F473440

General Info

Members Datasets Scaffolds Average Seq Length
661 363 660 65

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_816555_c1|nmdc:mga0n895_816555_c1_330_572
Length 80
Sequence MKNRLRVLRAERNWSQADLASHLGVSRQTVNSIENEKYDPSLPLAFDISRLFEQPIEAIFQPEPEPPGKAQQERSCDERQ

Samples

Sample ID Description Type Environment
1 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
193 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
194 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
195 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
202 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
203 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
204 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
205 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
206 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
207 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
208 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
209 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
210 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
211 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
212 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
233 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
251 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
292 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
293 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
329 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
333 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
344 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
346 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
347 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
348 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
349 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
350 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
351 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
352 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
353 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.15
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 0.61
Rhizoplane 1.21
Rhizosphere 83.96
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10024047 3300003320 Bacteria 6579
2 Ga0055525_1000070 3300003759 Bacteria 183047
3 Ga0055536_1001560 3300003781 Bacteria 13736
4 Ga0055536_1005420 3300003781 Bacteria 6243
5 Ga0055530_10000497 3300003791 Bacteria 34124
6 Ga0055530_10002634 3300003791 Bacteria 11252
7 Ga0055540_1014480 3300003792 Bacteria 2345
8 Ga0055531_10010233 3300003794 Bacteria 4689
9 Ga0065165_1000806 3300005262 Bacteria 41749
10 Ga0065707_10854783 3300005295 Bacteria 575
11 Ga0070658_10041757 3300005327 Bacteria 3701
12 Ga0070658_10144065 3300005327 Bacteria 1991
13 Ga0070658_10527030 3300005327 Bacteria 1022
14 Ga0070676_10713696 3300005328 Bacteria 733
15 Ga0070676_10840813 3300005328 Bacteria 680
16 Ga0070683_101834240 3300005329 Bacteria 583
17 Ga0070690_100047811 3300005330 Bacteria 2723
18 Ga0070670_100077601 3300005331 Bacteria 2854
19 Ga0070677_10421556 3300005333 Bacteria 708
20 Ga0068869_100018317 3300005334 Bacteria 4765
21 Ga0070680_100091889 3300005336 Bacteria 2513
22 Ga0068868_100372121 3300005338 Bacteria 1228
23 Ga0070660_100000511 3300005339 Bacteria 25935
24 Ga0070660_100184949 3300005339 Bacteria 1687
25 Ga0070660_101272861 3300005339 Bacteria 624
26 Ga0070660_101797456 3300005339 Bacteria 522
27 Ga0070689_100646074 3300005340 Bacteria 920
28 Ga0070668_101529167 3300005347 Bacteria 610
29 Ga0070669_102020223 3300005353 Bacteria 504
30 Ga0070675_100174762 3300005354 Bacteria 1854
31 Ga0070675_100908625 3300005354 Bacteria 807
32 Ga0070659_100000005 3300005366 Bacteria 259902
33 Ga0070659_101594428 3300005366 Bacteria 583
34 Ga0070709_10555675 3300005434 Unclassified 879
35 Ga0070714_100124662 3300005435 Bacteria 2295
36 Ga0070714_100200072 3300005435 Unclassified 1827
37 Ga0070713_100356448 3300005436 Unclassified 1358
38 Ga0070705_101322456 3300005440 Bacteria 598
39 Ga0070700_100834680 3300005441 Unclassified 745
40 Ga0070694_100011869 3300005444 Bacteria 5404
41 Ga0070708_100230586 3300005445 Unclassified 1737
42 Ga0070678_100690117 3300005456 Bacteria 919
43 Ga0070662_100594710 3300005457 Bacteria 930
44 Ga0070681_10666649 3300005458 Bacteria 955
45 Ga0068867_100083134 3300005459 Bacteria 2417
46 Ga0068867_100282315 3300005459 Bacteria 1362
47 Ga0070707_102229810 3300005468 Unclassified 515
48 Ga0070698_100071714 3300005471 Unclassified 3473
49 Ga0070684_100373980 3300005535 Bacteria 1312
50 Ga0068853_100606598 3300005539 Bacteria 1040
51 Ga0068853_101264286 3300005539 Bacteria 713
52 Ga0070672_100414128 3300005543 Bacteria 1157
53 Ga0070672_100620664 3300005543 Bacteria 943
54 Ga0070696_101297291 3300005546 Bacteria 618
55 Ga0070704_100030777 3300005549 Unclassified 3600
56 Ga0070704_100646629 3300005549 Bacteria 933
57 Ga0068855_100013193 3300005563 Bacteria 9968
58 Ga0068855_100116656 3300005563 Bacteria 3060
59 Ga0068855_100196722 3300005563 Bacteria 2271
60 Ga0068855_100546955 3300005563 Bacteria 1254
61 Ga0070664_100662898 3300005564 Bacteria 970
62 Ga0068857_100212663 3300005577 Bacteria 1765
63 Ga0068857_101104445 3300005577 Bacteria 766
64 Ga0068856_100829647 3300005614 Bacteria 944
65 Ga0068852_101788746 3300005616 Bacteria 637
66 Ga0068859_101163573 3300005617 Unclassified 849
67 Ga0068861_102246409 3300005719 Bacteria 547
68 Ga0068861_102402597 3300005719 Bacteria 530
69 Ga0068863_100044677 3300005841 Bacteria 4204
70 Ga0068863_102038495 3300005841 Bacteria 584
71 Ga0068860_100023746 3300005843 Bacteria 5928
72 Ga0068860_100125586 3300005843 Bacteria 2459
73 Ga0068862_101036340 3300005844 Bacteria 813
74 Ga0070716_101170974 3300006173 Bacteria 616
75 Ga0075366_10185123 3300006195 Bacteria 1265
76 Ga0075366_10561221 3300006195 Bacteria 707
77 Ga0075370_10917614 3300006353 Bacteria 536
78 Ga0075428_101036436 3300006844 Bacteria 868
79 Ga0075430_100193680 3300006846 Bacteria 1689
80 Ga0075431_101113139 3300006847 Bacteria 754
81 Ga0075429_100291085 3300006880 Bacteria 1430
82 Ga0068865_100189477 3300006881 Bacteria 1589
83 Ga0097620_101163354 3300006931 Unclassified 849
84 Ga0079104_1022939 3300006946 Bacteria 1669
85 Ga0079104_1038296 3300006946 Bacteria 1137
86 Ga0075435_101381635 3300007076 Bacteria 617
87 Ga0099794_10076507 3300007265 Bacteria 1645
88 Ga0099794_10451681 3300007265 Bacteria 674
89 Ga0105251_10038446 3300009011 Bacteria 2344
90 Ga0105251_10057008 3300009011 Bacteria 1847
91 Ga0105251_10116611 3300009011 Bacteria 1214
92 Ga0105250_10001803 3300009092 Bacteria 11215
93 Ga0105240_10065300 3300009093 Bacteria 4518
94 Ga0105240_10195742 3300009093 Bacteria 2373
95 Ga0105240_10427852 3300009093 Bacteria 1486
96 Ga0105240_12414585 3300009093 Bacteria 544
97 Ga0111539_10003004 3300009094 Bacteria 22363
98 Ga0111539_12686020 3300009094 Bacteria 577
99 Ga0105245_10063800 3300009098 Bacteria 3328
100 Ga0105245_10355848 3300009098 Bacteria 1452
101 Ga0105245_11201528 3300009098 Bacteria 806
102 Ga0114129_10005995 3300009147 Bacteria 17223
103 Ga0114129_10033069 3300009147 Bacteria 7309
104 Ga0114129_12434619 3300009147 Bacteria 627
105 Ga0105243_11092557 3300009148 Bacteria 805
106 Ga0105242_10167926 3300009176 Bacteria 1926
107 Ga0105242_11406385 3300009176 Bacteria 725
108 Ga0105242_12716843 3300009176 Bacteria 545
109 Ga0105237_10997139 3300009545 Bacteria 844
110 Ga0105238_11190577 3300009551 Bacteria 786
111 Ga0105238_11905137 3300009551 Bacteria 627
112 Ga0105238_11915520 3300009551 Bacteria 626
113 Ga0105238_12278678 3300009551 Bacteria 577
114 Ga0105249_10421837 3300009553 Bacteria 1368
115 Ga0105249_10906080 3300009553 Bacteria 949
116 Ga0105249_12612958 3300009553 Bacteria 577
117 Ga0105239_10219490 3300010375 Bacteria 2132
118 Ga0105239_10638183 3300010375 Bacteria 1216
119 Ga0105239_11900377 3300010375 Bacteria 690
120 Ga0105246_10047321 3300011119 Bacteria 2937
121 Ga0105246_11782373 3300011119 Bacteria 588
122 Ga0157345_1000004 3300012498 Bacteria 80365
123 Ga0157373_10592543 3300013100 Bacteria 806
124 Ga0157373_11105377 3300013100 Bacteria 595
125 Ga0157371_10100965 3300013102 Bacteria 2047
126 Ga0157371_10151186 3300013102 Bacteria 1656
127 Ga0157371_10410373 3300013102 Bacteria 992
128 Ga0157371_10800311 3300013102 Bacteria 710
129 Ga0157370_10070925 3300013104 Bacteria 3288
130 Ga0157370_10085403 3300013104 Bacteria 2965
