 708 |
| 591 | Ga0501033_0433387 | 3300049570 | Bacteria | 914 |
| 592 | Ga0501037_0069254 | 3300049573 | Bacteria | 2569 |
| 593 | Ga0501043_0001012 | 3300049579 | Bacteria | 24676 |
| 594 | Ga0501046_0000044 | 3300049580 | Bacteria | 151271 |
| 595 | Ga0501047_0007075 | 3300049581 | Bacteria | 10537 |
| 596 | Ga0501047_0044992 | 3300049581 | Bacteria | 4267 |
| 597 | Ga0501048_0000140 | 3300049582 | Bacteria | 43760 |
| 598 | Ga0501048_0408432 | 3300049582 | Bacteria | 971 |
| 599 | Ga0501048_0459442 | 3300049582 | Bacteria | 912 |
| 600 | Ga0501068_0083794 | 3300049584 | Bacteria | 1960 |
| 601 | Ga0501068_0330768 | 3300049584 | Bacteria | 977 |
| 602 | Ga0501070_0982390 | 3300049586 | Bacteria | 655 |
| 603 | Ga0501070_1162509 | 3300049586 | Bacteria | 593 |
| 604 | Ga0501072_0181537 | 3300049588 | Bacteria | 1679 |
| 605 | Ga0501072_0468805 | 3300049588 | Unclassified | 997 |
| 606 | Ga0501074_0792939 | 3300049590 | Bacteria | 668 |
| 607 | Ga0501075_0000725 | 3300049591 | Bacteria | 20461 |
| 608 | Ga0501077_0000732 | 3300049593 | Bacteria | 19858 |
| 609 | Ga0501216_045412 | 3300049660 | Bacteria | 851 |
| 610 | Ga0501238_000525 | 3300049671 | Bacteria | 4387 |
| 611 | Ga0501080_0050404 | 3300049742 | Bacteria | 3875 |
| 612 | Ga0501083_0000008 | 3300049744 | Bacteria | 197749 |
| 613 | Ga0501241_039531 | 3300049758 | Bacteria | 911 |
| 614 | Ga0501263_055779 | 3300049760 | Unclassified | 610 |
| 615 | Ga0501035_0016147 | 3300049822 | Bacteria | 6890 |
| 616 | Ga0501035_0110431 | 3300049822 | Bacteria | 2410 |
| 617 | Ga0501044_0014847 | 3300049823 | Bacteria | 8394 |
| 618 | Ga0501044_0019695 | 3300049823 | Bacteria | 7211 |
| 619 | nmdc:mga00v17_153926_c1 | 3300050491 | Bacteria | 1478 |
| 620 | nmdc:mga00v17_256829_c1 | 3300050491 | Bacteria | 1133 |
| 621 | nmdc:mga0k408_170596_c1 | 3300050493 | Bacteria | 1297 |
| 622 | nmdc:mga07m45_741247_c1 | 3300050496 | Bacteria | 564 |
| 623 | nmdc:mga0qj67_313144_c1 | 3300050509 | Bacteria | 1271 |
| 624 | nmdc:mga06r32_1778442_c1 | 3300050510 | Bacteria | 552 |
| 625 | nmdc:mga06r32_911818_c1 | 3300050510 | Bacteria | 835 |
| 626 | nmdc:mga08y16_4529_c1 | 3300050511 | Bacteria | 14495 |
| 627 | nmdc:mga08y16_705768_c1 | 3300050511 | Bacteria | 1008 |
| 628 | nmdc:mga0n895_816555_c1 | 3300050512 | Unclassified | 922 |
| 629 | Ga0500635_0000112 | 3300053080 | Bacteria | 49317 |
| 630 | Ga0500578_0000387 | 3300053086 | Bacteria | 54007 |
| 631 | Ga0500578_0020307 | 3300053086 | Bacteria | 4270 |
| 632 | Ga0500578_0301982 | 3300053086 | Bacteria | 949 |
| 633 | Ga0500643_135352 | 3300053087 | Bacteria | 662 |
| 634 | Ga0500644_0245385 | 3300053088 | Bacteria | 753 |
| 635 | Ga0500556_0002634 | 3300053104 | Bacteria | 5610 |
| 636 | Ga0500556_0005331 | 3300053104 | Bacteria | 3635 |
| 637 | Ga0500562_000388 | 3300053108 | Bacteria | 10696 |
| 638 | Ga0500562_121127 | 3300053108 | Bacteria | 713 |
| 639 | Ga0500572_002475 | 3300053111 | Bacteria | 4427 |
| 640 | Ga0500572_107052 | 3300053111 | Bacteria | 897 |
| 641 | Ga0500594_0000328 | 3300053118 | Bacteria | 10626 |
| 642 | Ga0500608_000367 | 3300053122 | Bacteria | 17481 |
| 643 | Ga0500652_284064 | 3300053131 | Bacteria | 645 |
| 644 | Ga0500658_0006135 | 3300053134 | Bacteria | 4474 |
| 645 | Ga0500658_0086297 | 3300053134 | Bacteria | 1350 |
| 646 | Ga0500559_0022150 | 3300053136 | Bacteria | 2695 |
| 647 | Ga0500559_0025012 | 3300053136 | Bacteria | 2541 |
| 648 | Ga0500568_0121341 | 3300053139 | Bacteria | 974 |
| 649 | Ga0500586_280837 | 3300053145 | Bacteria | 508 |
| 650 | Ga0500622_0000389 | 3300053156 | Bacteria | 42477 |
| 651 | Ga0500622_0006923 | 3300053156 | Bacteria | 6497 |
| 652 | Ga0500645_000888 | 3300053730 | Bacteria | 17345 |
| 653 | Ga0500645_004039 | 3300053730 | Bacteria | 5758 |
| 654 | Ga0500645_051558 | 3300053730 | Bacteria | 1200 |
| 655 | Ga0501084_1330215 | 3300054114 | Bacteria | 602 |
| 656 | Ga0590075_014819 | 3300059424 | Bacteria | 1908 |
| 657 | Ga0501082_0002246 | 3300060353 | Bacteria | 16907 |
| 658 | Ga0501082_0100222 | 3300060353 | Bacteria | 2505 |
| 659 | Ga0466962_0084888 | 3300061719 | Bacteria | 1515 |
| 660 | Ga0530510_0118204 | 3300061734 | Bacteria | 1945 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10266574 | Ga0157370_102665742 | 58 |
| 2 | 3300035241 | Ga0373961_0000144 | Ga0373961_0000144_11119_11316 | 58 |
| 3 | 3300005327 | Ga0070658_10527030 | Ga0070658_105270302 | 59 |
| 4 | 3300005328 | Ga0070676_10840813 | Ga0070676_108408132 | 59 |
| 5 | 3300005329 | Ga0070683_101834240 | Ga0070683_1018342402 | 59 |
| 6 | 3300005333 | Ga0070677_10421556 | Ga0070677_104215562 | 59 |
| 7 | 3300005339 | Ga0070660_100000511 | Ga0070660_1000005116 | 59 |
| 8 | 3300005339 | Ga0070660_100184949 | Ga0070660_1001849491 | 59 |
| 9 | 3300005347 | Ga0070668_101529167 | Ga0070668_1015291672 | 59 |
| 10 | 3300005366 | Ga0070659_100000005 | Ga0070659_100000005141 | 59 |
| 11 | 3300005440 | Ga0070705_101322456 | Ga0070705_1013224561 | 59 |
| 12 | 3300005445 | Ga0070708_100230586 | Ga0070708_1002305862 | 59 |
| 13 | 3300005456 | Ga0070678_100690117 | Ga0070678_1006901172 | 59 |
| 14 | 3300005468 | Ga0070707_102229810 | Ga0070707_1022298101 | 59 |
| 15 | 3300005471 | Ga0070698_100071714 | Ga0070698_1000717143 | 59 |
| 16 | 3300005543 | Ga0070672_100414128 | Ga0070672_1004141282 | 59 |
| 17 | 3300005543 | Ga0070672_100620664 | Ga0070672_1006206643 | 59 |
| 18 | 3300005546 | Ga0070696_101297291 | Ga0070696_1012972911 | 59 |
| 19 | 3300005549 | Ga0070704_100030777 | Ga0070704_1000307773 | 59 |
| 20 | 3300005563 | Ga0068855_100196722 | Ga0068855_1001967222 | 59 |
| 21 | 3300005719 | Ga0068861_102402597 | Ga0068861_1024025972 | 59 |
| 22 | 3300005841 | Ga0068863_100044677 | Ga0068863_1000446773 | 59 |
| 23 | 3300005841 | Ga0068863_102038495 | Ga0068863_1020384952 | 59 |
| 24 | 3300005843 | Ga0068860_100023746 | Ga0068860_1000237463 | 59 |
| 25 | 3300005843 | Ga0068860_100125586 | Ga0068860_1001255862 | 59 |
| 26 | 3300006195 | Ga0075366_10561221 | Ga0075366_105612211 | 59 |
| 27 | 3300006353 | Ga0075370_10917614 | Ga0075370_109176142 | 59 |
| 28 | 3300007076 | Ga0075435_101381635 | Ga0075435_1013816352 | 59 |
| 29 | 3300007265 | Ga0099794_10451681 | Ga0099794_104516812 | 59 |
| 30 | 3300009093 | Ga0105240_10195742 | Ga0105240_101957422 | 59 |
| 31 | 3300009094 | Ga0111539_12686020 | Ga0111539_126860202 | 59 |
| 32 | 3300009098 | Ga0105245_10063800 | Ga0105245_100638005 | 59 |
| 33 | 3300009176 | Ga0105242_11406385 | Ga0105242_114063852 | 59 |
| 34 | 3300009551 | Ga0105238_11915520 | Ga0105238_119155201 | 59 |
| 35 | 3300009551 | Ga0105238_12278678 | Ga0105238_122786782 | 59 |
| 36 | 3300009553 | Ga0105249_12612958 | Ga0105249_126129582 | 59 |
| 37 | 3300010375 | Ga0105239_11900377 | Ga0105239_119003771 | 59 |
| 38 | 3300013105 | Ga0157369_10045234 | Ga0157369_100452343 | 59 |
| 39 | 3300013306 | Ga0163162_10472910 | Ga0163162_104729102 | 59 |
| 40 | 3300014326 | Ga0157380_11316911 | Ga0157380_113169112 | 59 |
| 41 | 3300014745 | Ga0157377_11467735 | Ga0157377_114677352 | 59 |
| 42 | 3300014969 | Ga0157376_11378395 | Ga0157376_113783951 | 59 |
| 43 | 3300028381 | Ga0268264_10027029 | Ga0268264_100270292 | 59 |
| 44 | 3300041486 | Ga0451807_0089940 | Ga0451807_0089940_324_524 | 59 |
| 45 | 3300041507 | Ga0451851_0935334 | Ga0451851_0935334_471_671 | 59 |
| 46 | 3300041512 | Ga0451853_0449395 | Ga0451853_0449395_88_288 | 59 |
| 47 | 3300003759 | Ga0055525_1000070 | Ga0055525_1000070135 | 60 |
| 48 | 3300003781 | Ga0055536_1001560 | Ga0055536_10015605 | 60 |
| 49 | 3300003781 | Ga0055536_1005420 | Ga0055536_10054207 | 60 |
| 50 | 3300003791 | Ga0055530_10002634 | Ga0055530_100026345 | 60 |
| 51 | 3300003792 | Ga0055540_1014480 | Ga0055540_10144804 | 60 |
| 52 | 3300005327 | Ga0070658_10041757 | Ga0070658_100417576 | 60 |
| 53 | 3300005327 | Ga0070658_10144065 | Ga0070658_101440654 | 60 |
| 54 | 3300005328 | Ga0070676_10713696 | Ga0070676_107136961 | 60 |
| 55 | 3300005330 | Ga0070690_100047811 | Ga0070690_1000478113 | 60 |
| 56 | 3300005331 | Ga0070670_100077601 | Ga0070670_1000776013 | 60 |
| 57 | 3300005334 | Ga0068869_100018317 | Ga0068869_1000183175 | 60 |
| 58 | 3300005338 | Ga0068868_100372121 | Ga0068868_1003721213 | 60 |
| 59 | 3300005339 | Ga0070660_101797456 | Ga0070660_1017974562 | 60 |
| 60 | 3300005340 | Ga0070689_100646074 | Ga0070689_1006460742 | 60 |
| 61 | 3300005353 | Ga0070669_102020223 | Ga0070669_1020202232 | 60 |
| 62 | 3300005354 | Ga0070675_100174762 | Ga0070675_1001747624 | 60 |
| 63 | 3300005354 | Ga0070675_100908625 | Ga0070675_1009086251 | 60 |
| 64 | 3300005366 | Ga0070659_101594428 | Ga0070659_1015944282 | 60 |
| 65 | 3300005434 | Ga0070709_10555675 | Ga0070709_105556752 | 60 |
| 66 | 3300005436 | Ga0070713_100356448 | Ga0070713_1003564482 | 60 |
| 67 | 3300005457 | Ga0070662_100594710 | Ga0070662_1005947103 | 60 |
| 68 | 3300005459 | Ga0068867_100083134 | Ga0068867_1000831343 | 60 |
| 69 | 3300005459 | Ga0068867_100282315 | Ga0068867_1002823152 | 60 |
| 70 | 3300005535 | Ga0070684_100373980 | Ga0070684_1003739802 | 60 |
| 71 | 3300005539 | Ga0068853_101264286 | Ga0068853_1012642862 | 60 |
| 72 | 3300005563 | Ga0068855_100013193 | Ga0068855_1000131937 | 60 |
| 73 | 3300005563 | Ga0068855_100546955 | Ga0068855_1005469552 | 60 |
| 74 | 3300005564 | Ga0070664_100662898 | Ga0070664_1006628982 | 60 |
| 75 | 3300005577 | Ga0068857_100212663 | Ga0068857_1002126632 | 60 |
| 76 | 3300005577 | Ga0068857_101104445 | Ga0068857_1011044452 | 60 |
| 77 | 3300005614 | Ga0068856_100829647 | Ga0068856_1008296472 | 60 |
| 78 | 3300005616 | Ga0068852_101788746 | Ga0068852_1017887462 | 60 |
| 79 | 3300005719 | Ga0068861_102246409 | Ga0068861_1022464092 | 60 |
| 80 | 3300005844 | Ga0068862_101036340 | Ga0068862_1010363402 | 60 |
| 81 | 3300006173 | Ga0070716_101170974 | Ga0070716_1011709742 | 60 |
| 82 | 3300006195 | Ga0075366_10185123 | Ga0075366_101851231 | 60 |
| 83 | 3300006844 | Ga0075428_101036436 | Ga0075428_1010364363 | 60 |
| 84 | 3300006847 | Ga0075431_101113139 | Ga0075431_1011131392 | 60 |
| 85 | 3300006880 | Ga0075429_100291085 | Ga0075429_1002910852 | 60 |
| 86 | 3300006881 | Ga0068865_100189477 | Ga0068865_1001894774 | 60 |
| 87 | 3300009093 | Ga0105240_12414585 | Ga0105240_124145852 | 60 |
| 88 | 3300009098 | Ga0105245_10355848 | Ga0105245_103558483 | 60 |
| 89 | 3300009098 | Ga0105245_11201528 | Ga0105245_112015281 | 60 |
| 90 | 3300009147 | Ga0114129_10033069 | Ga0114129_100330696 | 60 |
| 91 | 3300009148 | Ga0105243_11092557 | Ga0105243_110925572 | 60 |
| 92 | 3300009176 | Ga0105242_10167926 | Ga0105242_101679263 | 60 |
| 93 | 3300009176 | Ga0105242_12716843 | Ga0105242_127168432 | 60 |
| 94 | 3300009545 | Ga0105237_10997139 | Ga0105237_109971392 | 60 |
| 95 | 3300009551 | Ga0105238_11190577 | Ga0105238_111905772 | 60 |
| 96 | 3300009551 | Ga0105238_11905137 | Ga0105238_119051372 | 60 |
| 97 | 3300009553 | Ga0105249_10906080 | Ga0105249_109060802 | 60 |
| 98 | 3300010375 | Ga0105239_10638183 | Ga0105239_106381832 | 60 |
| 99 | 3300011119 | Ga0105246_10047321 | Ga0105246_100473212 | 60 |
| 100 | 3300011119 | Ga0105246_11782373 | Ga0105246_117823732 | 60 |
| 101 | 3300013296 | Ga0157374_11733915 | Ga0157374_117339152 | 60 |
| 102 | 3300013297 | Ga0157378_10094847 | Ga0157378_100948472 | 60 |
| 103 | 3300013308 | Ga0157375_10824280 | Ga0157375_108242803 | 60 |
| 104 | 3300014325 | Ga0163163_10051008 | Ga0163163_100510084 | 60 |
| 105 | 3300014745 | Ga0157377_10323589 | Ga0157377_103235892 | 60 |
| 106 | 3300025230 | Ga0209563_100053 | Ga0209563_10005361 | 60 |
| 107 | 3300025253 | Ga0209677_101505 | Ga0209677_1015053 | 60 |
| 108 | 3300025292 | Ga0209676_1000138 | Ga0209676_100013896 | 60 |
| 109 | 3300025292 | Ga0209676_1000832 | Ga0209676_10008329 | 60 |
| 110 | 3300025295 | Ga0209564_1018162 | Ga0209564_10181623 | 60 |
| 111 | 3300025298 | Ga0209050_1001184 | Ga0209050_100118426 | 60 |
| 112 | 3300025298 | Ga0209050_1089822 | Ga0209050_10898222 | 60 |
| 113 | 3300025303 | Ga0209051_1003081 | Ga0209051_10030814 | 60 |
| 114 | 3300025304 | Ga0209257_1004893 | Ga0209257_10048936 | 60 |
| 115 | 3300025901 | Ga0207688_10093713 | Ga0207688_100937132 | 60 |
| 116 | 3300025907 | Ga0207645_10598417 | Ga0207645_105984172 | 60 |
| 117 | 3300025909 | Ga0207705_10131851 | Ga0207705_101318513 | 60 |
| 118 | 3300025909 | Ga0207705_10666327 | Ga0207705_106663272 | 60 |
| 119 | 3300025926 | Ga0207659_10806204 | Ga0207659_108062042 | 60 |
| 120 | 3300025927 | Ga0207687_10168964 | Ga0207687_101689643 | 60 |
| 121 | 3300025927 | Ga0207687_11890201 | Ga0207687_118902011 | 60 |
| 122 | 3300025928 | Ga0207700_11411762 | Ga0207700_114117622 | 60 |
| 123 | 3300025932 | Ga0207690_10542574 | Ga0207690_105425743 | 60 |
| 124 | 3300025932 | Ga0207690_10775006 | Ga0207690_107750062 | 60 |
| 125 | 3300025932 | Ga0207690_11402617 | Ga0207690_114026172 | 60 |
| 126 | 3300025933 | Ga0207706_10509011 | Ga0207706_105090112 | 60 |
| 127 | 3300025934 | Ga0207686_10014800 | Ga0207686_100148006 | 60 |
| 128 | 3300025935 | Ga0207709_10855210 | Ga0207709_108552102 | 60 |
| 129 | 3300025936 | Ga0207670_10035207 | Ga0207670_100352074 | 60 |
| 130 | 3300025940 | Ga0207691_10347548 | Ga0207691_103475482 | 60 |
| 131 | 3300025942 | Ga0207689_10014590 | Ga0207689_100145907 | 60 |
| 132 | 3300025945 | Ga0207679_10487440 | Ga0207679_104874402 | 60 |
| 133 | 3300025949 | Ga0207667_10027912 | Ga0207667_100279127 | 60 |
| 134 | 3300025981 | Ga0207640_10760949 | Ga0207640_107609492 | 60 |