131 Ga0157370_10266574 3300013104 Bacteria 1582
132 Ga0157370_10480058 3300013104 Bacteria 1142
133 Ga0157370_10693578 3300013104 Bacteria 929
134 Ga0157370_10745089 3300013104 Bacteria 893
135 Ga0157370_11524983 3300013104 Bacteria 601
136 Ga0157369_10000286 3300013105 Bacteria 67677
137 Ga0157369_10045234 3300013105 Bacteria 4789
138 Ga0157369_10226243 3300013105 Bacteria 1957
139 Ga0157369_11987240 3300013105 Bacteria 590
140 Ga0157374_10001026 3300013296 Bacteria 24241
141 Ga0157374_11733915 3300013296 Bacteria 649
142 Ga0157378_10094847 3300013297 Bacteria 2717
143 Ga0163162_10472910 3300013306 Bacteria 1385
144 Ga0163162_11279787 3300013306 Bacteria 833
145 Ga0157375_10098142 3300013308 Bacteria 3005
146 Ga0157375_10228060 3300013308 Bacteria 2021
147 Ga0157375_10824280 3300013308 Bacteria 1076
148 Ga0163163_10051008 3300014325 Bacteria 4078
149 Ga0157380_10084749 3300014326 Bacteria 2599
150 Ga0157380_11316911 3300014326 Bacteria 770
151 Ga0182008_10015262 3300014497 Bacteria 4010
152 Ga0157377_10323589 3300014745 Bacteria 1025
153 Ga0157377_11467735 3300014745 Bacteria 541
154 Ga0157377_11619666 3300014745 Bacteria 519
155 Ga0157376_11378395 3300014969 Bacteria 736
156 Ga0182005_1008233 3300015265 Bacteria 3083
157 Ga0163161_10059022 3300017792 Bacteria 2789
158 Ga0163161_10123333 3300017792 Bacteria 1949
159 Ga0209563_100053 3300025230 Bacteria 332370
160 Ga0209677_101505 3300025253 Bacteria 10000
161 Ga0209676_1000138 3300025292 Bacteria 178932
162 Ga0209676_1000832 3300025292 Bacteria 39998
163 Ga0209564_1018162 3300025295 Bacteria 2696
164 Ga0209758_1024949 3300025297 Bacteria 2643
165 Ga0209050_1000121 3300025298 Bacteria 196019
166 Ga0209050_1001184 3300025298 Bacteria 30681
167 Ga0209050_1089822 3300025298 Bacteria 632
168 Ga0207426_1068343 3300025302 Bacteria 999
169 Ga0209051_1003081 3300025303 Bacteria 11251
170 Ga0209257_1000125 3300025304 Bacteria 218126
171 Ga0209257_1004893 3300025304 Bacteria 9889
172 Ga0207696_1001491 3300025711 Bacteria 12591
173 Ga0207696_1001893 3300025711 Bacteria 10684
174 Ga0207655_1017725 3300025728 Bacteria 3826
175 Ga0207713_1011282 3300025735 Bacteria 4872
176 Ga0207688_10093713 3300025901 Bacteria 1727
177 Ga0207680_10333177 3300025903 Bacteria 1063
178 Ga0207645_10598417 3300025907 Bacteria 749
179 Ga0207705_10131851 3300025909 Bacteria 1860
180 Ga0207705_10666327 3300025909 Bacteria 809
181 Ga0207695_10021692 3300025913 Bacteria 7321
182 Ga0207695_10273993 3300025913 Bacteria 1582
183 Ga0207649_10521825 3300025920 Bacteria 906
184 Ga0207659_10806204 3300025926 Bacteria 807
185 Ga0207687_10168964 3300025927 Bacteria 1685
186 Ga0207687_11890201 3300025927 Bacteria 510
187 Ga0207700_11411762 3300025928 Unclassified 619
188 Ga0207664_10537005 3300025929 Bacteria 1049
189 Ga0207664_11394254 3300025929 Bacteria 621
190 Ga0207690_10542574 3300025932 Bacteria 945
191 Ga0207690_10775006 3300025932 Bacteria 792
192 Ga0207690_11402617 3300025932 Bacteria 584
193 Ga0207706_10051270 3300025933 Bacteria 3644
194 Ga0207706_10509011 3300025933 Bacteria 1039
195 Ga0207686_10014800 3300025934 Bacteria 4352
196 Ga0207709_10855210 3300025935 Bacteria 737
197 Ga0207670_10035207 3300025936 Bacteria 3245
198 Ga0207691_10347548 3300025940 Bacteria 1269
199 Ga0207689_10014590 3300025942 Bacteria 6680
200 Ga0207679_10487440 3300025945 Bacteria 1098
201 Ga0207667_10027912 3300025949 Bacteria 6135
202 Ga0207667_10122051 3300025949 Bacteria 2685
203 Ga0207668_11822885 3300025972 Bacteria 549
204 Ga0207640_10760949 3300025981 Bacteria 836
205 Ga0207640_10834947 3300025981 Bacteria 801
206 Ga0207658_10057884 3300025986 Bacteria 2882
207 Ga0207677_11217232 3300026023 Bacteria 690
208 Ga0207639_11665174 3300026041 Bacteria 598
209 Ga0207678_11042401 3300026067 Bacteria 724
210 Ga0207648_10145160 3300026089 Bacteria 2093
211 Ga0207648_10306461 3300026089 Bacteria 1425
212 Ga0207648_11901496 3300026089 Bacteria 557
213 Ga0207674_10112152 3300026116 Bacteria 2701
214 Ga0207674_10160449 3300026116 Bacteria 2203
215 Ga0207674_12126336 3300026116 Bacteria 525
216 Ga0207675_102093909 3300026118 Bacteria 582
217 Ga0207698_10324361 3300026142 Bacteria 1444
218 Ga0209281_1002352 3300027111 Bacteria 7794
219 Ga0209281_1020171 3300027111 Bacteria 1307
220 Ga0207428_10007515 3300027907 Bacteria 9928
221 Ga0268266_12292251 3300028379 Bacteria 511
222 Ga0268265_10456238 3300028380 Bacteria 1195
223 Ga0268265_10772792 3300028380 Bacteria 934
224 Ga0268264_10027029 3300028381 Bacteria 4687
225 Ga0268264_10961468 3300028381 Bacteria 859
226 Ga0265334_10120105 3300028573 Bacteria 939
227 Ga0307515_10143053 3300028794 Bacteria 2552
228 Ga0307515_10725384 3300028794 Bacteria 611
229 Ga0265338_10017848 3300028800 Bacteria 7628
230 Ga0265338_10024196 3300028800 Bacteria 6213
231 Ga0265338_10248139 3300028800 Bacteria 1315
232 Ga0265760_10082623 3300031090 Bacteria 997
233 Ga0265330_10132270 3300031235 Bacteria 1062
234 Ga0265332_10324326 3300031238 Bacteria 635
235 Ga0265328_10099047 3300031239 Bacteria 1079
236 Ga0265325_10435894 3300031241 Unclassified 572
237 Ga0265340_10382617 3300031247 Viruses 621
238 Ga0265339_10000687 3300031249 Bacteria 26098
239 Ga0265331_10137810 3300031250 Bacteria 1111
240 Ga0265316_10005832 3300031344 Bacteria 11874
241 Ga0265316_10006068 3300031344 Bacteria 11599
242 Ga0307408_100186082 3300031548 Bacteria 1669
243 Ga0265313_10176595 3300031595 Bacteria 899
244 Ga0316579_10140335 3300031691 Bacteria 1165
245 Ga0265314_10312354 3300031711 Bacteria 877
246 Ga0265342_10006636 3300031712 Bacteria 8589
247 Ga0265342_10189658 3300031712 Bacteria 1122
248 Ga0316576_10034516 3300031727 Bacteria 3605
249 Ga0316576_10404515 3300031727 Bacteria 1011
250 Ga0316578_10728232 3300031728 Unclassified 577
251 Ga0307516_10053106 3300031730 Bacteria 3964
252 Ga0307405_10158536 3300031731 Bacteria 1600
253 Ga0307405_10447808 3300031731 Unclassified 1023
254 Ga0316577_10174379 3300031733 Bacteria 1214
255 Ga0307413_11382408 3300031824 Unclassified 619
256 Ga0307406_10503824 3300031901 Bacteria 982
257 Ga0307406_10524753 3300031901 Bacteria 964
258 Ga0307407_10071060 3300031903 Bacteria 2071
259 Ga0307407_11284157 3300031903 Bacteria 574
260 Ga0307412_10231256 3300031911 Unclassified 1424
261 Ga0307412_10295882 3300031911 Bacteria 1277
262 Ga0307412_10679188 3300031911 Bacteria 881
263 Ga0307412_11662562 3300031911 Bacteria 584
264 Ga0307409_100561794 3300031995 Bacteria 1122
265 Ga0307409_102392622 3300031995 Bacteria 557
266 Ga0307409_102469495 3300031995 Bacteria 548
267 Ga0307416_100606929 3300032002 Unclassified 1175
268 Ga0307414_10104491 3300032004 Bacteria 2139
269 Ga0307414_10365980 3300032004 Bacteria 1242
270 Ga0307414_10617061 3300032004 Bacteria 974
271 Ga0307411_10009261 3300032005 Bacteria 5163
272 Ga0307411_10567117 3300032005 Bacteria 971
273 Ga0307415_100850887 3300032126 Bacteria 837
274 Ga0316580_10003837 3300032139 Bacteria 4309
275 Ga0307510_10010763 3300033180 Bacteria 10879
276 Ga0316212_1051398 3300033547 Bacteria 587
277 Ga0373934_0026017 3300035086 Bacteria 2269
278 Ga0373956_0045320 3300035119 Unclassified 1962
279 Ga0373957_0041997 3300035120 Unclassified 1724
280 Ga0373955_0287772 3300035172 Bacteria 989
281 Ga0373961_0000144 3300035241 Bacteria 34810
282 Ga0316574_0087492 3300035398 Bacteria 1984
283 Ga0373924_0018038 3300035410 Bacteria 2716
284 Ga0373935_0011040 3300035692 Bacteria 5427
285 Ga0373935_0069521 3300035692 Bacteria 2268
286 Ga0373927_0373784 3300035695 Bacteria 940
287 Ga0373927_0589543 3300035695 Bacteria 735
288 Ga0373937_0002374 3300036401 Bacteria 15671
289 Ga0316582_0668945 3300036647 Unclassified 714
290 Ga0316584_0133892 3300036712 Bacteria 1851
291 Ga0316584_0459503 3300036712 Bacteria 899
292 Ga0395905_1032376 3300037471 Bacteria 725
293 Ga0395905_1192681 3300037471 Bacteria 665
294 Ga0436360_0809450 3300039438 Bacteria 1088
295 Ga0436360_0822581 3300039438 Bacteria 1241
296 Ga0436362_0544016 3300039453 Bacteria 842
297 Ga0439438_006478 3300041405 Bacteria 4120
298 Ga0439447_023816 3300041407 Bacteria 1591
299 Ga0451807_0089940 3300041486 Bacteria 1582
300 Ga0451835_0461422 3300041492 Bacteria 905
301 Ga0451837_0202422 3300041494 Bacteria 738
302 Ga0451841_0847936 3300041498 Bacteria 618
303 Ga0451847_0762432 3300041503 Bacteria 1390
304 Ga0451851_0935334 3300041507 Bacteria 746
305 Ga0451855_1322555 3300041511 Bacteria 728