| 135 | 3300026041 | Ga0207639_11665174 | Ga0207639_116651742 | 60 |
| 136 | 3300026067 | Ga0207678_11042401 | Ga0207678_110424011 | 60 |
| 137 | 3300026089 | Ga0207648_10145160 | Ga0207648_101451603 | 60 |
| 138 | 3300026089 | Ga0207648_10306461 | Ga0207648_103064613 | 60 |
| 139 | 3300026116 | Ga0207674_10112152 | Ga0207674_101121523 | 60 |
| 140 | 3300026116 | Ga0207674_10160449 | Ga0207674_101604493 | 60 |
| 141 | 3300026116 | Ga0207674_12126336 | Ga0207674_121263361 | 60 |
| 142 | 3300026118 | Ga0207675_102093909 | Ga0207675_1020939091 | 60 |
| 143 | 3300028380 | Ga0268265_10456238 | Ga0268265_104562382 | 60 |
| 144 | 3300028381 | Ga0268264_10961468 | Ga0268264_109614683 | 60 |
| 145 | 3300028573 | Ga0265334_10120105 | Ga0265334_101201052 | 60 |
| 146 | 3300028794 | Ga0307515_10143053 | Ga0307515_101430532 | 60 |
| 147 | 3300028794 | Ga0307515_10725384 | Ga0307515_107253841 | 60 |
| 148 | 3300028800 | Ga0265338_10024196 | Ga0265338_100241962 | 60 |
| 149 | 3300028800 | Ga0265338_10248139 | Ga0265338_102481395 | 60 |
| 150 | 3300031235 | Ga0265330_10132270 | Ga0265330_101322702 | 60 |
| 151 | 3300031238 | Ga0265332_10324326 | Ga0265332_103243262 | 60 |
| 152 | 3300031239 | Ga0265328_10099047 | Ga0265328_100990472 | 60 |
| 153 | 3300031247 | Ga0265340_10382617 | Ga0265340_103826172 | 60 |
| 154 | 3300031249 | Ga0265339_10000687 | Ga0265339_1000068712 | 60 |
| 155 | 3300031250 | Ga0265331_10137810 | Ga0265331_101378102 | 60 |
| 156 | 3300031344 | Ga0265316_10005832 | Ga0265316_100058325 | 60 |
| 157 | 3300031344 | Ga0265316_10006068 | Ga0265316_1000606811 | 60 |
| 158 | 3300031711 | Ga0265314_10312354 | Ga0265314_103123543 | 60 |
| 159 | 3300031712 | Ga0265342_10006636 | Ga0265342_100066363 | 60 |
| 160 | 3300031712 | Ga0265342_10189658 | Ga0265342_101896582 | 60 |
| 161 | 3300031727 | Ga0316576_10034516 | Ga0316576_100345162 | 60 |
| 162 | 3300031730 | Ga0307516_10053106 | Ga0307516_100531064 | 60 |
| 163 | 3300031824 | Ga0307413_11382408 | Ga0307413_113824081 | 60 |
| 164 | 3300031901 | Ga0307406_10524753 | Ga0307406_105247532 | 60 |
| 165 | 3300031911 | Ga0307412_10231256 | Ga0307412_102312562 | 60 |
| 166 | 3300031995 | Ga0307409_100561794 | Ga0307409_1005617943 | 60 |
| 167 | 3300032126 | Ga0307415_100850887 | Ga0307415_1008508871 | 60 |
| 168 | 3300033547 | Ga0316212_1051398 | Ga0316212_10513982 | 60 |
| 169 | 3300035086 | Ga0373934_0026017 | Ga0373934_0026017_1718_1912 | 60 |
| 170 | 3300035398 | Ga0316574_0087492 | Ga0316574_0087492_467_661 | 60 |
| 171 | 3300036712 | Ga0316584_0133892 | Ga0316584_0133892_637_831 | 60 |
| 172 | 3300037471 | Ga0395905_1192681 | Ga0395905_1192681_452_646 | 60 |
| 173 | 3300041498 | Ga0451841_0847936 | Ga0451841_0847936_390_584 | 60 |
| 174 | 3300041511 | Ga0451855_1732057 | Ga0451855_1732057_97_291 | 60 |
| 175 | 3300042530 | Ga0450916_019682 | Ga0450916_019682_671_865 | 60 |
| 176 | 3300044683 | Ga0466965_0054912 | Ga0466965_0054912_239_433 | 60 |
| 177 | 3300044684 | Ga0466966_0011392 | Ga0466966_0011392_4270_4464 | 60 |
| 178 | 3300044693 | Ga0466961_0075938 | Ga0466961_0075938_1115_1309 | 60 |
| 179 | 3300044706 | Ga0466964_0010049 | Ga0466964_0010049_2084_2278 | 60 |
| 180 | 3300044719 | Ga0466971_0216582 | Ga0466971_0216582_392_586 | 60 |
| 181 | 3300044735 | Ga0466968_0023356 | Ga0466968_0023356_169_363 | 60 |
| 182 | 3300044765 | Ga0466970_0515347 | Ga0466970_0515347_47_241 | 60 |
| 183 | 3300044842 | Ga0466957_0106104 | Ga0466957_0106104_1296_1490 | 60 |
| 184 | 3300044842 | Ga0466957_0176931 | Ga0466957_0176931_599_793 | 60 |
| 185 | 3300044901 | Ga0466960_0339170 | Ga0466960_0339170_353_547 | 60 |
| 186 | 3300045049 | Ga0466959_0039972 | Ga0466959_0039972_1696_1890 | 60 |
| 187 | 3300045051 | Ga0451576_1215356 | Ga0451576_1215356_454_657 | 60 |
| 188 | 3300045836 | Ga0466958_0890514 | Ga0466958_0890514_248_442 | 60 |
| 189 | 3300045976 | Ga0466967_0009535 | Ga0466967_0009535_5414_5608 | 60 |
| 190 | 3300045976 | Ga0466967_1607267 | Ga0466967_1607267_318_512 | 60 |
| 191 | 3300046453 | Ga0495627_000256 | Ga0495627_000256_35527_35721 | 60 |
| 192 | 3300046457 | Ga0495590_0005196 | Ga0495590_0005196_3794_3988 | 60 |
| 193 | 3300046460 | Ga0495638_0000387 | Ga0495638_0000387_25972_26166 | 60 |
| 194 | 3300046460 | Ga0495638_0005523 | Ga0495638_0005523_3387_3581 | 60 |
| 195 | 3300046460 | Ga0495638_0035510 | Ga0495638_0035510_1452_1646 | 60 |
| 196 | 3300046471 | Ga0495650_0000940 | Ga0495650_0000940_14415_14609 | 60 |
| 197 | 3300046471 | Ga0495650_0025311 | Ga0495650_0025311_1096_1290 | 60 |
| 198 | 3300046471 | Ga0495650_0135911 | Ga0495650_0135911_350_544 | 60 |
| 199 | 3300046475 | Ga0495639_0403076 | Ga0495639_0403076_251_445 | 60 |
| 200 | 3300046476 | Ga0495662_0679486 | Ga0495662_0679486_271_465 | 60 |
| 201 | 3300046492 | Ga0495585_0464591 | Ga0495585_0464591_179_373 | 60 |
| 202 | 3300046506 | Ga0495583_0000018 | Ga0495583_0000018_53843_54037 | 60 |
| 203 | 3300046506 | Ga0495583_0198120 | Ga0495583_0198120_382_576 | 60 |
| 204 | 3300046507 | Ga0495606_0003207 | Ga0495606_0003207_3569_3763 | 60 |
| 205 | 3300046507 | Ga0495606_0006281 | Ga0495606_0006281_7208_7402 | 60 |
| 206 | 3300046511 | Ga0495608_0199814 | Ga0495608_0199814_88_282 | 60 |
| 207 | 3300046512 | Ga0495610_0000056 | Ga0495610_0000056_59339_59533 | 60 |
| 208 | 3300046512 | Ga0495610_0000220 | Ga0495610_0000220_37140_37334 | 60 |
| 209 | 3300046512 | Ga0495610_0002390 | Ga0495610_0002390_1305_1499 | 60 |
| 210 | 3300046515 | Ga0495620_0121396 | Ga0495620_0121396_157_351 | 60 |
| 211 | 3300046517 | Ga0495630_0847632 | Ga0495630_0847632_444_638 | 60 |
| 212 | 3300046518 | Ga0495631_0005679 | Ga0495631_0005679_3591_3785 | 60 |
| 213 | 3300046520 | Ga0495637_0026055 | Ga0495637_0026055_442_636 | 60 |
| 214 | 3300046522 | Ga0495643_0062766 | Ga0495643_0062766_1411_1605 | 60 |
| 215 | 3300046524 | Ga0495648_0210936 | Ga0495648_0210936_216_410 | 60 |
| 216 | 3300046529 | Ga0495652_0319289 | Ga0495652_0319289_629_823 | 60 |
| 217 | 3300046530 | Ga0495654_0105705 | Ga0495654_0105705_271_465 | 60 |
| 218 | 3300046542 | Ga0495597_0080344 | Ga0495597_0080344_448_642 | 60 |
| 219 | 3300046616 | Ga0495668_0004517 | Ga0495668_0004517_5038_5232 | 60 |
| 220 | 3300046616 | Ga0495668_0037958 | Ga0495668_0037958_1302_1496 | 60 |
| 221 | 3300046660 | Ga0495625_0012052 | Ga0495625_0012052_1729_1923 | 60 |
| 222 | 3300046660 | Ga0495625_0026327 | Ga0495625_0026327_3600_3794 | 60 |
| 223 | 3300046660 | Ga0495625_0175376 | Ga0495625_0175376_278_472 | 60 |
| 224 | 3300046660 | Ga0495625_0250952 | Ga0495625_0250952_206_400 | 60 |
| 225 | 3300046684 | Ga0495669_0009409 | Ga0495669_0009409_3376_3570 | 60 |
| 226 | 3300046692 | Ga0495671_0082623 | Ga0495671_0082623_23_217 | 60 |
| 227 | 3300046692 | Ga0495671_0139594 | Ga0495671_0139594_460_654 | 60 |
| 228 | 3300046694 | Ga0495649_0001823 | Ga0495649_0001823_6326_6520 | 60 |
| 229 | 3300046794 | Ga0495589_0016461 | Ga0495589_0016461_2922_3116 | 60 |
| 230 | 3300046810 | Ga0495660_0369883 | Ga0495660_0369883_323_517 | 60 |
| 231 | 3300047320 | Ga0495672_0003554 | Ga0495672_0003554_1976_2170 | 60 |
| 232 | 3300047323 | Ga0495683_0097371 | Ga0495683_0097371_287_481 | 60 |
| 233 | 3300047469 | Ga0495673_0007069 | Ga0495673_0007069_5483_5677 | 60 |
| 234 | 3300047470 | Ga0495681_0000065 | Ga0495681_0000065_36051_36245 | 60 |
| 235 | 3300047472 | Ga0495686_0002204 | Ga0495686_0002204_11324_11518 | 60 |
| 236 | 3300047472 | Ga0495686_0014125 | Ga0495686_0014125_4828_5022 | 60 |
| 237 | 3300047472 | Ga0495686_0325028 | Ga0495686_0325028_589_783 | 60 |
| 238 | 3300047472 | Ga0495686_0465101 | Ga0495686_0465101_148_342 | 60 |
| 239 | 3300047673 | Ga0495593_0514495 | Ga0495593_0514495_225_419 | 60 |
| 240 | 3300048909 | Ga0496106_0145361 | Ga0496106_0145361_637_831 | 60 |
| 241 | 3300048909 | Ga0496106_0193863 | Ga0496106_0193863_535_729 | 60 |
| 242 | 3300048910 | Ga0496107_0000073 | Ga0496107_0000073_5871_6065 | 60 |
| 243 | 3300048918 | Ga0496115_0340473 | Ga0496115_0340473_260_454 | 60 |
| 244 | 3300048918 | Ga0496115_0484381 | Ga0496115_0484381_145_339 | 60 |
| 245 | 3300048924 | Ga0496121_0002640 | Ga0496121_0002640_9011_9205 | 60 |
| 246 | 3300048926 | Ga0496123_0509238 | Ga0496123_0509238_264_458 | 60 |
| 247 | 3300048928 | Ga0496125_0204869 | Ga0496125_0204869_775_969 | 60 |
| 248 | 3300048929 | Ga0496126_0132330 | Ga0496126_0132330_1749_1943 | 60 |
| 249 | 3300048929 | Ga0496126_0249014 | Ga0496126_0249014_990_1184 | 60 |
| 250 | 3300048929 | Ga0496126_0575706 | Ga0496126_0575706_513_707 | 60 |
| 251 | 3300049459 | Ga0495678_008789 | Ga0495678_008789_3164_3358 | 60 |
| 252 | 3300049582 | Ga0501048_0408432 | Ga0501048_0408432_659_853 | 60 |
| 253 | 3300049584 | Ga0501068_0083794 | Ga0501068_0083794_563_781 | 60 |
| 254 | 3300049591 | Ga0501075_0000725 | Ga0501075_0000725_2916_3134 | 60 |
| 255 | 3300049593 | Ga0501077_0000732 | Ga0501077_0000732_3152_3370 | 60 |
| 256 | 3300049671 | Ga0501238_000525 | Ga0501238_000525_3909_4103 | 60 |
| 257 | 3300049742 | Ga0501080_0050404 | Ga0501080_0050404_560_778 | 60 |
| 258 | 3300049758 | Ga0501241_039531 | Ga0501241_039531_543_737 | 60 |
| 259 | 3300049760 | Ga0501263_055779 | Ga0501263_055779_116_310 | 60 |
| 260 | 3300050493 | nmdc:mga0k408_170596_c1 | nmdc:mga0k408_170596_c1_56_250 | 60 |
| 261 | 3300050496 | nmdc:mga07m45_741247_c1 | nmdc:mga07m45_741247_c1_47_241 | 60 |
| 262 | 3300050510 | nmdc:mga06r32_1778442_c1 | nmdc:mga06r32_1778442_c1_283_477 | 60 |
| 263 | 3300053080 | Ga0500635_0000112 | Ga0500635_0000112_32052_32246 | 60 |
| 264 | 3300053086 | Ga0500578_0000387 | Ga0500578_0000387_3202_3396 | 60 |
| 265 | 3300053086 | Ga0500578_0020307 | Ga0500578_0020307_649_843 | 60 |
| 266 | 3300053086 | Ga0500578_0301982 | Ga0500578_0301982_349_543 | 60 |
| 267 | 3300053087 | Ga0500643_135352 | Ga0500643_135352_101_295 | 60 |
| 268 | 3300053088 | Ga0500644_0245385 | Ga0500644_0245385_389_583 | 60 |
| 269 | 3300053104 | Ga0500556_0002634 | Ga0500556_0002634_2317_2511 | 60 |
| 270 | 3300053104 | Ga0500556_0005331 | Ga0500556_0005331_1303_1497 | 60 |
| 271 | 3300053108 | Ga0500562_000388 | Ga0500562_000388_2074_2268 | 60 |
| 272 | 3300053111 | Ga0500572_107052 | Ga0500572_107052_290_484 | 60 |
| 273 | 3300053118 | Ga0500594_0000328 | Ga0500594_0000328_2880_3074 | 60 |
| 274 | 3300053122 | Ga0500608_000367 | Ga0500608_000367_10021_10215 | 60 |
| 275 | 3300053131 | Ga0500652_284064 | Ga0500652_284064_87_281 | 60 |
| 276 | 3300053134 | Ga0500658_0006135 | Ga0500658_0006135_1691_1885 | 60 |
| 277 | 3300053134 | Ga0500658_0086297 | Ga0500658_0086297_852_1046 | 60 |
| 278 | 3300053136 | Ga0500559_0022150 | Ga0500559_0022150_2371_2565 | 60 |
| 279 | 3300053136 | Ga0500559_0025012 | Ga0500559_0025012_776_970 | 60 |
| 280 | 3300053156 | Ga0500622_0000389 | Ga0500622_0000389_40327_40521 | 60 |
| 281 | 3300053156 | Ga0500622_0006923 | Ga0500622_0006923_3781_3975 | 60 |
| 282 | 3300053730 | Ga0500645_000888 | Ga0500645_000888_5847_6041 | 60 |
| 283 | 3300053730 | Ga0500645_051558 | Ga0500645_051558_86_280 | 60 |
| 284 | 3300060353 | Ga0501082_0002246 | Ga0501082_0002246_12441_12659 | 60 |
| 285 | 3300061719 | Ga0466962_0084888 | Ga0466962_0084888_520_714 | 60 |
| 286 | 3300061734 | Ga0530510_0118204 | Ga0530510_0118204_423_641 | 60 |
| 287 | 3300003791 | Ga0055530_10000497 | Ga0055530_1000049713 | 61 |
| 288 | 3300003794 | Ga0055531_10010233 | Ga0055531_100102333 | 61 |
| 289 | 3300005262 | Ga0065165_1000806 | Ga0065165_100080618 | 61 |
| 290 | 3300005435 | Ga0070714_100124662 | Ga0070714_1001246622 | 61 |
| 291 | 3300005458 | Ga0070681_10666649 | Ga0070681_106666492 | 61 |
| 292 | 3300005539 | Ga0068853_100606598 | Ga0068853_1006065982 | 61 |
| 293 | 3300006946 | Ga0079104_1022939 | Ga0079104_10229391 | 61 |
| 294 | 3300009011 | Ga0105251_10057008 | Ga0105251_100570083 | 61 |
| 295 | 3300009011 | Ga0105251_10116611 | Ga0105251_101166112 | 61 |
| 296 | 3300009092 | Ga0105250_10001803 | Ga0105250_100018038 | 61 |
| 297 | 3300009093 | Ga0105240_10065300 | Ga0105240_100653006 | 61 |
| 298 | 3300009093 | Ga0105240_10427852 | Ga0105240_104278523 | 61 |
| 299 | 3300010375 | Ga0105239_10219490 | Ga0105239_102194903 | 61 |
| 300 | 3300012498 | Ga0157345_1000004 | Ga0157345_10000048 | 61 |
| 301 | 3300013100 | Ga0157373_10592543 | Ga0157373_105925432 | 61 |
| 302 | 3300013102 | Ga0157371_10151186 | Ga0157371_101511863 | 61 |
| 303 | 3300013102 | Ga0157371_10410373 | Ga0157371_104103732 | 61 |
| 304 | 3300013102 | Ga0157371_10800311 | Ga0157371_108003111 | 61 |
| 305 | 3300013104 | Ga0157370_10070925 | Ga0157370_100709253 | 61 |
| 306 | 3300013104 | Ga0157370_10480058 | Ga0157370_104800582 | 61 |
| 307 | 3300013104 | Ga0157370_10693578 | Ga0157370_106935782 | 61 |
| 308 | 3300013104 | Ga0157370_10745089 | Ga0157370_107450892 | 61 |
| 309 | 3300013104 | Ga0157370_11524983 | Ga0157370_115249832 | 61 |
| 310 | 3300013105 | Ga0157369_10000286 | Ga0157369_1000028611 | 61 |
| 311 | 3300013105 | Ga0157369_11987240 | Ga0157369_119872402 | 61 |
| 312 | 3300013296 | Ga0157374_10001026 | Ga0157374_1000102621 | 61 |
| 313 | 3300013306 | Ga0163162_11279787 | Ga0163162_112797872 | 61 |
| 314 | 3300013308 | Ga0157375_10098142 | Ga0157375_100981422 | 61 |
| 315 | 3300014497 | Ga0182008_10015262 | Ga0182008_100152623 | 61 |
| 316 | 3300015265 | Ga0182005_1008233 | Ga0182005_10082333 | 61 |
| 317 | 3300017792 | Ga0163161_10059022 | Ga0163161_100590224 | 61 |
| 318 | 3300017792 | Ga0163161_10123333 | Ga0163161_101233333 | 61 |