306 Ga0451855_1732057 3300041511 Bacteria 503
307 Ga0451853_0449395 3300041512 Bacteria 507
308 Ga0451853_2292328 3300041512 Bacteria 1556
309 Ga0439445_0045000 3300042004 Bacteria 1180
310 Ga0439432_028822 3300042006 Bacteria 1806
311 Ga0439432_040469 3300042006 Bacteria 1478
312 Ga0439452_028068 3300042010 Bacteria 1407
313 Ga0439456_020350 3300042013 Bacteria 1399
314 Ga0439463_058242 3300042016 Bacteria 987
315 Ga0450911_016424 3300042115 Bacteria 977
316 Ga0450900_001423 3300042136 Bacteria 2329
317 Ga0450902_006363 3300042137 Bacteria 1809
318 Ga0450903_007678 3300042138 Bacteria 1770
319 Ga0450905_021159 3300042142 Bacteria 960
320 Ga0450889_017003 3300042144 Bacteria 788
321 Ga0450907_006503 3300042146 Bacteria 1954
322 Ga0450916_019682 3300042530 Bacteria 918
323 Ga0450893_0009319 3300042532 Bacteria 1602
324 Ga0450893_0122840 3300042532 Bacteria 543
325 Ga0453683_0943569 3300044673 Bacteria 571
326 Ga0466965_0054912 3300044683 Bacteria 1981
327 Ga0466966_0011392 3300044684 Bacteria 5897
328 Ga0466966_0116555 3300044684 Bacteria 1644
329 Ga0466961_0075938 3300044693 Bacteria 2129
330 Ga0466964_0010049 3300044706 Bacteria 3565
331 Ga0453684_0023941 3300044712 Bacteria 8954
332 Ga0453684_0179887 3300044712 Bacteria 2483
333 Ga0466971_0216582 3300044719 Bacteria 906
334 Ga0466968_0023356 3300044735 Bacteria 2518
335 Ga0466970_0515347 3300044765 Bacteria 689
336 Ga0466957_0106104 3300044842 Bacteria 1776
337 Ga0466957_0176931 3300044842 Bacteria 1392
338 Ga0466960_0339170 3300044901 Bacteria 855
339 Ga0466959_0039972 3300045049 Bacteria 3466
340 Ga0466959_0769367 3300045049 Bacteria 644
341 Ga0451576_0213695 3300045051 Bacteria 2014
342 Ga0451576_1215356 3300045051 Bacteria 787
343 Ga0451576_1870407 3300045051 Bacteria 620
344 Ga0451576_2314195 3300045051 Unclassified 550
345 Ga0451576_2321386 3300045051 Unclassified 550
346 Ga0466958_0890514 3300045836 Bacteria 580
347 Ga0466967_0009535 3300045976 Bacteria 7210
348 Ga0466967_1607267 3300045976 Unclassified 647
349 Ga0466967_2151676 3300045976 Bacteria 554
350 Ga0495617_000484 3300046452 Bacteria 21177
351 Ga0495617_061067 3300046452 Bacteria 1246
352 Ga0495617_086658 3300046452 Bacteria 1024
353 Ga0495617_097426 3300046452 Bacteria 957
354 Ga0495627_000101 3300046453 Bacteria 105414
355 Ga0495627_000256 3300046453 Bacteria 54510
356 Ga0495627_005742 3300046453 Bacteria 4953
357 Ga0495627_010736 3300046453 Bacteria 3315
358 Ga0495592_0063081 3300046454 Bacteria 2718
359 Ga0495603_0068327 3300046455 Unclassified 2091
360 Ga0495603_0561847 3300046455 Bacteria 653
361 Ga0495590_0005196 3300046457 Bacteria 5173
362 Ga0495590_0044692 3300046457 Bacteria 1544
363 Ga0495590_0195284 3300046457 Bacteria 742
364 Ga0495591_000032 3300046458 Bacteria 176337
365 Ga0495591_000082 3300046458 Bacteria 107579
366 Ga0495591_000120 3300046458 Bacteria 86214
367 Ga0495591_017809 3300046458 Bacteria 2427
368 Ga0495591_037727 3300046458 Bacteria 1396
369 Ga0495591_147101 3300046458 Bacteria 566
370 Ga0495591_163458 3300046458 Bacteria 532
371 Ga0495638_0000387 3300046460 Bacteria 54475
372 Ga0495638_0000449 3300046460 Bacteria 49303
373 Ga0495638_0005523 3300046460 Bacteria 9389
374 Ga0495638_0035510 3300046460 Bacteria 3177
375 Ga0495638_0043562 3300046460 Bacteria 2830
376 Ga0495638_0167622 3300046460 Bacteria 1262
377 Ga0495638_0604717 3300046460 Bacteria 538
378 Ga0495653_0035570 3300046463 Bacteria 3928
379 Ga0495653_0109156 3300046463 Bacteria 1991
380 Ga0495650_0000940 3300046471 Bacteria 33781
381 Ga0495650_0009217 3300046471 Bacteria 5645
382 Ga0495650_0022904 3300046471 Bacteria 2985
383 Ga0495650_0025311 3300046471 Bacteria 2785
384 Ga0495650_0043435 3300046471 Bacteria 1907
385 Ga0495650_0135911 3300046471 Bacteria 893
386 Ga0495580_0437056 3300046472 Bacteria 879
387 Ga0495582_0096427 3300046473 Unclassified 1653
388 Ga0495605_0000147 3300046474 Bacteria 90988
389 Ga0495605_0034354 3300046474 Bacteria 2567
390 Ga0495605_0418719 3300046474 Bacteria 555
391 Ga0495639_0403076 3300046475 Bacteria 691
392 Ga0495662_0679486 3300046476 Bacteria 502
393 Ga0495584_0014100 3300046491 Bacteria 4072
394 Ga0495585_0000234 3300046492 Bacteria 57324
395 Ga0495585_0003811 3300046492 Bacteria 10041
396 Ga0495585_0020869 3300046492 Bacteria 3764
397 Ga0495585_0369397 3300046492 Bacteria 694
398 Ga0495585_0464591 3300046492 Bacteria 604
399 Ga0495594_0065163 3300046499 Unclassified 2021
400 Ga0495596_0051284 3300046500 Bacteria 1616
401 Ga0495596_0250547 3300046500 Bacteria 687
402 Ga0495607_0000603 3300046501 Bacteria 35007
403 Ga0495607_0053808 3300046501 Bacteria 2323
404 Ga0495607_0123450 3300046501 Bacteria 1356
405 Ga0495583_0000018 3300046506 Bacteria 306541
406 Ga0495583_0014877 3300046506 Bacteria 4260
407 Ga0495583_0198120 3300046506 Bacteria 817
408 Ga0495606_0003207 3300046507 Bacteria 17626
409 Ga0495606_0006281 3300046507 Bacteria 11021
410 Ga0495606_0007373 3300046507 Bacteria 9870
411 Ga0495606_0164399 3300046507 Bacteria 1292
412 Ga0495606_0183965 3300046507 Bacteria 1202
413 Ga0495606_0261848 3300046507 Bacteria 954
414 Ga0495606_0314617 3300046507 Bacteria 843
415 Ga0495608_0199814 3300046511 Bacteria 1260
416 Ga0495610_0000056 3300046512 Bacteria 138703
417 Ga0495610_0000133 3300046512 Bacteria 82356
418 Ga0495610_0000173 3300046512 Bacteria 72402
419 Ga0495610_0000220 3300046512 Bacteria 61190
420 Ga0495610_0002390 3300046512 Bacteria 15805
421 Ga0495610_0003946 3300046512 Bacteria 11235
422 Ga0495610_0115398 3300046512 Bacteria 1184
423 Ga0495616_0001757 3300046513 Bacteria 14739
424 Ga0495616_0009481 3300046513 Bacteria 5686
425 Ga0495616_0126042 3300046513 Bacteria 1177
426 Ga0495616_0272256 3300046513 Bacteria 721
427 Ga0495620_0011877 3300046515 Bacteria 4526
428 Ga0495620_0020652 3300046515 Bacteria 3214
429 Ga0495620_0026416 3300046515 Bacteria 2731
430 Ga0495620_0121396 3300046515 Bacteria 1029
431 Ga0495620_0351896 3300046515 Bacteria 558
432 Ga0495620_0389876 3300046515 Bacteria 527
433 Ga0495630_0847632 3300046517 Bacteria 697
434 Ga0495631_0000013 3300046518 Bacteria 109794
435 Ga0495631_0005679 3300046518 Bacteria 6509
436 Ga0495631_0020958 3300046518 Bacteria 3047
437 Ga0495632_0002535 3300046519 Bacteria 13843
438 Ga0495632_0023186 3300046519 Bacteria 3317
439 Ga0495632_0045071 3300046519 Bacteria 2198
440 Ga0495632_0073255 3300046519 Bacteria 1642
441 Ga0495632_0232721 3300046519 Bacteria 830
442 Ga0495637_0000855 3300046520 Bacteria 19898
443 Ga0495637_0004752 3300046520 Bacteria 7005
444 Ga0495637_0026055 3300046520 Bacteria 2630
445 Ga0495643_0000396 3300046522 Bacteria 57359
446 Ga0495643_0042273 3300046522 Bacteria 2483
447 Ga0495643_0062766 3300046522 Bacteria 1966
448 Ga0495644_0005850 3300046523 Bacteria 4804
449 Ga0495648_0000259 3300046524 Bacteria 59999
450 Ga0495648_0006035 3300046524 Bacteria 9942
451 Ga0495648_0127771 3300046524 Bacteria 1355
452 Ga0495648_0210936 3300046524 Bacteria 965
453 Ga0495666_0022607 3300046526 Bacteria 3114
454 Ga0495652_0319289 3300046529 Bacteria 1123
455 Ga0495654_0000104 3300046530 Bacteria 95266
456 Ga0495654_0009881 3300046530 Bacteria 5214
457 Ga0495654_0105705 3300046530 Bacteria 1290
458 Ga0495654_0106165 3300046530 Bacteria 1286
459 Ga0495654_0106167 3300046530 Bacteria 1286
460 Ga0495586_0518481 3300046535 Bacteria 688
461 Ga0495587_0202399 3300046536 Bacteria 1123
462 Ga0495609_0000879 3300046538 Bacteria 21988
463 Ga0495609_0007370 3300046538 Bacteria 5500
464 Ga0495609_0007402 3300046538 Bacteria 5485
465 Ga0495609_0019094 3300046538 Bacteria 3173
466 Ga0495609_0428857 3300046538 Bacteria 527
467 Ga0495597_0000965 3300046542 Bacteria 22210
468 Ga0495597_0080344 3300046542 Bacteria 1395
469 Ga0495622_0000047 3300046557 Bacteria 109638
470 Ga0495633_0000304 3300046558 Bacteria 55996
471 Ga0495668_0002358 3300046616 Bacteria 15711
472 Ga0495668_0004517 3300046616 Bacteria 9846
473 Ga0495668_0019393 3300046616 Bacteria 3921
474 Ga0495668_0037958 3300046616 Bacteria 2693
475 Ga0495668_0464086 3300046616 Bacteria 697
476 Ga0495634_0043669 3300046642 Bacteria 3037
477 Ga0495634_0653411 3300046642 Bacteria 607
478 Ga0495611_0000024 3300046648 Bacteria 118898
479 Ga0495611_0064734 3300046648 Bacteria 1665
480 Ga0495611_0085640 3300046648 Bacteria 1453
481 Ga0495625_0000103 3300046660 Bacteria 136109
482 Ga0495625_0002403 3300046660 Bacteria 20297
483 Ga0495625_0012052 3300046660 Bacteria 7015