| 319 | 3300025297 | Ga0209758_1024949 | Ga0209758_10249492 | 61 |
| 320 | 3300025298 | Ga0209050_1000121 | Ga0209050_1000121195 | 61 |
| 321 | 3300025302 | Ga0207426_1068343 | Ga0207426_10683432 | 61 |
| 322 | 3300025304 | Ga0209257_1000125 | Ga0209257_1000125219 | 61 |
| 323 | 3300025711 | Ga0207696_1001491 | Ga0207696_10014916 | 61 |
| 324 | 3300025711 | Ga0207696_1001893 | Ga0207696_10018934 | 61 |
| 325 | 3300025728 | Ga0207655_1017725 | Ga0207655_10177253 | 61 |
| 326 | 3300025735 | Ga0207713_1011282 | Ga0207713_10112826 | 61 |
| 327 | 3300025913 | Ga0207695_10021692 | Ga0207695_100216924 | 61 |
| 328 | 3300025913 | Ga0207695_10273993 | Ga0207695_102739933 | 61 |
| 329 | 3300025929 | Ga0207664_11394254 | Ga0207664_113942542 | 61 |
| 330 | 3300025933 | Ga0207706_10051270 | Ga0207706_100512706 | 61 |
| 331 | 3300027111 | Ga0209281_1002352 | Ga0209281_10023524 | 61 |
| 332 | 3300028800 | Ga0265338_10017848 | Ga0265338_100178485 | 61 |
| 333 | 3300031548 | Ga0307408_100186082 | Ga0307408_1001860824 | 61 |
| 334 | 3300031595 | Ga0265313_10176595 | Ga0265313_101765953 | 61 |
| 335 | 3300031691 | Ga0316579_10140335 | Ga0316579_101403352 | 61 |
| 336 | 3300031728 | Ga0316578_10728232 | Ga0316578_107282322 | 61 |
| 337 | 3300031731 | Ga0307405_10158536 | Ga0307405_101585363 | 61 |
| 338 | 3300031901 | Ga0307406_10503824 | Ga0307406_105038242 | 61 |
| 339 | 3300031903 | Ga0307407_10071060 | Ga0307407_100710604 | 61 |
| 340 | 3300031911 | Ga0307412_10295882 | Ga0307412_102958822 | 61 |
| 341 | 3300031995 | Ga0307409_102469495 | Ga0307409_1024694952 | 61 |
| 342 | 3300032004 | Ga0307414_10104491 | Ga0307414_101044913 | 61 |
| 343 | 3300032005 | Ga0307411_10009261 | Ga0307411_100092616 | 61 |
| 344 | 3300033180 | Ga0307510_10010763 | Ga0307510_100107635 | 61 |
| 345 | 3300042004 | Ga0439445_0045000 | Ga0439445_0045000_303_500 | 61 |
| 346 | 3300042006 | Ga0439432_040469 | Ga0439432_040469_1147_1344 | 61 |
| 347 | 3300042016 | Ga0439463_058242 | Ga0439463_058242_62_259 | 61 |
| 348 | 3300042144 | Ga0450889_017003 | Ga0450889_017003_435_632 | 61 |
| 349 | 3300042532 | Ga0450893_0009319 | Ga0450893_0009319_1366_1563 | 61 |
| 350 | 3300044684 | Ga0466966_0116555 | Ga0466966_0116555_641_838 | 61 |
| 351 | 3300045049 | Ga0466959_0769367 | Ga0466959_0769367_270_467 | 61 |
| 352 | 3300045051 | Ga0451576_1870407 | Ga0451576_1870407_311_508 | 61 |
| 353 | 3300045976 | Ga0466967_2151676 | Ga0466967_2151676_226_423 | 61 |
| 354 | 3300046452 | Ga0495617_000484 | Ga0495617_000484_1930_2127 | 61 |
| 355 | 3300046452 | Ga0495617_061067 | Ga0495617_061067_226_423 | 61 |
| 356 | 3300046452 | Ga0495617_086658 | Ga0495617_086658_67_264 | 61 |
| 357 | 3300046452 | Ga0495617_097426 | Ga0495617_097426_700_897 | 61 |
| 358 | 3300046453 | Ga0495627_000101 | Ga0495627_000101_93835_94032 | 61 |
| 359 | 3300046453 | Ga0495627_005742 | Ga0495627_005742_3279_3476 | 61 |
| 360 | 3300046453 | Ga0495627_010736 | Ga0495627_010736_1596_1793 | 61 |
| 361 | 3300046454 | Ga0495592_0063081 | Ga0495592_0063081_1359_1556 | 61 |
| 362 | 3300046457 | Ga0495590_0044692 | Ga0495590_0044692_433_630 | 61 |
| 363 | 3300046457 | Ga0495590_0195284 | Ga0495590_0195284_451_648 | 61 |
| 364 | 3300046458 | Ga0495591_000032 | Ga0495591_000032_10509_10706 | 61 |
| 365 | 3300046458 | Ga0495591_000082 | Ga0495591_000082_95830_96027 | 61 |
| 366 | 3300046458 | Ga0495591_017809 | Ga0495591_017809_1123_1320 | 61 |
| 367 | 3300046458 | Ga0495591_037727 | Ga0495591_037727_63_260 | 61 |
| 368 | 3300046458 | Ga0495591_147101 | Ga0495591_147101_17_214 | 61 |
| 369 | 3300046458 | Ga0495591_163458 | Ga0495591_163458_254_451 | 61 |
| 370 | 3300046460 | Ga0495638_0000449 | Ga0495638_0000449_18497_18694 | 61 |
| 371 | 3300046460 | Ga0495638_0043562 | Ga0495638_0043562_1632_1829 | 61 |
| 372 | 3300046460 | Ga0495638_0167622 | Ga0495638_0167622_900_1097 | 61 |
| 373 | 3300046460 | Ga0495638_0604717 | Ga0495638_0604717_71_268 | 61 |
| 374 | 3300046463 | Ga0495653_0035570 | Ga0495653_0035570_2146_2343 | 61 |
| 375 | 3300046463 | Ga0495653_0109156 | Ga0495653_0109156_748_945 | 61 |
| 376 | 3300046471 | Ga0495650_0009217 | Ga0495650_0009217_3851_4048 | 61 |
| 377 | 3300046471 | Ga0495650_0022904 | Ga0495650_0022904_944_1141 | 61 |
| 378 | 3300046471 | Ga0495650_0043435 | Ga0495650_0043435_82_279 | 61 |
| 379 | 3300046472 | Ga0495580_0437056 | Ga0495580_0437056_306_503 | 61 |
| 380 | 3300046474 | Ga0495605_0000147 | Ga0495605_0000147_79177_79374 | 61 |
| 381 | 3300046474 | Ga0495605_0034354 | Ga0495605_0034354_1237_1434 | 61 |
| 382 | 3300046474 | Ga0495605_0418719 | Ga0495605_0418719_286_483 | 61 |
| 383 | 3300046491 | Ga0495584_0014100 | Ga0495584_0014100_1989_2186 | 61 |
| 384 | 3300046492 | Ga0495585_0000234 | Ga0495585_0000234_32341_32538 | 61 |
| 385 | 3300046492 | Ga0495585_0003811 | Ga0495585_0003811_8334_8531 | 61 |
| 386 | 3300046492 | Ga0495585_0020869 | Ga0495585_0020869_1505_1702 | 61 |
| 387 | 3300046492 | Ga0495585_0369397 | Ga0495585_0369397_187_384 | 61 |
| 388 | 3300046500 | Ga0495596_0051284 | Ga0495596_0051284_1200_1397 | 61 |
| 389 | 3300046500 | Ga0495596_0250547 | Ga0495596_0250547_255_452 | 61 |
| 390 | 3300046501 | Ga0495607_0000603 | Ga0495607_0000603_29827_30024 | 61 |
| 391 | 3300046501 | Ga0495607_0053808 | Ga0495607_0053808_128_325 | 61 |
| 392 | 3300046501 | Ga0495607_0123450 | Ga0495607_0123450_993_1190 | 61 |
| 393 | 3300046506 | Ga0495583_0014877 | Ga0495583_0014877_2352_2549 | 61 |
| 394 | 3300046507 | Ga0495606_0007373 | Ga0495606_0007373_774_971 | 61 |
| 395 | 3300046507 | Ga0495606_0164399 | Ga0495606_0164399_1047_1244 | 61 |
| 396 | 3300046507 | Ga0495606_0183965 | Ga0495606_0183965_849_1046 | 61 |
| 397 | 3300046507 | Ga0495606_0261848 | Ga0495606_0261848_613_810 | 61 |
| 398 | 3300046507 | Ga0495606_0314617 | Ga0495606_0314617_215_412 | 61 |
| 399 | 3300046512 | Ga0495610_0000133 | Ga0495610_0000133_15621_15818 | 61 |
| 400 | 3300046512 | Ga0495610_0000173 | Ga0495610_0000173_1591_1788 | 61 |
| 401 | 3300046512 | Ga0495610_0003946 | Ga0495610_0003946_8320_8517 | 61 |
| 402 | 3300046512 | Ga0495610_0115398 | Ga0495610_0115398_375_572 | 61 |
| 403 | 3300046513 | Ga0495616_0001757 | Ga0495616_0001757_12864_13061 | 61 |
| 404 | 3300046513 | Ga0495616_0009481 | Ga0495616_0009481_3963_4160 | 61 |
| 405 | 3300046513 | Ga0495616_0126042 | Ga0495616_0126042_37_234 | 61 |
| 406 | 3300046513 | Ga0495616_0272256 | Ga0495616_0272256_222_419 | 61 |
| 407 | 3300046515 | Ga0495620_0011877 | Ga0495620_0011877_1546_1743 | 61 |
| 408 | 3300046515 | Ga0495620_0020652 | Ga0495620_0020652_1386_1583 | 61 |
| 409 | 3300046515 | Ga0495620_0026416 | Ga0495620_0026416_2158_2355 | 61 |
| 410 | 3300046515 | Ga0495620_0351896 | Ga0495620_0351896_319_516 | 61 |