484 Ga0495625_0026327 3300046660 Bacteria 4396
485 Ga0495625_0028552 3300046660 Bacteria 4183
486 Ga0495625_0175376 3300046660 Bacteria 1429
487 Ga0495625_0250952 3300046660 Bacteria 1148
488 Ga0495625_0407322 3300046660 Bacteria 848
489 Ga0495635_0798414 3300046663 Bacteria 608
490 Ga0495661_0059049 3300046665 Bacteria 2284
491 Ga0495661_0099410 3300046665 Bacteria 1640
492 Ga0495588_0009849 3300046674 Bacteria 4431
493 Ga0495647_0012185 3300046681 Unclassified 2958
494 Ga0495669_0009409 3300046684 Bacteria 4119
495 Ga0495613_0001739 3300046689 Bacteria 16574
496 Ga0495624_0097110 3300046690 Bacteria 1815
497 Ga0495671_0000541 3300046692 Bacteria 28528
498 Ga0495671_0000799 3300046692 Bacteria 22506
499 Ga0495671_0008285 3300046692 Bacteria 5853
500 Ga0495671_0082623 3300046692 Bacteria 1574
501 Ga0495671_0139594 3300046692 Bacteria 1181
502 Ga0495649_0001823 3300046694 Bacteria 15652
503 Ga0495649_0002309 3300046694 Bacteria 13533
504 Ga0495649_0005390 3300046694 Bacteria 8143
505 Ga0495649_0007150 3300046694 Bacteria 6854
506 Ga0495649_0096780 3300046694 Bacteria 1570
507 Ga0495589_0016461 3300046794 Bacteria 3801
508 Ga0495589_0161687 3300046794 Bacteria 1066
509 Ga0495589_0589663 3300046794 Bacteria 506
510 Ga0495600_0017941 3300046809 Bacteria 4505
511 Ga0495660_0000785 3300046810 Bacteria 23782
512 Ga0495660_0002576 3300046810 Bacteria 11514
513 Ga0495660_0012681 3300046810 Bacteria 4891
514 Ga0495660_0108915 3300046810 Bacteria 1415
515 Ga0495660_0200672 3300046810 Bacteria 952
516 Ga0495660_0369883 3300046810 Bacteria 634
517 Ga0495581_0053318 3300047315 Unclassified 2336
518 Ga0495604_0026516 3300047317 Bacteria 4612
519 Ga0495672_0003554 3300047320 Bacteria 13271
520 Ga0495672_0003653 3300047320 Bacteria 13028
521 Ga0495672_0015739 3300047320 Bacteria 5124
522 Ga0495672_0034996 3300047320 Bacteria 3096
523 Ga0495676_0002653 3300047321 Bacteria 16007
524 Ga0495676_0024971 3300047321 Bacteria 5164
525 Ga0495680_0005627 3300047322 Bacteria 11740
526 Ga0495683_0011172 3300047323 Bacteria 4732
527 Ga0495683_0097371 3300047323 Bacteria 1418
528 Ga0495683_0410447 3300047323 Bacteria 561
529 Ga0495679_000612 3300047446 Bacteria 24130
530 Ga0495679_004870 3300047446 Bacteria 6061
531 Ga0495679_007852 3300047446 Bacteria 4398
532 Ga0495679_165567 3300047446 Bacteria 589
533 Ga0495673_0002039 3300047469 Bacteria 14802
534 Ga0495673_0007069 3300047469 Bacteria 6510
535 Ga0495673_0008887 3300047469 Bacteria 5601
536 Ga0495673_0010193 3300047469 Bacteria 5132
537 Ga0495673_0036415 3300047469 Bacteria 2258
538 Ga0495673_0045651 3300047469 Bacteria 1946
539 Ga0495681_0000065 3300047470 Bacteria 97979
540 Ga0495681_0000231 3300047470 Bacteria 46423
541 Ga0495684_0010927 3300047471 Bacteria 7018
542 Ga0495686_0002204 3300047472 Bacteria 18924
543 Ga0495686_0014125 3300047472 Bacteria 5507
544 Ga0495686_0014265 3300047472 Bacteria 5474
545 Ga0495686_0325028 3300047472 Bacteria 842
546 Ga0495686_0465101 3300047472 Bacteria 670
547 Ga0495593_0514495 3300047673 Bacteria 600
548 Ga0495602_0121621 3300048088 Bacteria 2099
549 Ga0495626_0000074 3300048091 Bacteria 132552
550 Ga0495626_0007211 3300048091 Bacteria 6212
551 Ga0495626_0010037 3300048091 Bacteria 5079
552 Ga0495626_0076279 3300048091 Bacteria 1496
553 Ga0495626_0096151 3300048091 Bacteria 1296
554 Ga0496105_1402681 3300048908 Bacteria 506
555 Ga0496106_0145361 3300048909 Bacteria 1867
556 Ga0496106_0193863 3300048909 Bacteria 1616
557 Ga0496107_0000073 3300048910 Bacteria 48489
558 Ga0496110_0208449 3300048913 Bacteria 1776
559 Ga0496115_0340473 3300048918 Bacteria 1224
560 Ga0496115_0484381 3300048918 Bacteria 996
561 Ga0496116_0001015 3300048919 Bacteria 34238
562 Ga0496117_0000475 3300048920 Bacteria 66690
563 Ga0496117_0067429 3300048920 Bacteria 2421
564 Ga0496118_0000482 3300048921 Bacteria 66218
565 Ga0496118_0074693 3300048921 Bacteria 2421
566 Ga0496118_0325142 3300048921 Bacteria 832
567 Ga0496119_0072833 3300048922 Bacteria 2005
568 Ga0496120_0247487 3300048923 Bacteria 838
569 Ga0496121_0002640 3300048924 Bacteria 26981
570 Ga0496121_0062032 3300048924 Bacteria 3064
571 Ga0496122_0009192 3300048925 Bacteria 10466
572 Ga0496122_0130664 3300048925 Bacteria 1596
573 Ga0496123_0003395 3300048926 Bacteria 17945
574 Ga0496123_0197762 3300048926 Bacteria 1033
575 Ga0496123_0509238 3300048926 Bacteria 524
576 Ga0496124_0039692 3300048927 Bacteria 4077
577 Ga0496124_0122912 3300048927 Bacteria 2071
578 Ga0496124_0280677 3300048927 Bacteria 1214
579 Ga0496125_0094137 3300048928 Bacteria 2233
580 Ga0496125_0179600 3300048928 Bacteria 1412
581 Ga0496125_0204869 3300048928 Bacteria 1287
582 Ga0496126_0132330 3300048929 Bacteria 2154
583 Ga0496126_0249014 3300048929 Bacteria 1481
584 Ga0496126_0575706 3300048929 Bacteria 890
585 Ga0495678_001994 3300049459 Bacteria 14674
586 Ga0495678_008180 3300049459 Bacteria 5312
587 Ga0495678_008789 3300049459 Bacteria 5059
588 Ga0495678_048215 3300049459 Bacteria 1662
589 Ga0495678_102005 3300049459 Bacteria 992
590 Ga0495678_163879 3300049459 Bacteria 708
591 Ga0501033_0433387 3300049570 Bacteria 914
592 Ga0501037_0069254 3300049573 Bacteria 2569
593 Ga0501043_0001012 3300049579 Bacteria 24676
594 Ga0501046_0000044 3300049580 Bacteria 151271
595 Ga0501047_0007075 3300049581 Bacteria 10537
596 Ga0501047_0044992 3300049581 Bacteria 4267
597 Ga0501048_0000140 3300049582 Bacteria 43760
598 Ga0501048_0408432 3300049582 Bacteria 971
599 Ga0501048_0459442 3300049582 Bacteria 912
600 Ga0501068_0083794 3300049584 Bacteria 1960
601 Ga0501068_0330768 3300049584 Bacteria 977
602 Ga0501070_0982390 3300049586 Bacteria 655
603 Ga0501070_1162509 3300049586 Bacteria 593
604 Ga0501072_0181537 3300049588 Bacteria 1679
605 Ga0501072_0468805 3300049588 Unclassified 997
606 Ga0501074_0792939 3300049590 Bacteria 668
607 Ga0501075_0000725 3300049591 Bacteria 20461
608 Ga0501077_0000732 3300049593 Bacteria 19858
609 Ga0501216_045412 3300049660 Bacteria 851
610 Ga0501238_000525 3300049671 Bacteria 4387
611 Ga0501080_0050404 3300049742 Bacteria 3875
612 Ga0501083_0000008 3300049744 Bacteria 197749
613 Ga0501241_039531 3300049758 Bacteria 911
614 Ga0501263_055779 3300049760 Unclassified 610
615 Ga0501035_0016147 3300049822 Bacteria 6890
616 Ga0501035_0110431 3300049822 Bacteria 2410
617 Ga0501044_0014847 3300049823 Bacteria 8394
618 Ga0501044_0019695 3300049823 Bacteria 7211
619 nmdc:mga00v17_153926_c1 3300050491 Bacteria 1478
620 nmdc:mga00v17_256829_c1 3300050491 Bacteria 1133
621 nmdc:mga0k408_170596_c1 3300050493 Bacteria 1297
622 nmdc:mga07m45_741247_c1 3300050496 Bacteria 564
623 nmdc:mga0qj67_313144_c1 3300050509 Bacteria 1271
624 nmdc:mga06r32_1778442_c1 3300050510 Bacteria 552
625 nmdc:mga06r32_911818_c1 3300050510 Bacteria 835
626 nmdc:mga08y16_4529_c1 3300050511 Bacteria 14495
627 nmdc:mga08y16_705768_c1 3300050511 Bacteria 1008
628 nmdc:mga0n895_816555_c1 3300050512 Unclassified 922
629 Ga0500635_0000112 3300053080 Bacteria 49317
630 Ga0500578_0000387 3300053086 Bacteria 54007
631 Ga0500578_0020307 3300053086 Bacteria 4270
632 Ga0500578_0301982 3300053086 Bacteria 949
633 Ga0500643_135352 3300053087 Bacteria 662
634 Ga0500644_0245385 3300053088 Bacteria 753
635 Ga0500556_0002634 3300053104 Bacteria 5610
636 Ga0500556_0005331 3300053104 Bacteria 3635
637 Ga0500562_000388 3300053108 Bacteria 10696
638 Ga0500562_121127 3300053108 Bacteria 713
639 Ga0500572_002475 3300053111 Bacteria 4427
640 Ga0500572_107052 3300053111 Bacteria 897
641 Ga0500594_0000328 3300053118 Bacteria 10626
642 Ga0500608_000367 3300053122 Bacteria 17481
643 Ga0500652_284064 3300053131 Bacteria 645
644 Ga0500658_0006135 3300053134 Bacteria 4474
645 Ga0500658_0086297 3300053134 Bacteria 1350
646 Ga0500559_0022150 3300053136 Bacteria 2695
647 Ga0500559_0025012 3300053136 Bacteria 2541
648 Ga0500568_0121341 3300053139 Bacteria 974
649 Ga0500586_280837 3300053145 Bacteria 508
650 Ga0500622_0000389 3300053156 Bacteria 42477
651 Ga0500622_0006923 3300053156 Bacteria 6497
652 Ga0500645_000888 3300053730 Bacteria 17345
653 Ga0500645_004039 3300053730 Bacteria 5758
654 Ga0500645_051558 3300053730 Bacteria 1200
655 Ga0501084_1330215 3300054114 Bacteria 602
656 Ga0590075_014819 3300059424 Bacteria 1908
657 Ga0501082_0002246 3300060353 Bacteria 16907
658 Ga0501082_0100222 3300060353 Bacteria 2505
659 Ga0466962_0084888 3300061719 Bacteria 1515
660 Ga0530510_0118204 3300061734 Bacteria 1945

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10266574 Ga0157370_102665742 58
2 3300035241 Ga0373961_0000144 Ga0373961_0000144_11119_11316 58
3 3300005327 Ga0070658_10527030 Ga0070658_105270302 59
4 3300005328 Ga0070676_10840813 Ga0070676_108408132 59
5 3300005329 Ga0070683_101834240 Ga0070683_1018342402 59
6 3300005333 Ga0070677_10421556 Ga0070677_104215562 59
7 3300005339 Ga0070660_100000511 Ga0070660_1000005116 59
8 3300005339 Ga0070660_100184949 Ga0070660_1001849491 59
9 3300005347 Ga0070668_101529167 Ga0070668_1015291672 59
10 3300005366 Ga0070659_100000005 Ga0070659_100000005141 59
11 3300005440 Ga0070705_101322456 Ga0070705_1013224561 59
12 3300005445 Ga0070708_100230586 Ga0070708_1002305862 59
13 3300005456 Ga0070678_100690117 Ga0070678_1006901172 59
14 3300005468 Ga0070707_102229810 Ga0070707_1022298101 59
15 3300005471 Ga0070698_100071714 Ga0070698_1000717143 59
16 3300005543 Ga0070672_100414128 Ga0070672_1004141282 59
17 3300005543 Ga0070672_100620664 Ga0070672_1006206643 59
18 3300005546 Ga0070696_101297291 Ga0070696_1012972911 59
19 3300005549 Ga0070704_100030777 Ga0070704_1000307773 59
20 3300005563 Ga0068855_100196722 Ga0068855_1001967222 59
21 3300005719 Ga0068861_102402597 Ga0068861_1024025972 59
22 3300005841 Ga0068863_100044677 Ga0068863_1000446773 59
23 3300005841 Ga0068863_102038495 Ga0068863_1020384952 59
24 3300005843 Ga0068860_100023746 Ga0068860_1000237463 59
25 3300005843 Ga0068860_100125586 Ga0068860_1001255862 59
26 3300006195 Ga0075366_10561221 Ga0075366_105612211 59
27 3300006353 Ga0075370_10917614 Ga0075370_109176142 59
28 3300007076 Ga0075435_101381635 Ga0075435_1013816352 59
29 3300007265 Ga0099794_10451681 Ga0099794_104516812 59
30 3300009093 Ga0105240_10195742 Ga0105240_101957422 59
31 3300009094 Ga0111539_12686020 Ga0111539_126860202 59
32 3300009098 Ga0105245_10063800 Ga0105245_100638005 59
33 3300009176 Ga0105242_11406385 Ga0105242_114063852 59
34 3300009551 Ga0105238_11915520 Ga0105238_119155201 59
35 3300009551 Ga0105238_12278678 Ga0105238_122786782 59
36 3300009553 Ga0105249_12612958 Ga0105249_126129582 59
37 3300010375 Ga0105239_11900377 Ga0105239_119003771 59
38 3300013105 Ga0157369_10045234 Ga0157369_100452343 59
39 3300013306 Ga0163162_10472910 Ga0163162_104729102 59
40 3300014326 Ga0157380_11316911 Ga0157380_113169112 59
41 3300014745 Ga0157377_11467735 Ga0157377_114677352 59
42 3300014969 Ga0157376_11378395 Ga0157376_113783951 59
43 3300028381 Ga0268264_10027029 Ga0268264_100270292 59
44 3300041486 Ga0451807_0089940 Ga0451807_0089940_324_524 59
45 3300041507 Ga0451851_0935334 Ga0451851_0935334_471_671 59
46 3300041512 Ga0451853_0449395 Ga0451853_0449395_88_288 59
47 3300003759 Ga0055525_1000070 Ga0055525_1000070135 60
48 3300003781 Ga0055536_1001560 Ga0055536_10015605 60
49 3300003781 Ga0055536_1005420 Ga0055536_10054207 60
50 3300003791 Ga0055530_10002634 Ga0055530_100026345 60
51 3300003792 Ga0055540_1014480 Ga0055540_10144804 60
52 3300005327 Ga0070658_10041757 Ga0070658_100417576 60
53 3300005327 Ga0070658_10144065 Ga0070658_101440654 60
54 3300005328 Ga0070676_10713696 Ga0070676_107136961 60
55 3300005330 Ga0070690_100047811 Ga0070690_1000478113 60
56 3300005331 Ga0070670_100077601 Ga0070670_1000776013 60
57 3300005334 Ga0068869_100018317 Ga0068869_1000183175 60
58 3300005338 Ga0068868_100372121 Ga0068868_1003721213 60
59 3300005339 Ga0070660_101797456 Ga0070660_1017974562 60
60 3300005340 Ga0070689_100646074 Ga0070689_1006460742 60
61 3300005353 Ga0070669_102020223 Ga0070669_1020202232 60
62 3300005354 Ga0070675_100174762 Ga0070675_1001747624 60
63 3300005354 Ga0070675_100908625 Ga0070675_1009086251 60
64 3300005366 Ga0070659_101594428 Ga0070659_1015944282 60
65 3300005434 Ga0070709_10555675 Ga0070709_105556752 60
66 3300005436 Ga0070713_100356448 Ga0070713_1003564482 60
67 3300005457 Ga0070662_100594710 Ga0070662_1005947103 60
68 3300005459 Ga0068867_100083134 Ga0068867_1000831343 60
69 3300005459 Ga0068867_100282315 Ga0068867_1002823152 60
70 3300005535 Ga0070684_100373980 Ga0070684_1003739802 60
71 3300005539 Ga0068853_101264286 Ga0068853_1012642862 60
72 3300005563 Ga0068855_100013193 Ga0068855_1000131937 60
73 3300005563 Ga0068855_100546955 Ga0068855_1005469552 60
74 3300005564 Ga0070664_100662898 Ga0070664_1006628982 60
75 3300005577 Ga0068857_100212663 Ga0068857_1002126632 60
76 3300005577 Ga0068857_101104445 Ga0068857_1011044452 60
77 3300005614 Ga0068856_100829647 Ga0068856_1008296472 60
78 3300005616 Ga0068852_101788746 Ga0068852_1017887462 60
79 3300005719 Ga0068861_102246409 Ga0068861_1022464092 60
80 3300005844 Ga0068862_101036340 Ga0068862_1010363402 60
81 3300006173 Ga0070716_101170974 Ga0070716_1011709742 60
82 3300006195 Ga0075366_10185123 Ga0075366_101851231 60
83 3300006844 Ga0075428_101036436 Ga0075428_1010364363 60
84 3300006847 Ga0075431_101113139 Ga0075431_1011131392 60
85 3300006880 Ga0075429_100291085 Ga0075429_1002910852 60
86 3300006881 Ga0068865_100189477 Ga0068865_1001894774 60
87 3300009093 Ga0105240_12414585 Ga0105240_124145852 60
88 3300009098 Ga0105245_10355848 Ga0105245_103558483 60
89 3300009098 Ga0105245_11201528 Ga0105245_112015281 60
90 3300009147 Ga0114129_10033069 Ga0114129_100330696 60
91 3300009148 Ga0105243_11092557 Ga0105243_110925572 60
92 3300009176 Ga0105242_10167926 Ga0105242_101679263 60
93 3300009176 Ga0105242_12716843 Ga0105242_127168432 60
94 3300009545 Ga0105237_10997139 Ga0105237_109971392 60
95 3300009551 Ga0105238_11190577 Ga0105238_111905772 60
96 3300009551 Ga0105238_11905137 Ga0105238_119051372 60
97 3300009553 Ga0105249_10906080 Ga0105249_109060802 60
98 3300010375 Ga0105239_10638183 Ga0105239_106381832 60
99 3300011119 Ga0105246_10047321 Ga0105246_100473212 60
100 3300011119 Ga0105246_11782373 Ga0105246_117823732 60
101 3300013296 Ga0157374_11733915 Ga0157374_117339152 60
102 3300013297 Ga0157378_10094847 Ga0157378_100948472 60
103 3300013308 Ga0157375_10824280 Ga0157375_108242803 60
104 3300014325 Ga0163163_10051008 Ga0163163_100510084 60
105 3300014745 Ga0157377_10323589 Ga0157377_103235892 60
106 3300025230 Ga0209563_100053 Ga0209563_10005361 60
107 3300025253 Ga0209677_101505 Ga0209677_1015053 60
108 3300025292 Ga0209676_1000138 Ga0209676_100013896 60
109 3300025292 Ga0209676_1000832 Ga0209676_10008329 60
110 3300025295 Ga0209564_1018162 Ga0209564_10181623 60
111 3300025298 Ga0209050_1001184 Ga0209050_100118426 60
112 3300025298 Ga0209050_1089822 Ga0209050_10898222 60
113 3300025303 Ga0209051_1003081 Ga0209051_10030814 60
114 3300025304 Ga0209257_1004893 Ga0209257_10048936 60
115 3300025901 Ga0207688_10093713 Ga0207688_100937132 60
116 3300025907 Ga0207645_10598417 Ga0207645_105984172 60
117 3300025909 Ga0207705_10131851 Ga0207705_101318513 60
118 3300025909 Ga0207705_10666327 Ga0207705_106663272 60
119 3300025926 Ga0207659_10806204 Ga0207659_108062042 60
120 3300025927 Ga0207687_10168964 Ga0207687_101689643 60
121 3300025927 Ga0207687_11890201 Ga0207687_118902011 60
122 3300025928 Ga0207700_11411762 Ga0207700_114117622 60
123 3300025932 Ga0207690_10542574 Ga0207690_105425743 60
124 3300025932 Ga0207690_10775006 Ga0207690_107750062 60
125 3300025932 Ga0207690_11402617 Ga0207690_114026172 60
126 3300025933 Ga0207706_10509011 Ga0207706_105090112 60
127 3300025934 Ga0207686_10014800 Ga0207686_100148006 60
128 3300025935 Ga0207709_10855210 Ga0207709_108552102 60
129 3300025936 Ga0207670_10035207 Ga0207670_100352074 60
130 3300025940 Ga0207691_10347548 Ga0207691_103475482 60
131 3300025942 Ga0207689_10014590 Ga0207689_100145907 60
132 3300025945 Ga0207679_10487440 Ga0207679_104874402 60
133 3300025949 Ga0207667_10027912 Ga0207667_100279127 60
134 3300025981 Ga0207640_10760949 Ga0207640_107609492 60
135 3300026041 Ga0207639_11665174 Ga0207639_116651742 60
136 3300026067 Ga0207678_11042401 Ga0207678_110424011 60
137 3300026089 Ga0207648_10145160 Ga0207648_101451603 60
138 3300026089 Ga0207648_10306461 Ga0207648_103064613 60
139 3300026116 Ga0207674_10112152 Ga0207674_101121523 60
140 3300026116 Ga0207674_10160449 Ga0207674_101604493 60
141 3300026116 Ga0207674_12126336 Ga0207674_121263361 60
142 3300026118 Ga0207675_102093909 Ga0207675_1020939091 60
143 3300028380 Ga0268265_10456238 Ga0268265_104562382 60
144 3300028381 Ga0268264_10961468 Ga0268264_109614683 60
145 3300028573 Ga0265334_10120105 Ga0265334_101201052 60
146 3300028794 Ga0307515_10143053 Ga0307515_101430532 60
147 3300028794 Ga0307515_10725384 Ga0307515_107253841 60
148 3300028800 Ga0265338_10024196 Ga0265338_100241962 60
149 3300028800 Ga0265338_10248139 Ga0265338_102481395 60
150 3300031235 Ga0265330_10132270 Ga0265330_101322702 60
151 3300031238 Ga0265332_10324326 Ga0265332_103243262 60
152 3300031239 Ga0265328_10099047 Ga0265328_100990472 60
153 3300031247 Ga0265340_10382617 Ga0265340_103826172 60
154 3300031249 Ga0265339_10000687 Ga0265339_1000068712 60
155 3300031250 Ga0265331_10137810 Ga0265331_101378102 60
156 3300031344 Ga0265316_10005832 Ga0265316_100058325 60
157 3300031344 Ga0265316_10006068 Ga0265316_1000606811 60
158 3300031711 Ga0265314_10312354 Ga0265314_103123543 60
159 3300031712 Ga0265342_10006636 Ga0265342_100066363 60
160 3300031712 Ga0265342_10189658 Ga0265342_101896582 60
161 3300031727 Ga0316576_10034516 Ga0316576_100345162 60
162 3300031730 Ga0307516_10053106 Ga0307516_100531064 60
163 3300031824 Ga0307413_11382408 Ga0307413_113824081 60
164 3300031901 Ga0307406_10524753 Ga0307406_105247532 60
165 3300031911 Ga0307412_10231256 Ga0307412_102312562 60
166 3300031995 Ga0307409_100561794 Ga0307409_1005617943 60
167 3300032126 Ga0307415_100850887 Ga0307415_1008508871 60
168 3300033547 Ga0316212_1051398 Ga0316212_10513982 60
169 3300035086 Ga0373934_0026017 Ga0373934_0026017_1718_1912 60
170 3300035398 Ga0316574_0087492 Ga0316574_0087492_467_661 60
171 3300036712 Ga0316584_0133892 Ga0316584_0133892_637_831 60
172 3300037471 Ga0395905_1192681 Ga0395905_1192681_452_646 60
173 3300041498 Ga0451841_0847936 Ga0451841_0847936_390_584 60
174 3300041511 Ga0451855_1732057 Ga0451855_1732057_97_291 60
175 3300042530 Ga0450916_019682 Ga0450916_019682_671_865 60
176 3300044683 Ga0466965_0054912 Ga0466965_0054912_239_433 60
177 3300044684 Ga0466966_0011392 Ga0466966_0011392_4270_4464 60
178 3300044693 Ga0466961_0075938 Ga0466961_0075938_1115_1309 60
179 3300044706 Ga0466964_0010049 Ga0466964_0010049_2084_2278 60
180 3300044719 Ga0466971_0216582 Ga0466971_0216582_392_586 60
181 3300044735 Ga0466968_0023356 Ga0466968_0023356_169_363 60