| 411 | 3300046515 | Ga0495620_0389876 | Ga0495620_0389876_234_431 | 61 |
| 412 | 3300046518 | Ga0495631_0000013 | Ga0495631_0000013_8827_9024 | 61 |
| 413 | 3300046519 | Ga0495632_0002535 | Ga0495632_0002535_11372_11569 | 61 |
| 414 | 3300046519 | Ga0495632_0045071 | Ga0495632_0045071_1957_2154 | 61 |
| 415 | 3300046519 | Ga0495632_0073255 | Ga0495632_0073255_214_411 | 61 |
| 416 | 3300046519 | Ga0495632_0232721 | Ga0495632_0232721_300_497 | 61 |
| 417 | 3300046520 | Ga0495637_0000855 | Ga0495637_0000855_7894_8091 | 61 |
| 418 | 3300046520 | Ga0495637_0004752 | Ga0495637_0004752_70_267 | 61 |
| 419 | 3300046522 | Ga0495643_0000396 | Ga0495643_0000396_46757_46954 | 61 |
| 420 | 3300046522 | Ga0495643_0042273 | Ga0495643_0042273_744_941 | 61 |
| 421 | 3300046523 | Ga0495644_0005850 | Ga0495644_0005850_4201_4398 | 61 |
| 422 | 3300046524 | Ga0495648_0000259 | Ga0495648_0000259_19796_19993 | 61 |
| 423 | 3300046524 | Ga0495648_0006035 | Ga0495648_0006035_9414_9611 | 61 |
| 424 | 3300046524 | Ga0495648_0127771 | Ga0495648_0127771_965_1162 | 61 |
| 425 | 3300046526 | Ga0495666_0022607 | Ga0495666_0022607_1287_1484 | 61 |
| 426 | 3300046530 | Ga0495654_0000104 | Ga0495654_0000104_13712_13909 | 61 |
| 427 | 3300046530 | Ga0495654_0009881 | Ga0495654_0009881_3975_4172 | 61 |
| 428 | 3300046530 | Ga0495654_0106165 | Ga0495654_0106165_640_837 | 61 |
| 429 | 3300046530 | Ga0495654_0106167 | Ga0495654_0106167_450_647 | 61 |
| 430 | 3300046535 | Ga0495586_0518481 | Ga0495586_0518481_346_543 | 61 |
| 431 | 3300046536 | Ga0495587_0202399 | Ga0495587_0202399_92_289 | 61 |
| 432 | 3300046538 | Ga0495609_0007370 | Ga0495609_0007370_3314_3511 | 61 |
| 433 | 3300046538 | Ga0495609_0007402 | Ga0495609_0007402_1460_1657 | 61 |
| 434 | 3300046538 | Ga0495609_0019094 | Ga0495609_0019094_2181_2378 | 61 |
| 435 | 3300046542 | Ga0495597_0000965 | Ga0495597_0000965_19507_19704 | 61 |
| 436 | 3300046557 | Ga0495622_0000047 | Ga0495622_0000047_8829_9026 | 61 |
| 437 | 3300046558 | Ga0495633_0000304 | Ga0495633_0000304_45310_45507 | 61 |
| 438 | 3300046616 | Ga0495668_0002358 | Ga0495668_0002358_4140_4337 | 61 |
| 439 | 3300046616 | Ga0495668_0019393 | Ga0495668_0019393_3698_3895 | 61 |
| 440 | 3300046642 | Ga0495634_0043669 | Ga0495634_0043669_1351_1548 | 61 |
| 441 | 3300046642 | Ga0495634_0653411 | Ga0495634_0653411_398_595 | 61 |
| 442 | 3300046648 | Ga0495611_0000024 | Ga0495611_0000024_105787_105984 | 61 |
| 443 | 3300046648 | Ga0495611_0064734 | Ga0495611_0064734_62_259 | 61 |
| 444 | 3300046648 | Ga0495611_0085640 | Ga0495611_0085640_193_390 | 61 |
| 445 | 3300046660 | Ga0495625_0000103 | Ga0495625_0000103_123281_123478 | 61 |
| 446 | 3300046660 | Ga0495625_0002403 | Ga0495625_0002403_9667_9864 | 61 |
| 447 | 3300046660 | Ga0495625_0407322 | Ga0495625_0407322_325_522 | 61 |
| 448 | 3300046663 | Ga0495635_0798414 | Ga0495635_0798414_268_465 | 61 |
| 449 | 3300046665 | Ga0495661_0059049 | Ga0495661_0059049_584_781 | 61 |
| 450 | 3300046665 | Ga0495661_0099410 | Ga0495661_0099410_800_997 | 61 |
| 451 | 3300046689 | Ga0495613_0001739 | Ga0495613_0001739_11230_11427 | 61 |
| 452 | 3300046692 | Ga0495671_0000541 | Ga0495671_0000541_25872_26069 | 61 |
| 453 | 3300046692 | Ga0495671_0000799 | Ga0495671_0000799_2127_2324 | 61 |
| 454 | 3300046692 | Ga0495671_0008285 | Ga0495671_0008285_4002_4199 | 61 |
| 455 | 3300046694 | Ga0495649_0002309 | Ga0495649_0002309_11831_12028 | 61 |
| 456 | 3300046694 | Ga0495649_0005390 | Ga0495649_0005390_4980_5177 | 61 |
| 457 | 3300046694 | Ga0495649_0007150 | Ga0495649_0007150_2632_2829 | 61 |
| 458 | 3300046694 | Ga0495649_0096780 | Ga0495649_0096780_852_1049 | 61 |
| 459 | 3300046794 | Ga0495589_0161687 | Ga0495589_0161687_81_278 | 61 |
| 460 | 3300046794 | Ga0495589_0589663 | Ga0495589_0589663_32_229 | 61 |
| 461 | 3300046809 | Ga0495600_0017941 | Ga0495600_0017941_2908_3105 | 61 |
| 462 | 3300046810 | Ga0495660_0000785 | Ga0495660_0000785_808_1005 | 61 |
| 463 | 3300046810 | Ga0495660_0002576 | Ga0495660_0002576_9794_9991 | 61 |
| 464 | 3300046810 | Ga0495660_0012681 | Ga0495660_0012681_2036_2233 | 61 |
| 465 | 3300046810 | Ga0495660_0108915 | Ga0495660_0108915_1147_1344 | 61 |
| 466 | 3300046810 | Ga0495660_0200672 | Ga0495660_0200672_669_866 | 61 |
| 467 | 3300047317 | Ga0495604_0026516 | Ga0495604_0026516_1364_1561 | 61 |
| 468 | 3300047320 | Ga0495672_0015739 | Ga0495672_0015739_981_1178 | 61 |
| 469 | 3300047320 | Ga0495672_0034996 | Ga0495672_0034996_1333_1530 | 61 |
| 470 | 3300047321 | Ga0495676_0002653 | Ga0495676_0002653_5267_5464 | 61 |
| 471 | 3300047322 | Ga0495680_0005627 | Ga0495680_0005627_7407_7604 | 61 |
| 472 | 3300047323 | Ga0495683_0011172 | Ga0495683_0011172_3280_3477 | 61 |
| 473 | 3300047323 | Ga0495683_0410447 | Ga0495683_0410447_277_474 | 61 |
| 474 | 3300047446 | Ga0495679_000612 | Ga0495679_000612_11293_11490 | 61 |
| 475 | 3300047446 | Ga0495679_004870 | Ga0495679_004870_4797_4994 | 61 |
| 476 | 3300047446 | Ga0495679_007852 | Ga0495679_007852_2543_2740 | 61 |
| 477 | 3300047446 | Ga0495679_165567 | Ga0495679_165567_13_210 | 61 |
| 478 | 3300047469 | Ga0495673_0002039 | Ga0495673_0002039_12812_13009 | 61 |
| 479 | 3300047469 | Ga0495673_0008887 | Ga0495673_0008887_1485_1682 | 61 |
| 480 | 3300047469 | Ga0495673_0010193 | Ga0495673_0010193_949_1146 | 61 |
| 481 | 3300047469 | Ga0495673_0036415 | Ga0495673_0036415_1148_1345 | 61 |
| 482 | 3300047469 | Ga0495673_0045651 | Ga0495673_0045651_454_651 | 61 |
| 483 | 3300047470 | Ga0495681_0000231 | Ga0495681_0000231_9374_9571 | 61 |
| 484 | 3300047471 | Ga0495684_0010927 | Ga0495684_0010927_1621_1818 | 61 |
| 485 | 3300048088 | Ga0495602_0121621 | Ga0495602_0121621_1367_1564 | 61 |
| 486 | 3300048091 | Ga0495626_0000074 | Ga0495626_0000074_9077_9274 | 61 |
| 487 | 3300048091 | Ga0495626_0007211 | Ga0495626_0007211_2577_2774 | 61 |
| 488 | 3300048091 | Ga0495626_0010037 | Ga0495626_0010037_1021_1218 | 61 |
| 489 | 3300048091 | Ga0495626_0076279 | Ga0495626_0076279_775_972 | 61 |
| 490 | 3300048091 | Ga0495626_0096151 | Ga0495626_0096151_482_679 | 61 |
| 491 | 3300048908 | Ga0496105_1402681 | Ga0496105_1402681_279_476 | 61 |
| 492 | 3300048913 | Ga0496110_0208449 | Ga0496110_0208449_855_1052 | 61 |
| 493 | 3300048920 | Ga0496117_0067429 | Ga0496117_0067429_396_593 | 61 |
| 494 | 3300048921 | Ga0496118_0074693 | Ga0496118_0074693_1826_2023 | 61 |
| 495 | 3300048921 | Ga0496118_0325142 | Ga0496118_0325142_163_360 | 61 |
| 496 | 3300048922 | Ga0496119_0072833 | Ga0496119_0072833_601_798 | 61 |
| 497 | 3300048923 | Ga0496120_0247487 | Ga0496120_0247487_587_784 | 61 |
| 498 | 3300048924 | Ga0496121_0062032 | Ga0496121_0062032_994_1191 | 61 |
| 499 | 3300048925 | Ga0496122_0130664 | Ga0496122_0130664_1276_1473 | 61 |