182 3300044765 Ga0466970_0515347 Ga0466970_0515347_47_241 60
183 3300044842 Ga0466957_0106104 Ga0466957_0106104_1296_1490 60
184 3300044842 Ga0466957_0176931 Ga0466957_0176931_599_793 60
185 3300044901 Ga0466960_0339170 Ga0466960_0339170_353_547 60
186 3300045049 Ga0466959_0039972 Ga0466959_0039972_1696_1890 60
187 3300045051 Ga0451576_1215356 Ga0451576_1215356_454_657 60
188 3300045836 Ga0466958_0890514 Ga0466958_0890514_248_442 60
189 3300045976 Ga0466967_0009535 Ga0466967_0009535_5414_5608 60
190 3300045976 Ga0466967_1607267 Ga0466967_1607267_318_512 60
191 3300046453 Ga0495627_000256 Ga0495627_000256_35527_35721 60
192 3300046457 Ga0495590_0005196 Ga0495590_0005196_3794_3988 60
193 3300046460 Ga0495638_0000387 Ga0495638_0000387_25972_26166 60
194 3300046460 Ga0495638_0005523 Ga0495638_0005523_3387_3581 60
195 3300046460 Ga0495638_0035510 Ga0495638_0035510_1452_1646 60
196 3300046471 Ga0495650_0000940 Ga0495650_0000940_14415_14609 60
197 3300046471 Ga0495650_0025311 Ga0495650_0025311_1096_1290 60
198 3300046471 Ga0495650_0135911 Ga0495650_0135911_350_544 60
199 3300046475 Ga0495639_0403076 Ga0495639_0403076_251_445 60
200 3300046476 Ga0495662_0679486 Ga0495662_0679486_271_465 60
201 3300046492 Ga0495585_0464591 Ga0495585_0464591_179_373 60
202 3300046506 Ga0495583_0000018 Ga0495583_0000018_53843_54037 60
203 3300046506 Ga0495583_0198120 Ga0495583_0198120_382_576 60
204 3300046507 Ga0495606_0003207 Ga0495606_0003207_3569_3763 60
205 3300046507 Ga0495606_0006281 Ga0495606_0006281_7208_7402 60
206 3300046511 Ga0495608_0199814 Ga0495608_0199814_88_282 60
207 3300046512 Ga0495610_0000056 Ga0495610_0000056_59339_59533 60
208 3300046512 Ga0495610_0000220 Ga0495610_0000220_37140_37334 60
209 3300046512 Ga0495610_0002390 Ga0495610_0002390_1305_1499 60
210 3300046515 Ga0495620_0121396 Ga0495620_0121396_157_351 60
211 3300046517 Ga0495630_0847632 Ga0495630_0847632_444_638 60
212 3300046518 Ga0495631_0005679 Ga0495631_0005679_3591_3785 60
213 3300046520 Ga0495637_0026055 Ga0495637_0026055_442_636 60
214 3300046522 Ga0495643_0062766 Ga0495643_0062766_1411_1605 60
215 3300046524 Ga0495648_0210936 Ga0495648_0210936_216_410 60
216 3300046529 Ga0495652_0319289 Ga0495652_0319289_629_823 60
217 3300046530 Ga0495654_0105705 Ga0495654_0105705_271_465 60
218 3300046542 Ga0495597_0080344 Ga0495597_0080344_448_642 60
219 3300046616 Ga0495668_0004517 Ga0495668_0004517_5038_5232 60
220 3300046616 Ga0495668_0037958 Ga0495668_0037958_1302_1496 60
221 3300046660 Ga0495625_0012052 Ga0495625_0012052_1729_1923 60
222 3300046660 Ga0495625_0026327 Ga0495625_0026327_3600_3794 60
223 3300046660 Ga0495625_0175376 Ga0495625_0175376_278_472 60
224 3300046660 Ga0495625_0250952 Ga0495625_0250952_206_400 60
225 3300046684 Ga0495669_0009409 Ga0495669_0009409_3376_3570 60
226 3300046692 Ga0495671_0082623 Ga0495671_0082623_23_217 60
227 3300046692 Ga0495671_0139594 Ga0495671_0139594_460_654 60
228 3300046694 Ga0495649_0001823 Ga0495649_0001823_6326_6520 60
229 3300046794 Ga0495589_0016461 Ga0495589_0016461_2922_3116 60
230 3300046810 Ga0495660_0369883 Ga0495660_0369883_323_517 60
231 3300047320 Ga0495672_0003554 Ga0495672_0003554_1976_2170 60
232 3300047323 Ga0495683_0097371 Ga0495683_0097371_287_481 60
233 3300047469 Ga0495673_0007069 Ga0495673_0007069_5483_5677 60
234 3300047470 Ga0495681_0000065 Ga0495681_0000065_36051_36245 60
235 3300047472 Ga0495686_0002204 Ga0495686_0002204_11324_11518 60
236 3300047472 Ga0495686_0014125 Ga0495686_0014125_4828_5022 60
237 3300047472 Ga0495686_0325028 Ga0495686_0325028_589_783 60
238 3300047472 Ga0495686_0465101 Ga0495686_0465101_148_342 60
239 3300047673 Ga0495593_0514495 Ga0495593_0514495_225_419 60
240 3300048909 Ga0496106_0145361 Ga0496106_0145361_637_831 60
241 3300048909 Ga0496106_0193863 Ga0496106_0193863_535_729 60
242 3300048910 Ga0496107_0000073 Ga0496107_0000073_5871_6065 60
243 3300048918 Ga0496115_0340473 Ga0496115_0340473_260_454 60
244 3300048918 Ga0496115_0484381 Ga0496115_0484381_145_339 60
245 3300048924 Ga0496121_0002640 Ga0496121_0002640_9011_9205 60
246 3300048926 Ga0496123_0509238 Ga0496123_0509238_264_458 60
247 3300048928 Ga0496125_0204869 Ga0496125_0204869_775_969 60
248 3300048929 Ga0496126_0132330 Ga0496126_0132330_1749_1943 60
249 3300048929 Ga0496126_0249014 Ga0496126_0249014_990_1184 60
250 3300048929 Ga0496126_0575706 Ga0496126_0575706_513_707 60
251 3300049459 Ga0495678_008789 Ga0495678_008789_3164_3358 60
252 3300049582 Ga0501048_0408432 Ga0501048_0408432_659_853 60
253 3300049584 Ga0501068_0083794 Ga0501068_0083794_563_781 60
254 3300049591 Ga0501075_0000725 Ga0501075_0000725_2916_3134 60
255 3300049593 Ga0501077_0000732 Ga0501077_0000732_3152_3370 60
256 3300049671 Ga0501238_000525 Ga0501238_000525_3909_4103 60
257 3300049742 Ga0501080_0050404 Ga0501080_0050404_560_778 60
258 3300049758 Ga0501241_039531 Ga0501241_039531_543_737 60
259 3300049760 Ga0501263_055779 Ga0501263_055779_116_310 60
260 3300050493 nmdc:mga0k408_170596_c1 nmdc:mga0k408_170596_c1_56_250 60
261 3300050496 nmdc:mga07m45_741247_c1 nmdc:mga07m45_741247_c1_47_241 60
262 3300050510 nmdc:mga06r32_1778442_c1 nmdc:mga06r32_1778442_c1_283_477 60
263 3300053080 Ga0500635_0000112 Ga0500635_0000112_32052_32246 60
264 3300053086 Ga0500578_0000387 Ga0500578_0000387_3202_3396 60
265 3300053086 Ga0500578_0020307 Ga0500578_0020307_649_843 60
266 3300053086 Ga0500578_0301982 Ga0500578_0301982_349_543 60
267 3300053087 Ga0500643_135352 Ga0500643_135352_101_295 60
268 3300053088 Ga0500644_0245385 Ga0500644_0245385_389_583 60
269 3300053104 Ga0500556_0002634 Ga0500556_0002634_2317_2511 60
270 3300053104 Ga0500556_0005331 Ga0500556_0005331_1303_1497 60
271 3300053108 Ga0500562_000388 Ga0500562_000388_2074_2268 60
272 3300053111 Ga0500572_107052 Ga0500572_107052_290_484 60
273 3300053118 Ga0500594_0000328 Ga0500594_0000328_2880_3074 60
274 3300053122 Ga0500608_000367 Ga0500608_000367_10021_10215 60
275 3300053131 Ga0500652_284064 Ga0500652_284064_87_281 60
276 3300053134 Ga0500658_0006135 Ga0500658_0006135_1691_1885 60
277 3300053134 Ga0500658_0086297 Ga0500658_0086297_852_1046 60
278 3300053136 Ga0500559_0022150 Ga0500559_0022150_2371_2565 60
279 3300053136 Ga0500559_0025012 Ga0500559_0025012_776_970 60
280 3300053156 Ga0500622_0000389 Ga0500622_0000389_40327_40521 60
281 3300053156 Ga0500622_0006923 Ga0500622_0006923_3781_3975 60
282 3300053730 Ga0500645_000888 Ga0500645_000888_5847_6041 60
283 3300053730 Ga0500645_051558 Ga0500645_051558_86_280 60
284 3300060353 Ga0501082_0002246 Ga0501082_0002246_12441_12659 60
285 3300061719 Ga0466962_0084888 Ga0466962_0084888_520_714 60
286 3300061734 Ga0530510_0118204 Ga0530510_0118204_423_641 60
287 3300003791 Ga0055530_10000497 Ga0055530_1000049713 61
288 3300003794 Ga0055531_10010233 Ga0055531_100102333 61
289 3300005262 Ga0065165_1000806 Ga0065165_100080618 61
290 3300005435 Ga0070714_100124662 Ga0070714_1001246622 61
291 3300005458 Ga0070681_10666649 Ga0070681_106666492 61
292 3300005539 Ga0068853_100606598 Ga0068853_1006065982 61
293 3300006946 Ga0079104_1022939 Ga0079104_10229391 61
294 3300009011 Ga0105251_10057008 Ga0105251_100570083 61
295 3300009011 Ga0105251_10116611 Ga0105251_101166112 61
296 3300009092 Ga0105250_10001803 Ga0105250_100018038 61
297 3300009093 Ga0105240_10065300 Ga0105240_100653006 61
298 3300009093 Ga0105240_10427852 Ga0105240_104278523 61
299 3300010375 Ga0105239_10219490 Ga0105239_102194903 61
300 3300012498 Ga0157345_1000004 Ga0157345_10000048 61
301 3300013100 Ga0157373_10592543 Ga0157373_105925432 61
302 3300013102 Ga0157371_10151186 Ga0157371_101511863 61
303 3300013102 Ga0157371_10410373 Ga0157371_104103732 61
304 3300013102 Ga0157371_10800311 Ga0157371_108003111 61
305 3300013104 Ga0157370_10070925 Ga0157370_100709253 61
306 3300013104 Ga0157370_10480058 Ga0157370_104800582 61
307 3300013104 Ga0157370_10693578 Ga0157370_106935782 61
308 3300013104 Ga0157370_10745089 Ga0157370_107450892 61
309 3300013104 Ga0157370_11524983 Ga0157370_115249832 61
310 3300013105 Ga0157369_10000286 Ga0157369_1000028611 61
311 3300013105 Ga0157369_11987240 Ga0157369_119872402 61
312 3300013296 Ga0157374_10001026 Ga0157374_1000102621 61
313 3300013306 Ga0163162_11279787 Ga0163162_112797872 61
314 3300013308 Ga0157375_10098142 Ga0157375_100981422 61
315 3300014497 Ga0182008_10015262 Ga0182008_100152623 61
316 3300015265 Ga0182005_1008233 Ga0182005_10082333 61
317 3300017792 Ga0163161_10059022 Ga0163161_100590224 61
318 3300017792 Ga0163161_10123333 Ga0163161_101233333 61
319 3300025297 Ga0209758_1024949 Ga0209758_10249492 61
320 3300025298 Ga0209050_1000121 Ga0209050_1000121195 61
321 3300025302 Ga0207426_1068343 Ga0207426_10683432 61
322 3300025304 Ga0209257_1000125 Ga0209257_1000125219 61
323 3300025711 Ga0207696_1001491 Ga0207696_10014916 61
324 3300025711 Ga0207696_1001893 Ga0207696_10018934 61
325 3300025728 Ga0207655_1017725 Ga0207655_10177253 61
326 3300025735 Ga0207713_1011282 Ga0207713_10112826 61
327 3300025913 Ga0207695_10021692 Ga0207695_100216924 61
328 3300025913 Ga0207695_10273993 Ga0207695_102739933 61
329 3300025929 Ga0207664_11394254 Ga0207664_113942542 61
330 3300025933 Ga0207706_10051270 Ga0207706_100512706 61
331 3300027111 Ga0209281_1002352 Ga0209281_10023524 61
332 3300028800 Ga0265338_10017848 Ga0265338_100178485 61
333 3300031548 Ga0307408_100186082 Ga0307408_1001860824 61
334 3300031595 Ga0265313_10176595 Ga0265313_101765953 61
335 3300031691 Ga0316579_10140335 Ga0316579_101403352 61
336 3300031728 Ga0316578_10728232 Ga0316578_107282322 61
337 3300031731 Ga0307405_10158536 Ga0307405_101585363 61
338 3300031901 Ga0307406_10503824 Ga0307406_105038242 61
339 3300031903 Ga0307407_10071060 Ga0307407_100710604 61
340 3300031911 Ga0307412_10295882 Ga0307412_102958822 61
341 3300031995 Ga0307409_102469495 Ga0307409_1024694952 61
342 3300032004 Ga0307414_10104491 Ga0307414_101044913 61
343 3300032005 Ga0307411_10009261 Ga0307411_100092616 61
344 3300033180 Ga0307510_10010763 Ga0307510_100107635 61
345 3300042004 Ga0439445_0045000 Ga0439445_0045000_303_500 61
346 3300042006 Ga0439432_040469 Ga0439432_040469_1147_1344 61
347 3300042016 Ga0439463_058242 Ga0439463_058242_62_259 61
348 3300042144 Ga0450889_017003 Ga0450889_017003_435_632 61
349 3300042532 Ga0450893_0009319 Ga0450893_0009319_1366_1563 61
350 3300044684 Ga0466966_0116555 Ga0466966_0116555_641_838 61
351 3300045049 Ga0466959_0769367 Ga0466959_0769367_270_467 61
352 3300045051 Ga0451576_1870407 Ga0451576_1870407_311_508 61
353 3300045976 Ga0466967_2151676 Ga0466967_2151676_226_423 61
354 3300046452 Ga0495617_000484 Ga0495617_000484_1930_2127 61
355 3300046452 Ga0495617_061067 Ga0495617_061067_226_423 61
356 3300046452 Ga0495617_086658 Ga0495617_086658_67_264 61
357 3300046452 Ga0495617_097426 Ga0495617_097426_700_897 61
358 3300046453 Ga0495627_000101 Ga0495627_000101_93835_94032 61
359 3300046453 Ga0495627_005742 Ga0495627_005742_3279_3476 61
360 3300046453 Ga0495627_010736 Ga0495627_010736_1596_1793 61
361 3300046454 Ga0495592_0063081 Ga0495592_0063081_1359_1556 61
362 3300046457 Ga0495590_0044692 Ga0495590_0044692_433_630 61
363 3300046457 Ga0495590_0195284 Ga0495590_0195284_451_648 61
364 3300046458 Ga0495591_000032 Ga0495591_000032_10509_10706 61
365 3300046458 Ga0495591_000082 Ga0495591_000082_95830_96027 61
366 3300046458 Ga0495591_017809 Ga0495591_017809_1123_1320 61
367 3300046458 Ga0495591_037727 Ga0495591_037727_63_260 61
368 3300046458 Ga0495591_147101 Ga0495591_147101_17_214 61
369 3300046458 Ga0495591_163458 Ga0495591_163458_254_451 61
370 3300046460 Ga0495638_0000449 Ga0495638_0000449_18497_18694 61
371 3300046460 Ga0495638_0043562 Ga0495638_0043562_1632_1829 61
372 3300046460 Ga0495638_0167622 Ga0495638_0167622_900_1097 61
373 3300046460 Ga0495638_0604717 Ga0495638_0604717_71_268 61
374 3300046463 Ga0495653_0035570 Ga0495653_0035570_2146_2343 61
375 3300046463 Ga0495653_0109156 Ga0495653_0109156_748_945 61
376 3300046471 Ga0495650_0009217 Ga0495650_0009217_3851_4048 61
377 3300046471 Ga0495650_0022904 Ga0495650_0022904_944_1141 61
378 3300046471 Ga0495650_0043435 Ga0495650_0043435_82_279 61
379 3300046472 Ga0495580_0437056 Ga0495580_0437056_306_503 61
380 3300046474 Ga0495605_0000147 Ga0495605_0000147_79177_79374 61
381 3300046474 Ga0495605_0034354 Ga0495605_0034354_1237_1434 61
382 3300046474 Ga0495605_0418719 Ga0495605_0418719_286_483 61
383 3300046491 Ga0495584_0014100 Ga0495584_0014100_1989_2186 61
384 3300046492 Ga0495585_0000234 Ga0495585_0000234_32341_32538 61
385 3300046492 Ga0495585_0003811 Ga0495585_0003811_8334_8531 61
386 3300046492 Ga0495585_0020869 Ga0495585_0020869_1505_1702 61
387 3300046492 Ga0495585_0369397 Ga0495585_0369397_187_384 61
388 3300046500 Ga0495596_0051284 Ga0495596_0051284_1200_1397 61
389 3300046500 Ga0495596_0250547 Ga0495596_0250547_255_452 61
390 3300046501 Ga0495607_0000603 Ga0495607_0000603_29827_30024 61
391 3300046501 Ga0495607_0053808 Ga0495607_0053808_128_325 61
392 3300046501 Ga0495607_0123450 Ga0495607_0123450_993_1190 61
393 3300046506 Ga0495583_0014877 Ga0495583_0014877_2352_2549 61
394 3300046507 Ga0495606_0007373 Ga0495606_0007373_774_971 61
395 3300046507 Ga0495606_0164399 Ga0495606_0164399_1047_1244 61
396 3300046507 Ga0495606_0183965 Ga0495606_0183965_849_1046 61
397 3300046507 Ga0495606_0261848 Ga0495606_0261848_613_810 61
398 3300046507 Ga0495606_0314617 Ga0495606_0314617_215_412 61
399 3300046512 Ga0495610_0000133 Ga0495610_0000133_15621_15818 61
400 3300046512 Ga0495610_0000173 Ga0495610_0000173_1591_1788 61
401 3300046512 Ga0495610_0003946 Ga0495610_0003946_8320_8517 61
402 3300046512 Ga0495610_0115398 Ga0495610_0115398_375_572 61
403 3300046513 Ga0495616_0001757 Ga0495616_0001757_12864_13061 61
404 3300046513 Ga0495616_0009481 Ga0495616_0009481_3963_4160 61
405 3300046513 Ga0495616_0126042 Ga0495616_0126042_37_234 61
406 3300046513 Ga0495616_0272256 Ga0495616_0272256_222_419 61
407 3300046515 Ga0495620_0011877 Ga0495620_0011877_1546_1743 61
408 3300046515 Ga0495620_0020652 Ga0495620_0020652_1386_1583 61
409 3300046515 Ga0495620_0026416 Ga0495620_0026416_2158_2355 61
410 3300046515 Ga0495620_0351896 Ga0495620_0351896_319_516 61
411 3300046515 Ga0495620_0389876 Ga0495620_0389876_234_431 61
412 3300046518 Ga0495631_0000013 Ga0495631_0000013_8827_9024 61
413 3300046519 Ga0495632_0002535 Ga0495632_0002535_11372_11569 61
414 3300046519 Ga0495632_0045071 Ga0495632_0045071_1957_2154 61
415 3300046519 Ga0495632_0073255 Ga0495632_0073255_214_411 61
416 3300046519 Ga0495632_0232721 Ga0495632_0232721_300_497 61
417 3300046520 Ga0495637_0000855 Ga0495637_0000855_7894_8091 61
418 3300046520 Ga0495637_0004752 Ga0495637_0004752_70_267 61
419 3300046522 Ga0495643_0000396 Ga0495643_0000396_46757_46954 61
420 3300046522 Ga0495643_0042273 Ga0495643_0042273_744_941 61
421 3300046523 Ga0495644_0005850 Ga0495644_0005850_4201_4398 61
422 3300046524 Ga0495648_0000259 Ga0495648_0000259_19796_19993 61
423 3300046524 Ga0495648_0006035 Ga0495648_0006035_9414_9611 61
424 3300046524 Ga0495648_0127771 Ga0495648_0127771_965_1162 61
425 3300046526 Ga0495666_0022607 Ga0495666_0022607_1287_1484 61
426 3300046530 Ga0495654_0000104 Ga0495654_0000104_13712_13909 61
427 3300046530 Ga0495654_0009881 Ga0495654_0009881_3975_4172 61
428 3300046530 Ga0495654_0106165 Ga0495654_0106165_640_837 61
429 3300046530 Ga0495654_0106167 Ga0495654_0106167_450_647 61
430 3300046535 Ga0495586_0518481 Ga0495586_0518481_346_543 61
431 3300046536 Ga0495587_0202399 Ga0495587_0202399_92_289 61
432 3300046538 Ga0495609_0007370 Ga0495609_0007370_3314_3511 61
433 3300046538 Ga0495609_0007402 Ga0495609_0007402_1460_1657 61
434 3300046538 Ga0495609_0019094 Ga0495609_0019094_2181_2378 61
435 3300046542 Ga0495597_0000965 Ga0495597_0000965_19507_19704 61
436 3300046557 Ga0495622_0000047 Ga0495622_0000047_8829_9026 61
437 3300046558 Ga0495633_0000304 Ga0495633_0000304_45310_45507 61
438 3300046616 Ga0495668_0002358 Ga0495668_0002358_4140_4337 61
439 3300046616 Ga0495668_0019393 Ga0495668_0019393_3698_3895 61
440 3300046642 Ga0495634_0043669 Ga0495634_0043669_1351_1548 61
441 3300046642 Ga0495634_0653411 Ga0495634_0653411_398_595 61
442 3300046648 Ga0495611_0000024 Ga0495611_0000024_105787_105984 61
443 3300046648 Ga0495611_0064734 Ga0495611_0064734_62_259 61
444 3300046648 Ga0495611_0085640 Ga0495611_0085640_193_390 61
445 3300046660 Ga0495625_0000103 Ga0495625_0000103_123281_123478 61
446 3300046660 Ga0495625_0002403 Ga0495625_0002403_9667_9864 61
447 3300046660 Ga0495625_0407322 Ga0495625_0407322_325_522 61
448 3300046663 Ga0495635_0798414 Ga0495635_0798414_268_465 61
449 3300046665 Ga0495661_0059049 Ga0495661_0059049_584_781 61
450 3300046665 Ga0495661_0099410 Ga0495661_0099410_800_997 61
451 3300046689 Ga0495613_0001739 Ga0495613_0001739_11230_11427 61
452 3300046692 Ga0495671_0000541 Ga0495671_0000541_25872_26069 61
453 3300046692 Ga0495671_0000799 Ga0495671_0000799_2127_2324 61
454 3300046692 Ga0495671_0008285 Ga0495671_0008285_4002_4199 61
455 3300046694 Ga0495649_0002309 Ga0495649_0002309_11831_12028 61
456 3300046694 Ga0495649_0005390 Ga0495649_0005390_4980_5177 61
457 3300046694 Ga0495649_0007150 Ga0495649_0007150_2632_2829 61
458 3300046694 Ga0495649_0096780 Ga0495649_0096780_852_1049 61
459 3300046794 Ga0495589_0161687 Ga0495589_0161687_81_278 61
460 3300046794 Ga0495589_0589663 Ga0495589_0589663_32_229 61
461 3300046809 Ga0495600_0017941 Ga0495600_0017941_2908_3105 61
462 3300046810 Ga0495660_0000785 Ga0495660_0000785_808_1005 61
463 3300046810 Ga0495660_0002576 Ga0495660_0002576_9794_9991 61
464 3300046810 Ga0495660_0012681 Ga0495660_0012681_2036_2233 61
465 3300046810 Ga0495660_0108915 Ga0495660_0108915_1147_1344 61
466 3300046810 Ga0495660_0200672 Ga0495660_0200672_669_866 61
467 3300047317 Ga0495604_0026516 Ga0495604_0026516_1364_1561 61
468 3300047320 Ga0495672_0015739 Ga0495672_0015739_981_1178 61
469 3300047320 Ga0495672_0034996 Ga0495672_0034996_1333_1530 61
470 3300047321 Ga0495676_0002653 Ga0495676_0002653_5267_5464 61
471 3300047322 Ga0495680_0005627 Ga0495680_0005627_7407_7604 61
472 3300047323 Ga0495683_0011172 Ga0495683_0011172_3280_3477 61
473 3300047323 Ga0495683_0410447 Ga0495683_0410447_277_474 61
474 3300047446 Ga0495679_000612 Ga0495679_000612_11293_11490 61
475 3300047446 Ga0495679_004870 Ga0495679_004870_4797_4994 61
476 3300047446 Ga0495679_007852 Ga0495679_007852_2543_2740 61
477 3300047446 Ga0495679_165567 Ga0495679_165567_13_210 61
478 3300047469 Ga0495673_0002039 Ga0495673_0002039_12812_13009 61
479 3300047469 Ga0495673_0008887 Ga0495673_0008887_1485_1682 61
480 3300047469 Ga0495673_0010193 Ga0495673_0010193_949_1146 61
481 3300047469 Ga0495673_0036415 Ga0495673_0036415_1148_1345 61
482 3300047469 Ga0495673_0045651 Ga0495673_0045651_454_651 61
483 3300047470 Ga0495681_0000231 Ga0495681_0000231_9374_9571 61
484 3300047471 Ga0495684_0010927 Ga0495684_0010927_1621_1818 61
485 3300048088 Ga0495602_0121621 Ga0495602_0121621_1367_1564 61
486 3300048091 Ga0495626_0000074 Ga0495626_0000074_9077_9274 61
487 3300048091 Ga0495626_0007211 Ga0495626_0007211_2577_2774 61
488 3300048091 Ga0495626_0010037 Ga0495626_0010037_1021_1218 61
489 3300048091 Ga0495626_0076279 Ga0495626_0076279_775_972 61
490 3300048091 Ga0495626_0096151 Ga0495626_0096151_482_679 61
491 3300048908 Ga0496105_1402681 Ga0496105_1402681_279_476 61
492 3300048913 Ga0496110_0208449 Ga0496110_0208449_855_1052 61
493 3300048920 Ga0496117_0067429 Ga0496117_0067429_396_593 61
494 3300048921 Ga0496118_0074693 Ga0496118_0074693_1826_2023 61
495 3300048921 Ga0496118_0325142 Ga0496118_0325142_163_360 61
496 3300048922 Ga0496119_0072833 Ga0496119_0072833_601_798 61
497 3300048923 Ga0496120_0247487 Ga0496120_0247487_587_784 61
498 3300048924 Ga0496121_0062032 Ga0496121_0062032_994_1191 61
499 3300048925 Ga0496122_0130664 Ga0496122_0130664_1276_1473 61
500 3300048926 Ga0496123_0197762 Ga0496123_0197762_558_755 61
501 3300048927 Ga0496124_0039692 Ga0496124_0039692_584_781 61
502 3300048927 Ga0496124_0122912 Ga0496124_0122912_726_923 61
503 3300048927 Ga0496124_0280677 Ga0496124_0280677_572_769 61
504 3300048928 Ga0496125_0094137 Ga0496125_0094137_1355_1552 61
505 3300048928 Ga0496125_0179600 Ga0496125_0179600_1028_1225 61
506 3300049459 Ga0495678_001994 Ga0495678_001994_1667_1864 61
507 3300049459 Ga0495678_008180 Ga0495678_008180_2742_2939 61
508 3300049459 Ga0495678_048215 Ga0495678_048215_57_254 61
509 3300049459 Ga0495678_102005 Ga0495678_102005_369_566 61
510 3300049459 Ga0495678_163879 Ga0495678_163879_440_637 61
511 3300049570 Ga0501033_0433387 Ga0501033_0433387_26_241 61
512 3300049573 Ga0501037_0069254 Ga0501037_0069254_932_1129 61
513 3300049581 Ga0501047_0044992 Ga0501047_0044992_1584_1781 61
514 3300049586 Ga0501070_0982390 Ga0501070_0982390_313_510 61
515 3300049822 Ga0501035_0110431 Ga0501035_0110431_995_1192 61
516 3300049823 Ga0501044_0014847 Ga0501044_0014847_2280_2477 61
517 3300053108 Ga0500562_121127 Ga0500562_121127_148_345 61
518 3300053111 Ga0500572_002475 Ga0500572_002475_3592_3789 61
519 3300053145 Ga0500586_280837 Ga0500586_280837_251_448 61
520 3300054114 Ga0501084_1330215 Ga0501084_1330215_202_399 61
521 3300005295 Ga0065707_10854783 Ga0065707_108547831 62
522 3300005339 Ga0070660_101272861 Ga0070660_1012728612 62
523 3300005441 Ga0070700_100834680 Ga0070700_1008346802 62
524 3300005549 Ga0070704_100646629 Ga0070704_1006466291 62
525 3300005617 Ga0068859_101163573 Ga0068859_1011635732 62
526 3300006931 Ga0097620_101163354 Ga0097620_1011633542 62
527 3300007265 Ga0099794_10076507 Ga0099794_100765072 62
528 3300009011 Ga0105251_10038446 Ga0105251_100384463 62
529 3300009094 Ga0111539_10003004 Ga0111539_1000300414 62
530 3300009147 Ga0114129_12434619 Ga0114129_124346192 62
531 3300009553 Ga0105249_10421837 Ga0105249_104218372 62
532 3300013105 Ga0157369_10226243 Ga0157369_102262433 62
533 3300014745 Ga0157377_11619666 Ga0157377_116196661 62
534 3300025903 Ga0207680_10333177 Ga0207680_103331771 62
535 3300026023 Ga0207677_11217232 Ga0207677_112172322 62
536 3300026089 Ga0207648_11901496 Ga0207648_119014961 62
537 3300027907 Ga0207428_10007515 Ga0207428_100075154 62
538 3300028379 Ga0268266_12292251 Ga0268266_122922512 62
539 3300031241 Ga0265325_10435894 Ga0265325_104358941 62
540 3300031727 Ga0316576_10404515 Ga0316576_104045153 62
541 3300031731 Ga0307405_10447808 Ga0307405_104478082 62
542 3300031733 Ga0316577_10174379 Ga0316577_101743792 62
543 3300031903 Ga0307407_11284157 Ga0307407_112841572 62
544 3300031995 Ga0307409_102392622 Ga0307409_1023926222 62
545 3300032002 Ga0307416_100606929 Ga0307416_1006069292 62
546 3300032004 Ga0307414_10365980 Ga0307414_103659802 62
547 3300032005 Ga0307411_10567117 Ga0307411_105671172 62
548 3300032139 Ga0316580_10003837 Ga0316580_100038374 62
549 3300035695 Ga0373927_0373784 Ga0373927_0373784_161_367 62
550 3300036647 Ga0316582_0668945 Ga0316582_0668945_160_360 62
551 3300036712 Ga0316584_0459503 Ga0316584_0459503_149_349 62
552 3300039438 Ga0436360_0809450 Ga0436360_0809450_404_604 62
553 3300039438 Ga0436360_0822581 Ga0436360_0822581_158_358 62
554 3300039453 Ga0436362_0544016 Ga0436362_0544016_480_680 62
555 3300041492 Ga0451835_0461422 Ga0451835_0461422_688_888 62
556 3300041494 Ga0451837_0202422 Ga0451837_0202422_296_496 62
557 3300041503 Ga0451847_0762432 Ga0451847_0762432_221_421 62
558 3300041511 Ga0451855_1322555 Ga0451855_1322555_316_516 62
559 3300041512 Ga0451853_2292328 Ga0451853_2292328_661_861 62
560 3300044712 Ga0453684_0023941 Ga0453684_0023941_7785_7985 62
561 3300045051 Ga0451576_2314195 Ga0451576_2314195_13_213 62
562 3300045051 Ga0451576_2321386 Ga0451576_2321386_300_500 62
563 3300046455 Ga0495603_0068327 Ga0495603_0068327_786_995 62
564 3300046616 Ga0495668_0464086 Ga0495668_0464086_74_286 62
565 3300046674 Ga0495588_0009849 Ga0495588_0009849_2329_2538 62
566 3300046681 Ga0495647_0012185 Ga0495647_0012185_998_1207 62
567 3300047315 Ga0495581_0053318 Ga0495581_0053318_324_533 62
568 3300047321 Ga0495676_0024971 Ga0495676_0024971_853_1062 62
569 3300047472 Ga0495686_0014265 Ga0495686_0014265_1362_1574 62
570 3300048919 Ga0496116_0001015 Ga0496116_0001015_4662_4862 62
571 3300048920 Ga0496117_0000475 Ga0496117_0000475_50783_50983 62
572 3300048921 Ga0496118_0000482 Ga0496118_0000482_50847_51047 62
573 3300048925 Ga0496122_0009192 Ga0496122_0009192_487_687 62
574 3300048926 Ga0496123_0003395 Ga0496123_0003395_15015_15215 62
575 3300049582 Ga0501048_0459442 Ga0501048_0459442_231_431 62
576 3300049586 Ga0501070_1162509 Ga0501070_1162509_165_371 62
577 3300049588 Ga0501072_0181537 Ga0501072_0181537_1219_1419 62
578 3300049590 Ga0501074_0792939 Ga0501074_0792939_335_541 62
579 3300049660 Ga0501216_045412 Ga0501216_045412_63_263 62
580 3300050510 nmdc:mga06r32_911818_c1 nmdc:mga06r32_911818_c1_570_770 62
581 3300050511 nmdc:mga08y16_4529_c1 nmdc:mga08y16_4529_c1_9993_10193 62
582 3300053139 Ga0500568_0121341 Ga0500568_0121341_334_546 62
583 3300053730 Ga0500645_004039 Ga0500645_004039_4202_4414 62
584 3300059424 Ga0590075_014819 Ga0590075_014819_1634_1834 62
585 3300003320 rootH2_10024047 rootH2_100240476 63
586 3300005336 Ga0070680_100091889 Ga0070680_1000918893 63
587 3300005435 Ga0070714_100200072 Ga0070714_1002000723 63
588 3300005444 Ga0070694_100011869 Ga0070694_1000118693 63
589 3300005563 Ga0068855_100116656 Ga0068855_1001166563 63
590 3300006846 Ga0075430_100193680 Ga0075430_1001936802 63
591 3300006946 Ga0079104_1038296 Ga0079104_10382962 63
592 3300009147 Ga0114129_10005995 Ga0114129_1000599514 63
593 3300013100 Ga0157373_11105377 Ga0157373_111053772 63
594 3300013102 Ga0157371_10100965 Ga0157371_101009653 63
595 3300013104 Ga0157370_10085403 Ga0157370_100854032 63
596 3300013308 Ga0157375_10228060 Ga0157375_102280604 63
597 3300014326 Ga0157380_10084749 Ga0157380_100847493 63
598 3300025920 Ga0207649_10521825 Ga0207649_105218252 63
599 3300025929 Ga0207664_10537005 Ga0207664_105370052 63
600 3300025949 Ga0207667_10122051 Ga0207667_101220512 63
601 3300025972 Ga0207668_11822885 Ga0207668_118228852 63
602 3300025981 Ga0207640_10834947 Ga0207640_108349472 63
603 3300025986 Ga0207658_10057884 Ga0207658_100578842 63
604 3300026142 Ga0207698_10324361 Ga0207698_103243612 63
605 3300027111 Ga0209281_1020171 Ga0209281_10201713 63
606 3300028380 Ga0268265_10772792 Ga0268265_107727923 63
607 3300031090 Ga0265760_10082623 Ga0265760_100826232 63
608 3300031911 Ga0307412_10679188 Ga0307412_106791882 63
609 3300031911 Ga0307412_11662562 Ga0307412_116625622 63
610 3300032004 Ga0307414_10617061 Ga0307414_106170612 63
611 3300035119 Ga0373956_0045320 Ga0373956_0045320_1467_1670 63
612 3300035120 Ga0373957_0041997 Ga0373957_0041997_1346_1549 63
613 3300035172 Ga0373955_0287772 Ga0373955_0287772_596_799 63
614 3300035410 Ga0373924_0018038 Ga0373924_0018038_1155_1358 63
615 3300035692 Ga0373935_0011040 Ga0373935_0011040_630_854 63
616 3300035692 Ga0373935_0069521 Ga0373935_0069521_16_219 63
617 3300035695 Ga0373927_0589543 Ga0373927_0589543_406_609 63
618 3300036401 Ga0373937_0002374 Ga0373937_0002374_6959_7162 63
619 3300037471 Ga0395905_1032376 Ga0395905_1032376_453_665 63
620 3300041405 Ga0439438_006478 Ga0439438_006478_1645_1860 63
621 3300041407 Ga0439447_023816 Ga0439447_023816_1293_1508 63
622 3300042006 Ga0439432_028822 Ga0439432_028822_786_1001 63
623 3300042010 Ga0439452_028068 Ga0439452_028068_889_1104 63
624 3300042013 Ga0439456_020350 Ga0439456_020350_307_522 63
625 3300042115 Ga0450911_016424 Ga0450911_016424_607_822 63
626 3300042136 Ga0450900_001423 Ga0450900_001423_1953_2168 63
627 3300042137 Ga0450902_006363 Ga0450902_006363_1213_1428 63
628 3300042138 Ga0450903_007678 Ga0450903_007678_344_559 63
629 3300042142 Ga0450905_021159 Ga0450905_021159_410_625 63
630 3300042146 Ga0450907_006503 Ga0450907_006503_1154_1369 63
631 3300042532 Ga0450893_0122840 Ga0450893_0122840_72_287 63
632 3300044673 Ga0453683_0943569 Ga0453683_0943569_53_280 63
633 3300044712 Ga0453684_0179887 Ga0453684_0179887_658_885 63
634 3300045051 Ga0451576_0213695 Ga0451576_0213695_100_327 63
635 3300046455 Ga0495603_0561847 Ga0495603_0561847_209_412 63
636 3300046458 Ga0495591_000120 Ga0495591_000120_13469_13678 63
637 3300046473 Ga0495582_0096427 Ga0495582_0096427_571_774 63
638 3300046499 Ga0495594_0065163 Ga0495594_0065163_335_538 63
639 3300046518 Ga0495631_0020958 Ga0495631_0020958_2042_2248 63
640 3300046519 Ga0495632_0023186 Ga0495632_0023186_1991_2197 63
641 3300046538 Ga0495609_0000879 Ga0495609_0000879_9896_10102 63
642 3300046538 Ga0495609_0428857 Ga0495609_0428857_23_226 63
643 3300046660 Ga0495625_0028552 Ga0495625_0028552_2163_2369 63
644 3300046690 Ga0495624_0097110 Ga0495624_0097110_939_1148 63
645 3300047320 Ga0495672_0003653 Ga0495672_0003653_11047_11256 63
646 3300049579 Ga0501043_0001012 Ga0501043_0001012_13789_14001 63
647 3300049580 Ga0501046_0000044 Ga0501046_0000044_36080_36292 63
648 3300049581 Ga0501047_0007075 Ga0501047_0007075_8718_8930 63
649 3300049582 Ga0501048_0000140 Ga0501048_0000140_26560_26772 63
650 3300049584 Ga0501068_0330768 Ga0501068_0330768_534_764 63
651 3300049588 Ga0501072_0468805 Ga0501072_0468805_760_966 63
652 3300049744 Ga0501083_0000008 Ga0501083_0000008_35828_36040 63
653 3300049822 Ga0501035_0016147 Ga0501035_0016147_5458_5670 63
654 3300049823 Ga0501044_0019695 Ga0501044_0019695_5050_5262 63
655 3300050491 nmdc:mga00v17_153926_c1 nmdc:mga00v17_153926_c1_996_1202 63
656 3300050491 nmdc:mga00v17_256829_c1 nmdc:mga00v17_256829_c1_890_1096 63
657 3300050509 nmdc:mga0qj67_313144_c1 nmdc:mga0qj67_313144_c1_48_263 63
658 3300050511 nmdc:mga08y16_705768_c1 nmdc:mga08y16_705768_c1_55_261 63
659 3300050512 nmdc:mga0n895_816555_c1 nmdc:mga0n895_816555_c1_330_572 63
660 3300060353 Ga0501082_0100222 Ga0501082_0100222_897_1109 63
661 iso_pu_bacteria 2842832357 2842835312 63

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12844

HTH_19

Helix-turn-helix domain

3

64

0.96

PF01381

HTH_3

Helix-turn-helix

5

59

0.93

PF13560

HTH_31

Helix-turn-helix domain

3

57

0.9

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

4

65

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hkx-assembly1.cif.gz_A structure of cooa mutant (n127l/s128l) from carboxydothermus hydrogenoformans 0.9722 9 32
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9512 2 61
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9511 2 61
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9491 2 57
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9398 2 59
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9882 2 59 1.10.260.40
2kpjA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9538 2 55 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9407 2 59 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9393 2 59 1.10.260.40
2lykB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9298 2 55 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3R7EKQ7-F1-model_v4 Putative transcriptional regulator 1.003 1 59 GO:0003677
AF-A0A6L8F9T1-F1-model_v4 deleted 1.003 2 54
AF-A0A328P874-F1-model_v4 Transcriptional regulator 1.002 1 57 GO:0003677
AF-V9GAV8-F1-model_v4 Transcriptional regulator, XRE family 1.001 2 57 GO:0003677
AF-A0A0B2XJD3-F1-model_v4 deleted 0.9998 2 54

Feature Viewer

pLDDT pTM Quality
92.69 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map