| 500 | 3300048926 | Ga0496123_0197762 | Ga0496123_0197762_558_755 | 61 |
| 501 | 3300048927 | Ga0496124_0039692 | Ga0496124_0039692_584_781 | 61 |
| 502 | 3300048927 | Ga0496124_0122912 | Ga0496124_0122912_726_923 | 61 |
| 503 | 3300048927 | Ga0496124_0280677 | Ga0496124_0280677_572_769 | 61 |
| 504 | 3300048928 | Ga0496125_0094137 | Ga0496125_0094137_1355_1552 | 61 |
| 505 | 3300048928 | Ga0496125_0179600 | Ga0496125_0179600_1028_1225 | 61 |
| 506 | 3300049459 | Ga0495678_001994 | Ga0495678_001994_1667_1864 | 61 |
| 507 | 3300049459 | Ga0495678_008180 | Ga0495678_008180_2742_2939 | 61 |
| 508 | 3300049459 | Ga0495678_048215 | Ga0495678_048215_57_254 | 61 |
| 509 | 3300049459 | Ga0495678_102005 | Ga0495678_102005_369_566 | 61 |
| 510 | 3300049459 | Ga0495678_163879 | Ga0495678_163879_440_637 | 61 |
| 511 | 3300049570 | Ga0501033_0433387 | Ga0501033_0433387_26_241 | 61 |
| 512 | 3300049573 | Ga0501037_0069254 | Ga0501037_0069254_932_1129 | 61 |
| 513 | 3300049581 | Ga0501047_0044992 | Ga0501047_0044992_1584_1781 | 61 |
| 514 | 3300049586 | Ga0501070_0982390 | Ga0501070_0982390_313_510 | 61 |
| 515 | 3300049822 | Ga0501035_0110431 | Ga0501035_0110431_995_1192 | 61 |
| 516 | 3300049823 | Ga0501044_0014847 | Ga0501044_0014847_2280_2477 | 61 |
| 517 | 3300053108 | Ga0500562_121127 | Ga0500562_121127_148_345 | 61 |
| 518 | 3300053111 | Ga0500572_002475 | Ga0500572_002475_3592_3789 | 61 |
| 519 | 3300053145 | Ga0500586_280837 | Ga0500586_280837_251_448 | 61 |
| 520 | 3300054114 | Ga0501084_1330215 | Ga0501084_1330215_202_399 | 61 |
| 521 | 3300005295 | Ga0065707_10854783 | Ga0065707_108547831 | 62 |
| 522 | 3300005339 | Ga0070660_101272861 | Ga0070660_1012728612 | 62 |
| 523 | 3300005441 | Ga0070700_100834680 | Ga0070700_1008346802 | 62 |
| 524 | 3300005549 | Ga0070704_100646629 | Ga0070704_1006466291 | 62 |
| 525 | 3300005617 | Ga0068859_101163573 | Ga0068859_1011635732 | 62 |
| 526 | 3300006931 | Ga0097620_101163354 | Ga0097620_1011633542 | 62 |
| 527 | 3300007265 | Ga0099794_10076507 | Ga0099794_100765072 | 62 |
| 528 | 3300009011 | Ga0105251_10038446 | Ga0105251_100384463 | 62 |
| 529 | 3300009094 | Ga0111539_10003004 | Ga0111539_1000300414 | 62 |
| 530 | 3300009147 | Ga0114129_12434619 | Ga0114129_124346192 | 62 |
| 531 | 3300009553 | Ga0105249_10421837 | Ga0105249_104218372 | 62 |
| 532 | 3300013105 | Ga0157369_10226243 | Ga0157369_102262433 | 62 |
| 533 | 3300014745 | Ga0157377_11619666 | Ga0157377_116196661 | 62 |
| 534 | 3300025903 | Ga0207680_10333177 | Ga0207680_103331771 | 62 |
| 535 | 3300026023 | Ga0207677_11217232 | Ga0207677_112172322 | 62 |
| 536 | 3300026089 | Ga0207648_11901496 | Ga0207648_119014961 | 62 |
| 537 | 3300027907 | Ga0207428_10007515 | Ga0207428_100075154 | 62 |
| 538 | 3300028379 | Ga0268266_12292251 | Ga0268266_122922512 | 62 |
| 539 | 3300031241 | Ga0265325_10435894 | Ga0265325_104358941 | 62 |
| 540 | 3300031727 | Ga0316576_10404515 | Ga0316576_104045153 | 62 |
| 541 | 3300031731 | Ga0307405_10447808 | Ga0307405_104478082 | 62 |
| 542 | 3300031733 | Ga0316577_10174379 | Ga0316577_101743792 | 62 |
| 543 | 3300031903 | Ga0307407_11284157 | Ga0307407_112841572 | 62 |
| 544 | 3300031995 | Ga0307409_102392622 | Ga0307409_1023926222 | 62 |
| 545 | 3300032002 | Ga0307416_100606929 | Ga0307416_1006069292 | 62 |
| 546 | 3300032004 | Ga0307414_10365980 | Ga0307414_103659802 | 62 |
| 547 | 3300032005 | Ga0307411_10567117 | Ga0307411_105671172 | 62 |
| 548 | 3300032139 | Ga0316580_10003837 | Ga0316580_100038374 | 62 |
| 549 | 3300035695 | Ga0373927_0373784 | Ga0373927_0373784_161_367 | 62 |
| 550 | 3300036647 | Ga0316582_0668945 | Ga0316582_0668945_160_360 | 62 |
| 551 | 3300036712 | Ga0316584_0459503 | Ga0316584_0459503_149_349 | 62 |
| 552 | 3300039438 | Ga0436360_0809450 | Ga0436360_0809450_404_604 | 62 |
| 553 | 3300039438 | Ga0436360_0822581 | Ga0436360_0822581_158_358 | 62 |
| 554 | 3300039453 | Ga0436362_0544016 | Ga0436362_0544016_480_680 | 62 |
| 555 | 3300041492 | Ga0451835_0461422 | Ga0451835_0461422_688_888 | 62 |
| 556 | 3300041494 | Ga0451837_0202422 | Ga0451837_0202422_296_496 | 62 |
| 557 | 3300041503 | Ga0451847_0762432 | Ga0451847_0762432_221_421 | 62 |
| 558 | 3300041511 | Ga0451855_1322555 | Ga0451855_1322555_316_516 | 62 |
| 559 | 3300041512 | Ga0451853_2292328 | Ga0451853_2292328_661_861 | 62 |
| 560 | 3300044712 | Ga0453684_0023941 | Ga0453684_0023941_7785_7985 | 62 |
| 561 | 3300045051 | Ga0451576_2314195 | Ga0451576_2314195_13_213 | 62 |
| 562 | 3300045051 | Ga0451576_2321386 | Ga0451576_2321386_300_500 | 62 |
| 563 | 3300046455 | Ga0495603_0068327 | Ga0495603_0068327_786_995 | 62 |
| 564 | 3300046616 | Ga0495668_0464086 | Ga0495668_0464086_74_286 | 62 |
| 565 | 3300046674 | Ga0495588_0009849 | Ga0495588_0009849_2329_2538 | 62 |
| 566 | 3300046681 | Ga0495647_0012185 | Ga0495647_0012185_998_1207 | 62 |
| 567 | 3300047315 | Ga0495581_0053318 | Ga0495581_0053318_324_533 | 62 |
| 568 | 3300047321 | Ga0495676_0024971 | Ga0495676_0024971_853_1062 | 62 |
| 569 | 3300047472 | Ga0495686_0014265 | Ga0495686_0014265_1362_1574 | 62 |
| 570 | 3300048919 | Ga0496116_0001015 | Ga0496116_0001015_4662_4862 | 62 |
| 571 | 3300048920 | Ga0496117_0000475 | Ga0496117_0000475_50783_50983 | 62 |
| 572 | 3300048921 | Ga0496118_0000482 | Ga0496118_0000482_50847_51047 | 62 |
| 573 | 3300048925 | Ga0496122_0009192 | Ga0496122_0009192_487_687 | 62 |
| 574 | 3300048926 | Ga0496123_0003395 | Ga0496123_0003395_15015_15215 | 62 |
| 575 | 3300049582 | Ga0501048_0459442 | Ga0501048_0459442_231_431 | 62 |
| 576 | 3300049586 | Ga0501070_1162509 | Ga0501070_1162509_165_371 | 62 |
| 577 | 3300049588 | Ga0501072_0181537 | Ga0501072_0181537_1219_1419 | 62 |
| 578 | 3300049590 | Ga0501074_0792939 | Ga0501074_0792939_335_541 | 62 |
| 579 | 3300049660 | Ga0501216_045412 | Ga0501216_045412_63_263 | 62 |
| 580 | 3300050510 | nmdc:mga06r32_911818_c1 | nmdc:mga06r32_911818_c1_570_770 | 62 |
| 581 | 3300050511 | nmdc:mga08y16_4529_c1 | nmdc:mga08y16_4529_c1_9993_10193 | 62 |
| 582 | 3300053139 | Ga0500568_0121341 | Ga0500568_0121341_334_546 | 62 |
| 583 | 3300053730 | Ga0500645_004039 | Ga0500645_004039_4202_4414 | 62 |
| 584 | 3300059424 | Ga0590075_014819 | Ga0590075_014819_1634_1834 | 62 |
| 585 | 3300003320 | rootH2_10024047 | rootH2_100240476 | 63 |
| 586 | 3300005336 | Ga0070680_100091889 | Ga0070680_1000918893 | 63 |
| 587 | 3300005435 | Ga0070714_100200072 | Ga0070714_1002000723 | 63 |
| 588 | 3300005444 | Ga0070694_100011869 | Ga0070694_1000118693 | 63 |
| 589 | 3300005563 | Ga0068855_100116656 | Ga0068855_1001166563 | 63 |
| 590 | 3300006846 | Ga0075430_100193680 | Ga0075430_1001936802 | 63 |
| 591 | 3300006946 | Ga0079104_1038296 | Ga0079104_10382962 | 63 |
| 592 | 3300009147 | Ga0114129_10005995 | Ga0114129_1000599514 | 63 |
| 593 | 3300013100 | Ga0157373_11105377 | Ga0157373_111053772 | 63 |
| 594 | 3300013102 | Ga0157371_10100965 | Ga0157371_101009653 | 63 |
| 595 | 3300013104 | Ga0157370_10085403 | Ga0157370_100854032 | 63 |
| 596 | 3300013308 | Ga0157375_10228060 | Ga0157375_102280604 | 63 |
| 597 | 3300014326 | Ga0157380_10084749 | Ga0157380_100847493 | 63 |
| 598 | 3300025920 | Ga0207649_10521825 | Ga0207649_105218252 | 63 |
| 599 | 3300025929 | Ga0207664_10537005 | Ga0207664_105370052 | 63 |
| 600 | 3300025949 | Ga0207667_10122051 | Ga0207667_101220512 | 63 |
| 601 | 3300025972 | Ga0207668_11822885 | Ga0207668_118228852 | 63 |
| 602 | 3300025981 | Ga0207640_10834947 | Ga0207640_108349472 | 63 |
| 603 | 3300025986 | Ga0207658_10057884 | Ga0207658_100578842 | 63 |
| 604 | 3300026142 | Ga0207698_10324361 | Ga0207698_103243612 | 63 |
| 605 | 3300027111 | Ga0209281_1020171 | Ga0209281_10201713 | 63 |
| 606 | 3300028380 | Ga0268265_10772792 | Ga0268265_107727923 | 63 |
| 607 | 3300031090 | Ga0265760_10082623 | Ga0265760_100826232 | 63 |
| 608 | 3300031911 | Ga0307412_10679188 | Ga0307412_106791882 | 63 |
| 609 | 3300031911 | Ga0307412_11662562 | Ga0307412_116625622 | 63 |
| 610 | 3300032004 | Ga0307414_10617061 | Ga0307414_106170612 | 63 |
| 611 | 3300035119 | Ga0373956_0045320 | Ga0373956_0045320_1467_1670 | 63 |
| 612 | 3300035120 | Ga0373957_0041997 | Ga0373957_0041997_1346_1549 | 63 |
| 613 | 3300035172 | Ga0373955_0287772 | Ga0373955_0287772_596_799 | 63 |
| 614 | 3300035410 | Ga0373924_0018038 | Ga0373924_0018038_1155_1358 | 63 |
| 615 | 3300035692 | Ga0373935_0011040 | Ga0373935_0011040_630_854 | 63 |
| 616 | 3300035692 | Ga0373935_0069521 | Ga0373935_0069521_16_219 | 63 |
| 617 | 3300035695 | Ga0373927_0589543 | Ga0373927_0589543_406_609 | 63 |
| 618 | 3300036401 | Ga0373937_0002374 | Ga0373937_0002374_6959_7162 | 63 |
| 619 | 3300037471 | Ga0395905_1032376 | Ga0395905_1032376_453_665 | 63 |
| 620 | 3300041405 | Ga0439438_006478 | Ga0439438_006478_1645_1860 | 63 |
| 621 | 3300041407 | Ga0439447_023816 | Ga0439447_023816_1293_1508 | 63 |
| 622 | 3300042006 | Ga0439432_028822 | Ga0439432_028822_786_1001 | 63 |
| 623 | 3300042010 | Ga0439452_028068 | Ga0439452_028068_889_1104 | 63 |
| 624 | 3300042013 | Ga0439456_020350 | Ga0439456_020350_307_522 | 63 |
| 625 | 3300042115 | Ga0450911_016424 | Ga0450911_016424_607_822 | 63 |
| 626 | 3300042136 | Ga0450900_001423 | Ga0450900_001423_1953_2168 | 63 |
| 627 | 3300042137 | Ga0450902_006363 | Ga0450902_006363_1213_1428 | 63 |
| 628 | 3300042138 | Ga0450903_007678 | Ga0450903_007678_344_559 | 63 |
| 629 | 3300042142 | Ga0450905_021159 | Ga0450905_021159_410_625 | 63 |
| 630 | 3300042146 | Ga0450907_006503 | Ga0450907_006503_1154_1369 | 63 |
| 631 | 3300042532 | Ga0450893_0122840 | Ga0450893_0122840_72_287 | 63 |
| 632 | 3300044673 | Ga0453683_0943569 | Ga0453683_0943569_53_280 | 63 |
| 633 | 3300044712 | Ga0453684_0179887 | Ga0453684_0179887_658_885 | 63 |
| 634 | 3300045051 | Ga0451576_0213695 | Ga0451576_0213695_100_327 | 63 |
| 635 | 3300046455 | Ga0495603_0561847 | Ga0495603_0561847_209_412 | 63 |
| 636 | 3300046458 | Ga0495591_000120 | Ga0495591_000120_13469_13678 | 63 |
| 637 | 3300046473 | Ga0495582_0096427 | Ga0495582_0096427_571_774 | 63 |
| 638 | 3300046499 | Ga0495594_0065163 | Ga0495594_0065163_335_538 | 63 |
| 639 | 3300046518 | Ga0495631_0020958 | Ga0495631_0020958_2042_2248 | 63 |
| 640 | 3300046519 | Ga0495632_0023186 | Ga0495632_0023186_1991_2197 | 63 |
| 641 | 3300046538 | Ga0495609_0000879 | Ga0495609_0000879_9896_10102 | 63 |
| 642 | 3300046538 | Ga0495609_0428857 | Ga0495609_0428857_23_226 | 63 |
| 643 | 3300046660 | Ga0495625_0028552 | Ga0495625_0028552_2163_2369 | 63 |
| 644 | 3300046690 | Ga0495624_0097110 | Ga0495624_0097110_939_1148 | 63 |
| 645 | 3300047320 | Ga0495672_0003653 | Ga0495672_0003653_11047_11256 | 63 |
| 646 | 3300049579 | Ga0501043_0001012 | Ga0501043_0001012_13789_14001 | 63 |
| 647 | 3300049580 | Ga0501046_0000044 | Ga0501046_0000044_36080_36292 | 63 |
| 648 | 3300049581 | Ga0501047_0007075 | Ga0501047_0007075_8718_8930 | 63 |
| 649 | 3300049582 | Ga0501048_0000140 | Ga0501048_0000140_26560_26772 | 63 |
| 650 | 3300049584 | Ga0501068_0330768 | Ga0501068_0330768_534_764 | 63 |
| 651 | 3300049588 | Ga0501072_0468805 | Ga0501072_0468805_760_966 | 63 |
| 652 | 3300049744 | Ga0501083_0000008 | Ga0501083_0000008_35828_36040 | 63 |
| 653 | 3300049822 | Ga0501035_0016147 | Ga0501035_0016147_5458_5670 | 63 |
| 654 | 3300049823 | Ga0501044_0019695 | Ga0501044_0019695_5050_5262 | 63 |
| 655 | 3300050491 | nmdc:mga00v17_153926_c1 | nmdc:mga00v17_153926_c1_996_1202 | 63 |
| 656 | 3300050491 | nmdc:mga00v17_256829_c1 | nmdc:mga00v17_256829_c1_890_1096 | 63 |
| 657 | 3300050509 | nmdc:mga0qj67_313144_c1 | nmdc:mga0qj67_313144_c1_48_263 | 63 |
| 658 | 3300050511 | nmdc:mga08y16_705768_c1 | nmdc:mga08y16_705768_c1_55_261 | 63 |
| 659 | 3300050512 | nmdc:mga0n895_816555_c1 | nmdc:mga0n895_816555_c1_330_572 | 63 |
| 660 | 3300060353 | Ga0501082_0100222 | Ga0501082_0100222_897_1109 | 63 |
| 661 | iso_pu_bacteria | 2842832357 | 2842835312 | 63 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hkx-assembly1.cif.gz_A | structure of cooa mutant (n127l/s128l) from carboxydothermus hydrogenoformans | 0.9722 | 9 | 32 |
| 2xi8-assembly1.cif.gz_A | high resolution structure of native cylr2 | 0.9512 | 2 | 61 |
| 2xj3-assembly1.cif.gz_A | high resolution structure of the t55c mutant of cylr2. | 0.9511 | 2 | 61 |
| 2xj3-assembly1.cif.gz_B | high resolution structure of the t55c mutant of cylr2. | 0.9491 | 2 | 57 |
| 3jxc-assembly1.cif.gz_L | crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ | 0.9398 | 2 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57720_1_65_1.10.260.40 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9882 | 2 | 59 | 1.10.260.40 |
| 2kpjA01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9538 | 2 | 55 | 1.10.260.40 |
| 3jxbD00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9407 | 2 | 59 | 1.10.260.40 |
| 2r1jL00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9393 | 2 | 59 | 1.10.260.40 |
| 2lykB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9298 | 2 | 55 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3R7EKQ7-F1-model_v4 | Putative transcriptional regulator | 1.003 | 1 | 59 |
GO:0003677
|
| AF-A0A6L8F9T1-F1-model_v4 | deleted | 1.003 | 2 | 54 |
|
| AF-A0A328P874-F1-model_v4 | Transcriptional regulator | 1.002 | 1 | 57 |
GO:0003677
|
| AF-V9GAV8-F1-model_v4 | Transcriptional regulator, XRE family | 1.001 | 2 | 57 |
GO:0003677
|
| AF-A0A0B2XJD3-F1-model_v4 | deleted | 0.9998 | 2 | 54 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar