F473347

General Info

Members Datasets Scaffolds Average Seq Length
660 276 658 287

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0070516|Ga0436361_0070516_8604_9662
Length 352
Sequence MPPSAQFDWIAASSVMPQASTSAGTQKCMSVRTARTGCCLTACRSLIAVFLAAPGLMPWLLQNYVTLCAAILIHLSAYVKTNEETMGTAARYKEGKSQEEFRQYDAQAVPRVAEFYRQQHENMTVEYVLAKEEEYFTLRKGQKTVWEAAEFLNQLVDDSDPDTDLTQIEHLLQTSEAMRRDNLPRWMVLTGFLHDLGKCLCLYGEPQWGVVGDTFPVGCAWSEHIVFHQYFAKNPDRLNPQYQDLYGIYEPNCGLEKVHMSFGHDGYIGEVMQPYLPDEALYMLRFHSFYPWHKHGAYDHLCNDKDRAMKEWVLKFNQYDLYSKGHSKPDLKELKPYYDDLFAEFLPPTIAW

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
273 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 2.58
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 0.61
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10006251 3300003320 Bacteria 11598
2 rootH2_10183644 3300003320 Bacteria 2380
3 rootL2_10089696 3300003322 Bacteria 7437
4 rootH1_10319382 3300003323 Unclassified 2456
5 Ga0065707_10150079 3300005295 Bacteria 1668
6 Ga0070658_10006654 3300005327 Bacteria 9365
7 Ga0070658_10007325 3300005327 Bacteria 8911
8 Ga0070658_10027817 3300005327 Bacteria 4538
9 Ga0070683_100000008 3300005329 Bacteria 329206
10 Ga0070683_100001085 3300005329 Bacteria 20449
11 Ga0070683_100106880 3300005329 Bacteria 2638
12 Ga0070683_100240011 3300005329 Bacteria 1724
13 Ga0070683_100248932 3300005329 Bacteria 1690
14 Ga0068869_100009742 3300005334 Bacteria 6239
15 Ga0068869_100025813 3300005334 Bacteria 4083
16 Ga0068869_100029502 3300005334 Bacteria 3844
17 Ga0070666_10029166 3300005335 Unclassified 3625
18 Ga0070682_100069155 3300005337 Bacteria 2254
19 Ga0068868_100011969 3300005338 Bacteria 6331
20 Ga0068868_100038942 3300005338 Unclassified 3691
21 Ga0068868_100041785 3300005338 Unclassified 3574
22 Ga0068868_100158878 3300005338 Bacteria 1866
23 Ga0070660_100006724 3300005339 Bacteria 7976
24 Ga0070660_100195619 3300005339 Bacteria 1639
25 Ga0070661_100016382 3300005344 Bacteria 5239
26 Ga0070661_100059118 3300005344 Bacteria 2810
27 Ga0070661_100143738 3300005344 Unclassified 1799
28 Ga0070675_100045990 3300005354 Bacteria 3573
29 Ga0070671_100056092 3300005355 Bacteria 3278
30 Ga0070671_100307106 3300005355 Bacteria 1351
31 Ga0070673_100093952 3300005364 Bacteria 2457
32 Ga0070673_100132170 3300005364 Unclassified 2096
33 Ga0070659_100006194 3300005366 Bacteria 8642
34 Ga0070659_100007028 3300005366 Bacteria 8151
35 Ga0070667_100292379 3300005367 Unclassified 1465
36 Ga0070703_10004502 3300005406 Bacteria 3923
37 Ga0070709_10003223 3300005434 Bacteria 8766
38 Ga0070709_10004418 3300005434 Bacteria 7585
39 Ga0070709_10213377 3300005434 Bacteria 1373
40 Ga0070709_10274293 3300005434 Bacteria 1223
41 Ga0070709_10279995 3300005434 Unclassified 1212
42 Ga0070714_100014642 3300005435 Bacteria 6303
43 Ga0070714_100449729 3300005435 Bacteria 1223
44 Ga0070713_100001444 3300005436 Bacteria 15235
45 Ga0070713_100023514 3300005436 Bacteria 4783
46 Ga0070713_100081141 3300005436 Unclassified 2767
47 Ga0070713_100139246 3300005436 Bacteria 2148
48 Ga0070710_10013842 3300005437 Bacteria 4049
49 Ga0070711_100002499 3300005439 Bacteria 10495
50 Ga0070711_100322533 3300005439 Unclassified 1235
51 Ga0070711_100388518 3300005439 Bacteria 1130
52 Ga0070705_100037839 3300005440 Bacteria 2725
53 Ga0070705_100139845 3300005440 Bacteria 1592
54 Ga0070694_100011619 3300005444 Bacteria 5451
55 Ga0070708_100016490 3300005445 Bacteria 6132
56 Ga0070708_100018101 3300005445 Bacteria 5894
57 Ga0070708_100035172 3300005445 Bacteria 4363
58 Ga0070663_100054629 3300005455 Bacteria 2855
59 Ga0070663_100396411 3300005455 Bacteria 1127
60 Ga0070678_100013830 3300005456 Bacteria 5072
61 Ga0070662_100066627 3300005457 Bacteria 2642
62 Ga0070662_100295534 3300005457 Bacteria 1314
63 Ga0070681_10007463 3300005458 Bacteria 10688
64 Ga0070681_10047671 3300005458 Bacteria 4283
65 Ga0070681_10086352 3300005458 Bacteria 3090
66 Ga0070681_10123605 3300005458 Unclassified 2520
67 Ga0068867_100002168 3300005459 Bacteria 13782
68 Ga0068867_100024034 3300005459 Bacteria 4367
69 Ga0070706_100002900 3300005467 Bacteria 17069
70 Ga0070706_100045013 3300005467 Unclassified 4076
71 Ga0070706_100050232 3300005467 Bacteria 3848
72 Ga0070706_100117947 3300005467 Bacteria 2472
73 Ga0070707_100005573 3300005468 Bacteria 11759
74 Ga0070707_100256099 3300005468 Bacteria 1703
75 Ga0070698_100002625 3300005471 Bacteria 19805
76 Ga0070698_100057408 3300005471 Unclassified 3939
77 Ga0070698_100065920 3300005471 Unclassified 3646
78 Ga0070699_100008871 3300005518 Bacteria 8708
79 Ga0070699_100251999 3300005518 Bacteria 1577
80 Ga0070679_100061073 3300005530 Bacteria 3757
81 Ga0070679_100072203 3300005530 Bacteria 3443
82 Ga0070679_100088650 3300005530 Bacteria 3081
83 Ga0070679_100117500 3300005530 Bacteria 2644
84 Ga0070679_100154565 3300005530 Bacteria 2269
85 Ga0070679_100168347 3300005530 Bacteria 2164
86 Ga0070679_100367001 3300005530 Bacteria 1387
87 Ga0070684_100000002 3300005535 Bacteria 257669
88 Ga0070684_100016895 3300005535 Bacteria 5976
89 Ga0070697_100013036 3300005536 Bacteria 6516
90 Ga0070697_100013213 3300005536 Bacteria 6473
91 Ga0070697_100318773 3300005536 Bacteria 1338
92 Ga0068853_100000464 3300005539 Bacteria 27728
93 Ga0068853_100001128 3300005539 Bacteria 18922
94 Ga0068853_100011434 3300005539 Bacteria 7212
95 Ga0068853_100073632 3300005539 Bacteria 2979
96 Ga0068853_100084650 3300005539 Bacteria 2779
97 Ga0068853_100281836 3300005539 Bacteria 1532
98 Ga0068853_100548759 3300005539 Unclassified 1095
99 Ga0070672_100021776 3300005543 Bacteria 4695
100 Ga0070696_100012720 3300005546 Bacteria 5652
101 Ga0070696_100469541 3300005546 Bacteria 996
102 Ga0070693_100007359 3300005547 Bacteria 5379
103 Ga0070665_100000918 3300005548 Bacteria 37791
104 Ga0070665_100018880 3300005548 Bacteria 6915
105 Ga0070665_100124781 3300005548 Bacteria 2577
106 Ga0070704_100011412 3300005549 Bacteria 5446
107 Ga0068855_100002442 3300005563 Bacteria 22946
108 Ga0068855_100003189 3300005563 Bacteria 20091
109 Ga0068855_100020104 3300005563 Bacteria 8018
110 Ga0068855_100072726 3300005563 Bacteria 3995
111 Ga0068855_100074626 3300005563 Bacteria 3938
112 Ga0068855_100119528 3300005563 Bacteria 3017
113 Ga0068855_100230718 3300005563 Bacteria 2073
114 Ga0068855_100559090 3300005563 Unclassified 1238
115 Ga0068855_100602183 3300005563 Unclassified 1185
116 Ga0070664_100006730 3300005564 Bacteria 9264
117 Ga0070664_100231162 3300005564 Bacteria 1657
118 Ga0070664_100469749 3300005564 Unclassified 1156
119 Ga0068857_100042707 3300005577 Bacteria 4022
120 Ga0068857_100046601 3300005577 Bacteria 3847
121 Ga0068857_100102908 3300005577 Bacteria 2564
122 Ga0068854_100000003 3300005578 Bacteria 330045
123 Ga0068854_100002113 3300005578 Bacteria 12178
124 Ga0068854_100004181 3300005578 Bacteria 9084
125 Ga0068854_100161759 3300005578 Bacteria 1734
126 Ga0068854_100494323 3300005578 Bacteria 1029
127 Ga0068856_100002181 3300005614 Bacteria 20302
128 Ga0068856_100011264 3300005614 Bacteria 8680
129 Ga0068856_100018356 3300005614 Bacteria 6779
130 Ga0068856_100022060 3300005614 Bacteria 6191
131 Ga0068856_100029012 3300005614 Bacteria 5406
132 Ga0068856_100092143 3300005614 Bacteria 3015
133 Ga0068856_100111328 3300005614 Bacteria 2735
134 Ga0068856_100166330 3300005614 Bacteria 2216
135 Ga0068856_100312505 3300005614 Bacteria 1589
136 Ga0068856_100327532 3300005614 Bacteria 1549
137 Ga0068856_100540194 3300005614 Bacteria 1187
138 Ga0068852_100000032 3300005616 Bacteria 102480
139 Ga0068852_100000199 3300005616 Bacteria 40929
140 Ga0068852_100065221 3300005616 Bacteria 3176
141 Ga0068852_100083891 3300005616 Unclassified 2834
142 Ga0068852_100494862 3300005616 Bacteria 1217
143 Ga0068852_100535218 3300005616 Bacteria 1170
144 Ga0068859_100002369 3300005617 Bacteria 19177
145 Ga0068859_100020434 3300005617 Bacteria 6645
146 Ga0068859_100332786 3300005617 Bacteria 1613
147 Ga0068859_100434397 3300005617 Unclassified 1409
148 Ga0068859_100489876 3300005617 Bacteria 1325
149 Ga0068864_100002900 3300005618 Bacteria 14176
150 Ga0068864_100018903 3300005618 Bacteria 5761
151 Ga0068866_10126563 3300005718 Unclassified 1447
152 Ga0068861_100077420 3300005719 Bacteria 2594
153 Ga0068851_10090688 3300005834 Unclassified 1608
154 Ga0068863_100029216 3300005841 Bacteria 5264
155 Ga0068863_100066822 3300005841 Bacteria 3401
156 Ga0068863_100086118 3300005841 Bacteria 2977
157 Ga0068858_100001259 3300005842 Bacteria 26209
158 Ga0068858_100001498 3300005842 Bacteria 24088
159 Ga0068858_100176902 3300005842 Unclassified 2014
160 Ga0068858_100339292 3300005842 Unclassified 1438
161 Ga0068862_100170424 3300005844 Bacteria 1949
162 Ga0081455_10039483 3300005937 Unclassified 4170
163 Ga0081455_10055778 3300005937 Bacteria 3359
164 Ga0070717_10000582 3300006028 Bacteria 23306
165 Ga0070717_10003870 3300006028 Viruses 10763
166 Ga0070717_10005337 3300006028 Bacteria 9369
167 Ga0070716_100013778 3300006173 Bacteria 4129
168 Ga0070716_100135434 3300006173 Unclassified 1563
169 Ga0070712_100002219 3300006175 Bacteria 11949
170 Ga0097621_100015795 3300006237 Bacteria 5692
171 Ga0097621_100046311 3300006237 Unclassified 3519
172 Ga0097621_100107116 3300006237 Unclassified 2358
173 Ga0097621_100161562 3300006237 Bacteria 1926
174 Ga0068871_100048371 3300006358 Unclassified 3433
175 Ga0068871_100107333 3300006358 Bacteria 2345
176 Ga0068871_100339484 3300006358 Bacteria 1326
177 Ga0075430_100303111 3300006846 Bacteria 1321
178 Ga0075431_100067137 3300006847 Bacteria 3702
179 Ga0075433_10002750 3300006852 Bacteria 13457
180 Ga0075433_10020438 3300006852 Bacteria 5536
181 Ga0075434_100034834 3300006871 Bacteria 4974
182 Ga0068865_100031172 3300006881 Bacteria 3553
183 Ga0068865_100118821 3300006881 Bacteria 1962
184 Ga0075436_100004130 3300006914 Bacteria 9961
185 Ga0075436_100009950 3300006914 Bacteria 6505
186 Ga0075436_100251254 3300006914 Bacteria 1259
187 Ga0097620_100002369 3300006931 Bacteria 19177
188 Ga0097620_100020434 3300006931 Bacteria 6645
189 Ga0097620_100332784 3300006931 Bacteria 1613
190 Ga0097620_100434453 3300006931 Unclassified 1409
191 Ga0097620_100489893 3300006931 Bacteria 1325
192 Ga0075435_100104544 3300007076 Bacteria 2349
193 Ga0075435_100190720 3300007076 Unclassified 1735
194 Ga0075435_100315346 3300007076 Bacteria 1338
195 Ga0099794_10031748 3300007265 Bacteria 2475
196 Ga0099794_10209153 3300007265 Bacteria 1000
197 Ga0105240_10000001 3300009093 Bacteria 2887840
198 Ga0105240_10000135 3300009093 Bacteria 151432
199 Ga0105240_10017310 3300009093 Bacteria 9717
200 Ga0105240_10020798 3300009093 Bacteria 8741
201 Ga0105240_10031912 3300009093 Bacteria 6826
202 Ga0105240_10054690 3300009093 Bacteria 5001
203 Ga0105240_10076260 3300009093 Unclassified 4133
204 Ga0105240_10085141 3300009093 Bacteria 3874
205 Ga0105240_10125112 3300009093 Bacteria 3091
206 Ga0105240_10195396 3300009093 Bacteria 2376
207 Ga0105240_10225424 3300009093 Bacteria 2181
208 Ga0105240_10921485 3300009093 Bacteria 939
209 Ga0111539_10005961 3300009094 Bacteria 15739
210 Ga0105245_10020916 3300009098 Bacteria 5736
211 Ga0105245_10043376 3300009098 Unclassified 4012
212 Ga0105245_10067429 3300009098 Bacteria 3241
213 Ga0105245_10161177 3300009098 Bacteria 2129
214 Ga0105243_10116909 3300009148 Bacteria 2241
215 Ga0105241_10081792 3300009174 Bacteria 2531
216 Ga0105241_10361780 3300009174 Bacteria 1263
217 Ga0105248_10000319 3300009177 Bacteria 56800
218 Ga0105248_10001668 3300009177 Bacteria 24702
219 Ga0105248_10013472 3300009177 Bacteria 9004
220 Ga0105248_10074437 3300009177 Bacteria 3817
221 Ga0105248_10104724 3300009177 Bacteria 3190
222 Ga0105248_10210392 3300009177 Bacteria 2191
223 Ga0105237_10014461 3300009545 Bacteria 8250
224 Ga0105237_10071127 3300009545 Unclassified 3474
225 Ga0105237_10191985 3300009545 Bacteria 2042
226 Ga0105238_10000726 3300009551 Bacteria 34413
227 Ga0105238_10023719 3300009551 Bacteria 6253
228 Ga0105238_10110247 3300009551 Bacteria 2733
229 Ga0105238_10165817 3300009551 Bacteria 2185
230 Ga0105238_10505285 3300009551 Unclassified 1210
231 Ga0105249_10174381 3300009553 Unclassified 2087
232 Ga0105239_10002093 3300010375 Bacteria 25850
233 Ga0105239_10058528 3300010375 Bacteria 4229
234 Ga0105239_10079970 3300010375 Bacteria 3597
235 Ga0105239_10248459 3300010375 Unclassified 1998
236 Ga0105239_10525020 3300010375 Bacteria 1347
237 Ga0105246_10005875 3300011119 Bacteria 7487
238 Ga0157373_10021622 3300013100 Bacteria 4670
239 Ga0157373_10128449 3300013100 Unclassified 1782
240 Ga0157370_10000023 3300013104 Bacteria 161359
241 Ga0157370_10027433 3300013104 Bacteria 5614
242 Ga0157370_10044595 3300013104 Bacteria 4260
243 Ga0157370_10047287 3300013104 Bacteria 4125
244 Ga0157370_10060654 3300013104 Bacteria 3591
245 Ga0157370_10090725 3300013104 Bacteria 2869
246 Ga0157370_10315182 3300013104 Bacteria 1443
247 Ga0157369_10000010 3300013105 Bacteria 273443
248 Ga0157369_10001298 3300013105 Bacteria 31051
249 Ga0157369_10002224 3300013105 Bacteria 23356
250 Ga0157369_10010557 3300013105 Bacteria 10509
251 Ga0157369_10013277 3300013105 Bacteria 9321
252 Ga0157369_10014377 3300013105 Bacteria 8938
253 Ga0157369_10029511 3300013105 Bacteria 6060
254 Ga0157369_10032611 3300013105 Bacteria 5727
255 Ga0157369_10103507 3300013105 Unclassified 3033
256 Ga0157369_10129140 3300013105 Bacteria 2679
257 Ga0157369_10305573 3300013105 Bacteria 1654
258 Ga0157369_10336572 3300013105 Bacteria 1568
259 Ga0157374_10011786 3300013296 Bacteria 7585
260 Ga0157374_10016789 3300013296 Bacteria 6441
261 Ga0157374_10017924 3300013296 Bacteria 6240
262 Ga0157374_10043305 3300013296 Bacteria 4158
263 Ga0157374_10057426 3300013296 Bacteria 3635
264 Ga0157374_10058451 3300013296 Bacteria 3603
265 Ga0157374_10070498 3300013296 Bacteria 3294
266 Ga0157374_10119638 3300013296 Bacteria 2540
267 Ga0157374_10517090 3300013296 Bacteria 1199
268 Ga0157378_10000263 3300013297 Bacteria 51475
269 Ga0157378_10002951 3300013297 Bacteria 15127
270 Ga0157378_10070302 3300013297 Unclassified 3142
271 Ga0157378_10071073 3300013297 Bacteria 3125
272 Ga0157378_10110347 3300013297 Bacteria 2521
273 Ga0157378_10262987 3300013297 Unclassified 1656
274 Ga0163162_10038339 3300013306 Bacteria 4782
275 Ga0163162_10043586 3300013306 Bacteria 4493
276 Ga0163162_10063172 3300013306 Bacteria 3744
277 Ga0157372_10000055 3300013307 Bacteria 126308
278 Ga0157372_10000982 3300013307 Bacteria 31143
279 Ga0157372_10002405 3300013307 Bacteria 20274
280 Ga0157372_10005506 3300013307 Bacteria 13460
281 Ga0157372_10023742 3300013307 Bacteria 6652
282 Ga0157372_10042665 3300013307 Bacteria 5019
283 Ga0157372_10048425 3300013307 Bacteria 4725
284 Ga0157372_10064666 3300013307 Bacteria 4104
285 Ga0157372_10080653 3300013307 Bacteria 3683
286 Ga0157372_10117245 3300013307 Unclassified 3054
287 Ga0157372_10134615 3300013307 Bacteria 2845
288 Ga0157372_10142527 3300013307 Unclassified 2762
289 Ga0157372_10200053 3300013307 Unclassified 2314
290 Ga0157372_10252388 3300013307 Bacteria 2048
291 Ga0157372_10316871 3300013307 Bacteria 1816
292 Ga0157372_10345843 3300013307 Bacteria 1733
293 Ga0157375_10070316 3300013308 Bacteria 3510
294 Ga0157375_10098750 3300013308 Bacteria 2997
295 Ga0157375_10187695 3300013308 Bacteria 2221
296 Ga0157375_10473362 3300013308 Bacteria 1418
297 Ga0163163_10022326 3300014325 Bacteria 5989
298 Ga0163163_10132651 3300014325 Bacteria 2531
299 Ga0157379_10030324 3300014968 Bacteria 4813
300 Ga0157379_10174706 3300014968 Bacteria 1939
301 Ga0157376_10000041 3300014969 Bacteria 120988
302 Ga0157376_10023861 3300014969 Bacteria 4795
303 Ga0157376_10042803 3300014969 Bacteria 3713
304 Ga0157376_10044463 3300014969 Bacteria 3651
305 Ga0157376_10805989 3300014969 Bacteria 952
306 Ga0163161_10055232 3300017792 Bacteria 2883
307 Ga0197907_10130176 3300020069 Bacteria 1112
308 Ga0197907_10200061 3300020069 Bacteria 1372
309 Ga0206356_10197226 3300020070 Bacteria 1029
310 Ga0206355_1393545 3300020076 Bacteria 970
311 Ga0206355_1640260 3300020076 Bacteria 1747
312 Ga0206351_10618912 3300020077 Bacteria 1135
313 Ga0206352_10915830 3300020078 Bacteria 1118
314 Ga0206350_11571727 3300020080 Bacteria 2170
315 Ga0206353_12047086 3300020082 Unclassified 1045
316 Ga0154015_1398831 3300020610 Unclassified 1833
317 Ga0213872_10003517 3300021361 Bacteria 8657
318 Ga0213872_10024260 3300021361 Unclassified 2789
319 Ga0213872_10039843 3300021361 Bacteria 2144
320 Ga0213872_10063524 3300021361 Unclassified 1668
321 Ga0213875_10000017 3300021388 Bacteria 239813
322 Ga0213875_10012867 3300021388 Bacteria 4123
323 Ga0213875_10076329 3300021388 Bacteria 1564
324 Ga0213871_10038393 3300021441 Bacteria 1278
325 Ga0224712_10077080 3300022467 Bacteria 1367
326 Ga0224712_10128408 3300022467 Bacteria 1105
327 Ga0224712_10191885 3300022467 Bacteria 925
328 Ga0224712_10202143 3300022467 Bacteria 903
329 Ga0228598_1011194 3300024227 Bacteria 1786
330 Ga0207656_10050977 3300025321 Bacteria 1789
331 Ga0207653_10008013 3300025885 Bacteria 3292
332 Ga0207692_10014933 3300025898 Bacteria 3405
333 Ga0207680_10166360 3300025903 Bacteria 1482
334 Ga0207647_10003063 3300025904 Bacteria 12562
335 Ga0207647_10013832 3300025904 Bacteria 5588
336 Ga0207647_10025602 3300025904 Bacteria 3873
337 Ga0207647_10027843 3300025904 Bacteria 3680
338 Ga0207699_10285433 3300025906 Unclassified 1148
339 Ga0207643_10019835 3300025908 Bacteria 3685
340 Ga0207705_10003727 3300025909 Bacteria 11601
341 Ga0207705_10030086 3300025909 Bacteria 3873
342 Ga0207705_10031987 3300025909 Bacteria 3758
343 Ga0207705_10228848 3300025909 Unclassified 1414
344 Ga0207705_10340632 3300025909 Bacteria 1154
345 Ga0207684_10001901 3300025910 Bacteria 21698
346 Ga0207684_10015475 3300025910 Bacteria 6563
347 Ga0207684_10040662 3300025910 Unclassified 3941
348 Ga0207684_10044538 3300025910 Bacteria 3763
349 Ga0207654_10000350 3300025911 Bacteria 27453
350 Ga0207654_10083341 3300025911 Bacteria 1930
351 Ga0207707_10016653 3300025912 Bacteria 6407
352 Ga0207707_10058238 3300025912 Bacteria 3362
353 Ga0207707_10061328 3300025912 Bacteria 3272
354 Ga0207707_10090259 3300025912 Bacteria 2678
355 Ga0207707_10101603 3300025912 Unclassified 2513
356 Ga0207707_10288165 3300025912 Bacteria 1421
357 Ga0207695_10000001 3300025913 Bacteria 2888630
358 Ga0207695_10000050 3300025913 Bacteria 405727
359 Ga0207695_10000177 3300025913 Bacteria 185955
360 Ga0207695_10000188 3300025913 Bacteria 178721
361 Ga0207695_10000787 3300025913 Bacteria 59756
362 Ga0207695_10023116 3300025913 Bacteria 7035
363 Ga0207695_10057750 3300025913 Bacteria 4031
364 Ga0207695_10057769 3300025913 Bacteria 4030
365 Ga0207695_10084966 3300025913 Bacteria 3194
366 Ga0207695_10129495 3300025913 Bacteria 2482
367 Ga0207695_10329851 3300025913 Bacteria 1415
368 Ga0207671_10000324 3300025914 Bacteria 70145
369 Ga0207671_10027024 3300025914 Bacteria 4293
370 Ga0207671_10051647 3300025914 Bacteria 3047
371 Ga0207671_10059752 3300025914 Bacteria 2827
372 Ga0207671_10092267 3300025914 Bacteria 2283
373 Ga0207671_10100994 3300025914 Bacteria 2185
374 Ga0207671_10245443 3300025914 Bacteria 1407
375 Ga0207693_10002318 3300025915 Bacteria 16545
376 Ga0207693_10047808 3300025915 Bacteria 3361
377 Ga0207693_10208619 3300025915 Bacteria 1536
378 Ga0207663_10000716 3300025916 Bacteria 14786
379 Ga0207660_10014861 3300025917 Bacteria 5131
380 Ga0207660_10340310 3300025917 Bacteria 1201
381 Ga0207657_10001188 3300025919 Bacteria 27666
382 Ga0207657_10039381 3300025919 Bacteria 4201
383 Ga0207657_10107113 3300025919 Bacteria 2312
384 Ga0207657_10233532 3300025919 Bacteria 1470
385 Ga0207649_10041209 3300025920 Bacteria 2810
386 Ga0207649_10158915 3300025920 Unclassified 1564
387 Ga0207649_10214116 3300025920 Bacteria 1368
388 Ga0207652_10019678 3300025921 Bacteria 5554
389 Ga0207652_10175829 3300025921 Bacteria 1923
390 Ga0207652_10587535 3300025921 Bacteria 999
391 Ga0207646_10075160 3300025922 Unclassified 3019
392 Ga0207646_10239272 3300025922 Bacteria 1640
393 Ga0207694_10000083 3300025924 Bacteria 109611
394 Ga0207694_10013782 3300025924 Bacteria 6094
395 Ga0207694_10014157 3300025924 Bacteria 6014
396 Ga0207694_10082987 3300025924 Bacteria 2519
397 Ga0207659_10427694 3300025926 Unclassified 1111
398 Ga0207687_10041781 3300025927 Bacteria 3151
399 Ga0207687_10274703 3300025927 Bacteria 1348
400 Ga0207700_10034308 3300025928 Bacteria 3642
401 Ga0207664_10053848 3300025929 Unclassified 3187
402 Ga0207664_10152319 3300025929 Bacteria 1965
403 Ga0207664_10185904 3300025929 Bacteria 1786
404 Ga0207644_10019102 3300025931 Bacteria 4646
405 Ga0207690_10003397 3300025932 Bacteria 9510
406 Ga0207690_10020087 3300025932 Bacteria 4122
407 Ga0207706_10021352 3300025933 Bacteria 5817
408 Ga0207686_10103748 3300025934 Unclassified 1903
409 Ga0207709_10063461 3300025935 Bacteria 2315
410 Ga0207704_10145718 3300025938 Unclassified 1663
411 Ga0207665_10001965 3300025939 Bacteria 13839
412 Ga0207665_10006036 3300025939 Bacteria 8048
413 Ga0207665_10014502 3300025939 Bacteria 5191
414 Ga0207665_10271740 3300025939 Unclassified 1259
415 Ga0207711_10000225 3300025941 Bacteria 60644
416 Ga0207711_10015831 3300025941 Bacteria 6256
417 Ga0207711_10061798 3300025941 Bacteria 3230
418 Ga0207711_10062341 3300025941 Bacteria 3216
419 Ga0207711_10667878 3300025941 Bacteria 969
420 Ga0207689_10036312 3300025942 Bacteria 4092
421 Ga0207689_10144450 3300025942 Bacteria 1960
422 Ga0207661_10000008 3300025944 Bacteria 451211
423 Ga0207661_10019594 3300025944 Bacteria 5047
424 Ga0207661_10065336 3300025944 Bacteria 2953
425 Ga0207661_10120618 3300025944 Bacteria 2232
426 Ga0207661_10296383 3300025944 Bacteria 1449
427 Ga0207679_10037403 3300025945 Bacteria 3450
428 Ga0207667_10000251 3300025949 Bacteria 75691
429 Ga0207667_10003852 3300025949 Bacteria 18451
430 Ga0207667_10021968 3300025949 Bacteria 7062
431 Ga0207667_10022480 3300025949 Bacteria 6966
432 Ga0207667_10041383 3300025949 Bacteria 4901
433 Ga0207667_10114593 3300025949 Bacteria 2778
434 Ga0207667_10240988 3300025949 Bacteria 1851
435 Ga0207667_10270016 3300025949 Bacteria 1739
436 Ga0207667_10356585 3300025949 Unclassified 1491
437 Ga0207667_10433034 3300025949 Bacteria 1337
438 Ga0207667_10469016 3300025949 Unclassified 1278
439 Ga0207668_10252083 3300025972 Bacteria 1434
440 Ga0207640_10000002 3300025981 Bacteria 524211
441 Ga0207640_10030970 3300025981 Bacteria 3301
442 Ga0207640_10159441 3300025981 Unclassified 1667
443 Ga0207640_10333582 3300025981 Bacteria 1212
444 Ga0207677_10006069 3300026023 Bacteria 6591
445 Ga0207677_10085924 3300026023 Bacteria 2272
446 Ga0207677_10128172 3300026023 Unclassified 1921
447 Ga0207677_10370796 3300026023 Bacteria 1205
448 Ga0207677_10595188 3300026023 Bacteria 970
449 Ga0207703_10001373 3300026035 Bacteria 22244
450 Ga0207703_10210257 3300026035 Unclassified 1734
451 Ga0207639_10000011 3300026041 Bacteria 381897
452 Ga0207639_10000027 3300026041 Bacteria 197829
453 Ga0207639_10078842 3300026041 Bacteria 2601
454 Ga0207639_10112542 3300026041 Unclassified 2221
455 Ga0207678_10000939 3300026067 Bacteria 26562
456 Ga0207678_10001450 3300026067 Bacteria 21798
457 Ga0207678_10002208 3300026067 Bacteria 17582
458 Ga0207678_10103054 3300026067 Bacteria 2436
459 Ga0207678_10119063 3300026067 Bacteria 2253
460 Ga0207678_10195653 3300026067 Bacteria 1728
461 Ga0207702_10001494 3300026078 Bacteria 23124
462 Ga0207702_10001578 3300026078 Bacteria 22564
463 Ga0207702_10012061 3300026078 Bacteria 7187
464 Ga0207702_10185384 3300026078 Bacteria 1919
465 Ga0207702_10383903 3300026078 Bacteria 1351
466 Ga0207702_10479433 3300026078 Bacteria 1210
467 Ga0207641_10031687 3300026088 Unclassified 4385
468 Ga0207641_10033103 3300026088 Bacteria 4294
469 Ga0207641_10054514 3300026088 Bacteria 3393
470 Ga0207641_10207608 3300026088 Bacteria 1810
471 Ga0207641_10248438 3300026088 Bacteria 1660
472 Ga0207648_10014946 3300026089 Bacteria 7153
473 Ga0207648_10026270 3300026089 Bacteria 5176
474 Ga0207648_10435950 3300026089 Bacteria 1191
475 Ga0207676_10096187 3300026095 Bacteria 2444
476 Ga0207676_10107474 3300026095 Bacteria 2327
477 Ga0207676_10236698 3300026095 Bacteria 1635
478 Ga0207674_10000560 3300026116 Bacteria 48628
479 Ga0207674_10001500 3300026116 Bacteria 30118
480 Ga0207674_10013356 3300026116 Bacteria 9117
481 Ga0207674_10523908 3300026116 Bacteria 1145
482 Ga0207683_10007557 3300026121 Bacteria 9314
483 Ga0207698_10000008 3300026142 Bacteria 281991
484 Ga0207698_10000237 3300026142 Bacteria 34479
485 Ga0207698_10122389 3300026142 Bacteria 2205
486 Ga0207698_10207725 3300026142 Bacteria 1759
487 Ga0209588_1012353 3300027671 Bacteria 2592
488 Ga0207428_10041838 3300027907 Bacteria 3708
489 Ga0268266_10000144 3300028379 Bacteria 135508
490 Ga0268266_10016406 3300028379 Bacteria 6332
491 Ga0268266_10092298 3300028379 Bacteria 2656
492 Ga0268266_10283844 3300028379 Unclassified 1540
493 Ga0268266_10392128 3300028379 Bacteria 1311
494 Ga0268265_10182032 3300028380 Bacteria 1806
495 Ga0268264_10006871 3300028381 Bacteria 9551
496 Ga0268264_10049888 3300028381 Bacteria 3484
497 Ga0265338_10189767 3300028800 Unclassified 1559
498 Ga0265328_10050767 3300031239 Unclassified 1523
499 Ga0265339_10000694 3300031249 Bacteria 26062
500 Ga0265313_10116693 3300031595 Unclassified 1168
501 Ga0307413_10152124 3300031824 Eukaryota 1614
502 Ga0307510_10057547 3300033180 Bacteria 4034
503 Ga0307510_10090625 3300033180 Bacteria 2903
504 Ga0307510_10198442 3300033180 Bacteria 1545
505 Ga0373926_0004932 3300035083 Bacteria 4382
506 Ga0373946_0019411 3300035171 Unclassified 2619
507 Ga0373927_0003524 3300035695 Bacteria 11200
508 Ga0373927_0068300 3300035695 Unclassified 2300
509 Ga0373947_0006601 3300035725 Bacteria 6734
510 Ga0373937_0013743 3300036401 Bacteria 7134
511 Ga0373937_0495471 3300036401 Unclassified 1161
512 Ga0373925_0004006 3300037068 Bacteria 11208
513 Ga0395900_0096834 3300037418 Bacteria 3032
514 Ga0395898_0026273 3300037466 Bacteria 5861
515 Ga0395898_0514315 3300037466 Bacteria 1138
516 Ga0436364_0074911 3300037853 Bacteria 2024
517 Ga0436364_0103870 3300037853 Bacteria 1759
518 Ga0436364_0339530 3300037853 Bacteria 240640
519 Ga0436364_0609851 3300037853 Bacteria 5444
520 Ga0436364_0787170 3300037853 Bacteria 16621
521 Ga0436364_0814149 3300037853 Bacteria 1378
522 Ga0436364_0880534 3300037853 Bacteria 127762
523 Ga0436364_1041147 3300037853 Unclassified 2890
524 Ga0436365_0894537 3300039437 Bacteria 3691
525 Ga0436365_0960146 3300039437 Bacteria 4727
526 Ga0436365_1584098 3300039437 Bacteria 3527
527 Ga0436360_0111215 3300039438 Bacteria 8281
528 Ga0436360_0654204 3300039438 Bacteria 2128
529 Ga0436360_0673809 3300039438 Unclassified 2750
530 Ga0436360_1304700 3300039438 Bacteria 20254
531 Ga0436361_0070516 3300039447 Bacteria 11016
532 Ga0436361_0195153 3300039447 Bacteria 2318
533 Ga0436361_0248901 3300039447 Bacteria 25197
534 Ga0436361_0539608 3300039447 Bacteria 3865
535 Ga0436361_0761235 3300039447 Bacteria 90297
536 Ga0436363_0226217 3300039450 Bacteria 903
537 Ga0436363_1398555 3300039450 Bacteria 2225
538 Ga0436362_0626017 3300039453 Bacteria 2784
539 Ga0439448_0006572 3300042005 Unclassified 3348
540 Ga0451577_0204118 3300042876 Unclassified 1784
541 Ga0466966_0025506 3300044684 Bacteria 3860
542 Ga0466964_0024177 3300044706 Bacteria 2366
543 Ga0453684_0337075 3300044712 Unclassified 1704
544 Ga0451576_0062811 3300045051 Bacteria 3871
545 Ga0466967_0463958 3300045976 Bacteria 1239
546 Ga0466967_0486052 3300045976 Bacteria 1210
547 Ga0495603_0001049 3300046455 Bacteria 15997
548 Ga0495629_0040041 3300046459 Bacteria 3297
549 Ga0495629_0046247 3300046459 Bacteria 3053
550 Ga0495651_0000991 3300046462 Bacteria 22040
551 Ga0495651_0082688 3300046462 Bacteria 2423
552 Ga0495650_0001419 3300046471 Bacteria 23297
553 Ga0495580_0046668 3300046472 Bacteria 3073
554 Ga0495580_0058448 3300046472 Bacteria 2712
555 Ga0495580_0271764 3300046472 Archaea 1157
556 Ga0495582_0000192 3300046473 Bacteria 33815
557 Ga0495582_0002882 3300046473 Bacteria 9615
558 Ga0495662_0001218 3300046476 Bacteria 12657
559 Ga0495664_0007921 3300046477 Bacteria 5914
560 Ga0495594_0000311 3300046499 Bacteria 23929
561 Ga0495594_0007732 3300046499 Bacteria 5528
562 Ga0495583_0040724 3300046506 Bacteria 2180
563 Ga0495606_0176823 3300046507 Bacteria 1234
564 Ga0495618_0133075 3300046514 Bacteria 1591
565 Ga0495618_0290983 3300046514 Bacteria 1017
566 Ga0495628_0164220 3300046516 Bacteria 1686
567 Ga0495644_0001019 3300046523 Bacteria 11688
568 Ga0495666_0002474 3300046526 Bacteria 9179
569 Ga0495642_0120638 3300046528 Bacteria 1125
570 Ga0495640_0014874 3300046533 Bacteria 5870
571 Ga0495587_0098916 3300046536 Bacteria 1682
572 Ga0495587_0173080 3300046536 Bacteria 1226
573 Ga0495609_0008328 3300046538 Bacteria 5082
574 Ga0495645_0016767 3300046543 Bacteria 5240
575 Ga0495622_0040610 3300046557 Bacteria 2165
576 Ga0495633_0012427 3300046558 Bacteria 4529
577 Ga0495634_0001013 3300046642 Bacteria 26400
578 Ga0495625_0002508 3300046660 Bacteria 19770
579 Ga0495625_0017649 3300046660 Bacteria 5585
580 Ga0495625_0158440 3300046660 Bacteria 1518
581 Ga0495599_0001904 3300046678 Bacteria 12082
582 Ga0495658_0001341 3300046683 Bacteria 12919
583 Ga0495669_0003529 3300046684 Bacteria 6453
584 Ga0495613_0002687 3300046689 Bacteria 13349
585 Ga0495613_0005291 3300046689 Bacteria 9694
586 Ga0495624_0003225 3300046690 Bacteria 12159
587 Ga0495671_0133217 3300046692 Bacteria 1212
588 Ga0495649_0078066 3300046694 Bacteria 1772
589 Ga0495649_0232175 3300046694 Bacteria 952
590 Ga0495600_0079203 3300046809 Bacteria 2145
591 Ga0495581_0001414 3300047315 Bacteria 13303
592 Ga0495674_0106197 3300047319 Bacteria 2385
593 Ga0495676_0000384 3300047321 Bacteria 35933
594 Ga0495676_0134384 3300047321 Unclassified 1781
595 Ga0495683_0093917 3300047323 Bacteria 1450
596 Ga0495675_0002097 3300047444 Bacteria 11889
597 Ga0495679_063778 3300047446 Bacteria 1075
598 Ga0495614_0000029 3300048089 Bacteria 41379
599 Ga0496105_0015591 3300048908 Bacteria 6060
600 Ga0496112_0103579 3300048915 Bacteria 2816
601 Ga0496114_0008141 3300048917 Bacteria 8306
602 Ga0496115_0036296 3300048918 Bacteria 3902
603 Ga0496126_0000187 3300048929 Bacteria 139670
604 Ga0496126_0000333 3300048929 Bacteria 100416
605 Ga0496126_0002227 3300048929 Bacteria 26819
606 Ga0496126_0102647 3300048929 Unclassified 2500
607 Ga0495682_0004897 3300049460 Bacteria 5641
608 Ga0501031_0063959 3300049568 Bacteria 2396
609 Ga0501032_0000623 3300049569 Bacteria 28778
610 Ga0501034_0006263 3300049571 Bacteria 12801
611 Ga0501034_0036896 3300049571 Bacteria 4949
612 Ga0501036_0027879 3300049572 Bacteria 4774
613 Ga0501037_0017055 3300049573 Bacteria 5342
614 Ga0501038_0043408 3300049574 Bacteria 3909
615 Ga0501038_0082067 3300049574 Bacteria 2715
616 Ga0501043_0005499 3300049579 Bacteria 10233
617 Ga0501043_0009525 3300049579 Bacteria 7613
618 Ga0501046_0005952 3300049580 Bacteria 10859
619 Ga0501046_0069161 3300049580 Bacteria 2748
620 Ga0501047_0076345 3300049581 Bacteria 3224
621 Ga0501048_0118252 3300049582 Bacteria 1872
622 Ga0501048_0316619 3300049582 Unclassified 1111
623 Ga0501067_0108586 3300049583 Bacteria 1542
624 Ga0501068_0000526 3300049584 Bacteria 19398
625 Ga0501069_0000364 3300049585 Bacteria 20387
626 Ga0501070_0011024 3300049586 Bacteria 7630
627 Ga0501070_0107489 3300049586 Unclassified 2306
628 Ga0501072_0000479 3300049588 Bacteria 28715
629 Ga0501073_0000613 3300049589 Bacteria 25120
630 Ga0501073_0232615 3300049589 Bacteria 1273
631 Ga0501079_0005764 3300049741 Bacteria 9258
632 Ga0501080_0000055 3300049742 Bacteria 72931
633 Ga0501080_0340684 3300049742 Unclassified 1355
634 Ga0501083_0089591 3300049744 Bacteria 2032
635 Ga0501035_0034854 3300049822 Bacteria 4572
636 Ga0501035_0222351 3300049822 Bacteria 1611
637 Ga0501044_0030201 3300049823 Bacteria 5712
638 Ga0501044_0113587 3300049823 Unclassified 2715
639 nmdc:mga05p37_404163_c1 3300050507 Bacteria 1594
640 nmdc:mga0qj67_162642_c1 3300050509 Bacteria 1812
641 nmdc:mga08y16_60202_c1 3300050511 Bacteria 3967
642 nmdc:mga0n895_11278_c1 3300050512 Bacteria 7964
643 nmdc:mga08x19_10818_c1 3300050514 Bacteria 5487
644 nmdc:mga08x19_188_c1 3300050514 Bacteria 49158
645 nmdc:mga08x19_7537_c1 3300050514 Bacteria 6467
646 nmdc:mga0a205_10484_c1 3300050515 Bacteria 8515
647 Ga0495601_0021998 3300053077 Bacteria 3911
648 Ga0495612_0032994 3300053078 Bacteria 2094
649 Ga0500644_0016613 3300053088 Unclassified 2121
650 Ga0500651_0000007 3300053093 Bacteria 295019
651 Ga0500595_035608 3300053119 Unclassified 1637
652 Ga0501084_0001465 3300054114 Bacteria 18734
653 Ga0500661_000345 3300055283 Bacteria 8445
654 Ga0587088_019594 3300059508 Bacteria 1114
655 Ga0587092_016174 3300059512 Bacteria 1102
656 Ga0587067_015700 3300059640 Bacteria 1232
657 Ga0501082_0000192 3300060353 Bacteria 52678
658 Ga0501082_0012178 3300060353 Bacteria 7389

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021441 Ga0213871_10038393 Ga0213871_100383932 272
2 iso_pu_bacteria 2977232053 2977233308 276
3 3300005564 Ga0070664_100231162 Ga0070664_1002311621 277
4 3300013105 Ga0157369_10010557 Ga0157369_100105576 278
5 3300028379 Ga0268266_10283844 Ga0268266_102838442 279
6 3300033180 Ga0307510_10198442 Ga0307510_101984423 279
7 iso_pu_bacteria 2884215851 2884219309 279
8 3300009093 Ga0105240_10225424 Ga0105240_102254242 280
9 3300009545 Ga0105237_10071127 Ga0105237_100711274 280
10 3300025913 Ga0207695_10057769 Ga0207695_100577691 280
11 3300049568 Ga0501031_0063959 Ga0501031_0063959_218_1066 280
12 3300049569 Ga0501032_0000623 Ga0501032_0000623_16824_17672 280
13 3300049571 Ga0501034_0036896 Ga0501034_0036896_2655_3503 280
14 3300049572 Ga0501036_0027879 Ga0501036_0027879_603_1451 280
15 3300049573 Ga0501037_0017055 Ga0501037_0017055_4328_5176 280
16 3300049574 Ga0501038_0043408 Ga0501038_0043408_2767_3615 280
17 3300049579 Ga0501043_0005499 Ga0501043_0005499_4632_5480 280
18 3300049580 Ga0501046_0005952 Ga0501046_0005952_603_1451 280
19 3300049581 Ga0501047_0076345 Ga0501047_0076345_2210_3058 280
20 3300049582 Ga0501048_0118252 Ga0501048_0118252_42_890 280
21 3300049583 Ga0501067_0108586 Ga0501067_0108586_604_1452 280
22 3300049584 Ga0501068_0000526 Ga0501068_0000526_15133_15981 280
23 3300049585 Ga0501069_0000364 Ga0501069_0000364_16451_17299 280
24 3300049588 Ga0501072_0000479 Ga0501072_0000479_14990_15838 280
25 3300049589 Ga0501073_0000613 Ga0501073_0000613_3324_4172 280
26 3300049741 Ga0501079_0005764 Ga0501079_0005764_3907_4755 280
27 3300049742 Ga0501080_0000055 Ga0501080_0000055_4632_5480 280
28 3300049744 Ga0501083_0089591 Ga0501083_0089591_1018_1866 280
29 3300049822 Ga0501035_0222351 Ga0501035_0222351_454_1302 280
30 3300049823 Ga0501044_0030201 Ga0501044_0030201_2210_3058 280
31 3300054114 Ga0501084_0001465 Ga0501084_0001465_5055_5903 280
32 3300060353 Ga0501082_0012178 Ga0501082_0012178_4632_5480 280
33 3300005338 Ga0068868_100038942 Ga0068868_1000389421 281
34 3300005718 Ga0068866_10126563 Ga0068866_101265631 281
35 3300006237 Ga0097621_100046311 Ga0097621_1000463115 281
36 3300006358 Ga0068871_100048371 Ga0068871_1000483712 281
37 3300006852 Ga0075433_10002750 Ga0075433_100027508 281
38 3300009093 Ga0105240_10125112 Ga0105240_101251123 281
39 3300009094 Ga0111539_10005961 Ga0111539_100059615 281
40 3300009098 Ga0105245_10043376 Ga0105245_100433761 281
41 3300009177 Ga0105248_10074437 Ga0105248_100744372 281
42 3300010375 Ga0105239_10248459 Ga0105239_102484592 281
43 3300013296 Ga0157374_10517090 Ga0157374_105170901 281
44 3300013297 Ga0157378_10070302 Ga0157378_100703022 281
45 3300013306 Ga0163162_10063172 Ga0163162_100631722 281
46 3300025927 Ga0207687_10041781 Ga0207687_100417812 281
47 3300025934 Ga0207686_10103748 Ga0207686_101037481 281
48 3300025941 Ga0207711_10061798 Ga0207711_100617982 281
49 3300025981 Ga0207640_10159441 Ga0207640_101594411 281
50 3300026023 Ga0207677_10370796 Ga0207677_103707961 281
51 3300027907 Ga0207428_10041838 Ga0207428_100418382 281
52 3300039447 Ga0436361_0539608 Ga0436361_0539608_1492_2352 281
53 3300046514 Ga0495618_0290983 Ga0495618_0290983_18_902 281
54 3300046533 Ga0495640_0014874 Ga0495640_0014874_2427_3311 281
55 3300046543 Ga0495645_0016767 Ga0495645_0016767_389_1306 281
56 3300046683 Ga0495658_0001341 Ga0495658_0001341_10584_11468 281
57 3300046689 Ga0495613_0002687 Ga0495613_0002687_10096_10980 281
58 3300050511 nmdc:mga08y16_60202_c1 nmdc:mga08y16_60202_c1_1016_1885 281
59 3300050515 nmdc:mga0a205_10484_c1 nmdc:mga0a205_10484_c1_7585_8436 281
60 3300053077 Ga0495601_0021998 Ga0495601_0021998_1580_2497 281
61 3300053078 Ga0495612_0032994 Ga0495612_0032994_839_1756 281
62 3300006846 Ga0075430_100303111 Ga0075430_1003031112 282
63 3300006847 Ga0075431_100067137 Ga0075431_1000671371 282
64 3300006914 Ga0075436_100009950 Ga0075436_1000099503 282
65 3300009093 Ga0105240_10076260 Ga0105240_100762604 282
66 3300009148 Ga0105243_10116909 Ga0105243_101169092 282
67 3300009177 Ga0105248_10000319 Ga0105248_1000031927 282
68 3300013307 Ga0157372_10080653 Ga0157372_100806534 282
69 3300013307 Ga0157372_10142527 Ga0157372_101425273 282
70 3300021388 Ga0213875_10076329 Ga0213875_100763292 282
71 3300025935 Ga0207709_10063461 Ga0207709_100634612 282
72 3300025941 Ga0207711_10000225 Ga0207711_1000022551 282
73 3300031824 Ga0307413_10152124 Ga0307413_101521242 282
74 3300033180 Ga0307510_10090625 Ga0307510_100906252 282
75 3300037853 Ga0436364_0103870 Ga0436364_0103870_272_1123 282
76 3300037853 Ga0436364_0880534 Ga0436364_0880534_17912_18772 282
77 3300042876 Ga0451577_0204118 Ga0451577_0204118_515_1366 282
78 3300044712 Ga0453684_0337075 Ga0453684_0337075_102_953 282
79 3300045051 Ga0451576_0062811 Ga0451576_0062811_455_1306 282
80 3300048929 Ga0496126_0002227 Ga0496126_0002227_15428_16279 282
81 3300050509 nmdc:mga0qj67_162642_c1 nmdc:mga0qj67_162642_c1_852_1703 282
82 3300053088 Ga0500644_0016613 Ga0500644_0016613_716_1576 282
83 3300053119 Ga0500595_035608 Ga0500595_035608_579_1439 282
84 3300003322 rootL2_10089696 rootL2_100896963 283
85 3300005295 Ga0065707_10150079 Ga0065707_101500792 283
86 3300005329 Ga0070683_100240011 Ga0070683_1002400111 283
87 3300005334 Ga0068869_100009742 Ga0068869_1000097426 283
88 3300005338 Ga0068868_100011969 Ga0068868_1000119696 283
89 3300005344 Ga0070661_100059118 Ga0070661_1000591182 283
90 3300005364 Ga0070673_100093952 Ga0070673_1000939521 283
91 3300005406 Ga0070703_10004502 Ga0070703_100045022 283
92 3300005434 Ga0070709_10213377 Ga0070709_102133771 283
93 3300005435 Ga0070714_100449729 Ga0070714_1004497292 283
94 3300005436 Ga0070713_100081141 Ga0070713_1000811412 283
95 3300005440 Ga0070705_100037839 Ga0070705_1000378393 283
96 3300005440 Ga0070705_100139845 Ga0070705_1001398452 283
97 3300005444 Ga0070694_100011619 Ga0070694_1000116193 283
98 3300005445 Ga0070708_100016490 Ga0070708_1000164902 283
99 3300005445 Ga0070708_100018101 Ga0070708_1000181012 283
100 3300005458 Ga0070681_10047671 Ga0070681_100476714 283
101 3300005459 Ga0068867_100002168 Ga0068867_10000216812 283
102 3300005467 Ga0070706_100050232 Ga0070706_1000502322 283
103 3300005518 Ga0070699_100008871 Ga0070699_1000088713 283
104 3300005530 Ga0070679_100061073 Ga0070679_1000610733 283
105 3300005530 Ga0070679_100168347 Ga0070679_1001683472 283
106 3300005536 Ga0070697_100013036 Ga0070697_1000130362 283
107 3300005539 Ga0068853_100281836 Ga0068853_1002818362 283
108 3300005546 Ga0070696_100012720 Ga0070696_1000127203 283
109 3300005546 Ga0070696_100469541 Ga0070696_1004695411 283
110 3300005547 Ga0070693_100007359 Ga0070693_1000073592 283
111 3300005548 Ga0070665_100000918 Ga0070665_10000091828 283
112 3300005549 Ga0070704_100011412 Ga0070704_1000114122 283
113 3300005563 Ga0068855_100002442 Ga0068855_1000024427 283
114 3300005564 Ga0070664_100006730 Ga0070664_1000067304 283
115 3300005577 Ga0068857_100102908 Ga0068857_1001029082 283
116 3300005614 Ga0068856_100002181 Ga0068856_1000021817 283
117 3300005614 Ga0068856_100022060 Ga0068856_1000220605 283
118 3300005617 Ga0068859_100002369 Ga0068859_10000236921 283
119 3300005617 Ga0068859_100434397 Ga0068859_1004343972 283
120 3300005618 Ga0068864_100002900 Ga0068864_10000290015 283
121 3300005719 Ga0068861_100077420 Ga0068861_1000774202 283
122 3300005841 Ga0068863_100066822 Ga0068863_1000668222 283
123 3300005842 Ga0068858_100001259 Ga0068858_10000125937 283
124 3300005842 Ga0068858_100339292 Ga0068858_1003392922 283
125 3300005937 Ga0081455_10055778 Ga0081455_100557781 283
126 3300006028 Ga0070717_10000582 Ga0070717_100005825 283
127 3300006237 Ga0097621_100015795 Ga0097621_1000157952 283
128 3300006852 Ga0075433_10020438 Ga0075433_100204384 283
129 3300006871 Ga0075434_100034834 Ga0075434_1000348342 283
130 3300006881 Ga0068865_100118821 Ga0068865_1001188213 283
131 3300006914 Ga0075436_100004130 Ga0075436_1000041303 283
132 3300006914 Ga0075436_100251254 Ga0075436_1002512542 283
133 3300006931 Ga0097620_100002369 Ga0097620_1000023694 283
134 3300006931 Ga0097620_100434453 Ga0097620_1004344532 283
135 3300007076 Ga0075435_100104544 Ga0075435_1001045442 283
136 3300007076 Ga0075435_100190720 Ga0075435_1001907202 283
137 3300007076 Ga0075435_100315346 Ga0075435_1003153462 283
138 3300007265 Ga0099794_10031748 Ga0099794_100317482 283
139 3300007265 Ga0099794_10209153 Ga0099794_102091531 283
140 3300009098 Ga0105245_10067429 Ga0105245_100674294 283
141 3300009174 Ga0105241_10081792 Ga0105241_100817922 283
142 3300009177 Ga0105248_10210392 Ga0105248_102103922 283
143 3300013104 Ga0157370_10315182 Ga0157370_103151822 283
144 3300013296 Ga0157374_10057426 Ga0157374_100574263 283
145 3300013297 Ga0157378_10000263 Ga0157378_100002638 283
146 3300013297 Ga0157378_10002951 Ga0157378_1000295113 283
147 3300013307 Ga0157372_10000982 Ga0157372_1000098232 283
148 3300013308 Ga0157375_10098750 Ga0157375_100987503 283
149 3300013308 Ga0157375_10473362 Ga0157375_104733622 283
150 3300014325 Ga0163163_10132651 Ga0163163_101326512 283
151 3300021388 Ga0213875_10000017 Ga0213875_10000017114 283
152 3300025885 Ga0207653_10008013 Ga0207653_100080132 283
153 3300025904 Ga0207647_10025602 Ga0207647_100256024 283
154 3300025908 Ga0207643_10019835 Ga0207643_100198351 283
155 3300025910 Ga0207684_10015475 Ga0207684_100154753 283
156 3300025911 Ga0207654_10083341 Ga0207654_100833412 283
157 3300025912 Ga0207707_10016653 Ga0207707_100166534 283
158 3300025912 Ga0207707_10288165 Ga0207707_102881652 283
159 3300025914 Ga0207671_10245443 Ga0207671_102454432 283
160 3300025920 Ga0207649_10041209 Ga0207649_100412093 283
161 3300025921 Ga0207652_10175829 Ga0207652_101758291 283
162 3300025921 Ga0207652_10587535 Ga0207652_105875351 283
163 3300025927 Ga0207687_10274703 Ga0207687_102747032 283
164 3300025944 Ga0207661_10065336 Ga0207661_100653362 283
165 3300025945 Ga0207679_10037403 Ga0207679_100374032 283
166 3300026023 Ga0207677_10006069 Ga0207677_100060693 283
167 3300026078 Ga0207702_10012061 Ga0207702_100120612 283
168 3300026088 Ga0207641_10031687 Ga0207641_100316872 283
169 3300026088 Ga0207641_10248438 Ga0207641_102484382 283
170 3300026089 Ga0207648_10014946 Ga0207648_100149465 283
171 3300026095 Ga0207676_10236698 Ga0207676_102366981 283
172 3300026116 Ga0207674_10000560 Ga0207674_1000056044 283
173 3300027671 Ga0209588_1012353 Ga0209588_10123533 283
174 3300028379 Ga0268266_10000144 Ga0268266_10000144113 283
175 3300028379 Ga0268266_10392128 Ga0268266_103921281 283
176 3300028381 Ga0268264_10049888 Ga0268264_100498882 283
177 3300037853 Ga0436364_0074911 Ga0436364_0074911_741_1595 283
178 3300037853 Ga0436364_1041147 Ga0436364_1041147_556_1410 283
179 3300039437 Ga0436365_0894537 Ga0436365_0894537_1369_2223 283
180 3300039437 Ga0436365_0960146 Ga0436365_0960146_1433_2287 283
181 3300039437 Ga0436365_1584098 Ga0436365_1584098_724_1578 283
182 3300039450 Ga0436363_0226217 Ga0436363_0226217_29_883 283
183 3300039450 Ga0436363_1398555 Ga0436363_1398555_1039_1893 283
184 3300039453 Ga0436362_0626017 Ga0436362_0626017_1290_2144 283
185 3300046462 Ga0495651_0082688 Ga0495651_0082688_1383_2237 283
186 3300046471 Ga0495650_0001419 Ga0495650_0001419_18604_19464 283
187 3300046472 Ga0495580_0046668 Ga0495580_0046668_1616_2470 283
188 3300046536 Ga0495587_0173080 Ga0495587_0173080_321_1175 283
189 3300046660 Ga0495625_0002508 Ga0495625_0002508_4647_5507 283
190 3300046694 Ga0495649_0232175 Ga0495649_0232175_55_912 283
191 3300049571 Ga0501034_0006263 Ga0501034_0006263_5575_6441 283
192 3300049574 Ga0501038_0082067 Ga0501038_0082067_436_1302 283
193 3300049579 Ga0501043_0009525 Ga0501043_0009525_1243_2109 283
194 3300049580 Ga0501046_0069161 Ga0501046_0069161_1857_2723 283
195 3300049582 Ga0501048_0316619 Ga0501048_0316619_14_880 283
196 3300049586 Ga0501070_0011024 Ga0501070_0011024_2592_3458 283
197 3300049586 Ga0501070_0107489 Ga0501070_0107489_225_1082 283
198 3300049742 Ga0501080_0340684 Ga0501080_0340684_100_966 283
199 3300049822 Ga0501035_0034854 Ga0501035_0034854_2519_3385 283
200 3300049823 Ga0501044_0113587 Ga0501044_0113587_1736_2602 283
201 3300050512 nmdc:mga0n895_11278_c1 nmdc:mga0n895_11278_c1_3809_4663 283
202 3300050514 nmdc:mga08x19_7537_c1 nmdc:mga08x19_7537_c1_3385_4239 283
203 3300003323 rootH1_10319382 rootH1_103193823 284
204 3300005327 Ga0070658_10006654 Ga0070658_100066542 284
205 3300005327 Ga0070658_10007325 Ga0070658_100073259 284
206 3300005327 Ga0070658_10027817 Ga0070658_100278174 284
207 3300005329 Ga0070683_100000008 Ga0070683_10000000893 284
208 3300005329 Ga0070683_100001085 Ga0070683_1000010858 284
209 3300005329 Ga0070683_100248932 Ga0070683_1002489322 284
210 3300005334 Ga0068869_100025813 Ga0068869_1000258131 284
211 3300005334 Ga0068869_100029502 Ga0068869_1000295022 284
212 3300005335 Ga0070666_10029166 Ga0070666_100291662 284
213 3300005337 Ga0070682_100069155 Ga0070682_1000691552 284
214 3300005338 Ga0068868_100041785 Ga0068868_1000417853 284
215 3300005338 Ga0068868_100158878 Ga0068868_1001588782 284
216 3300005339 Ga0070660_100006724 Ga0070660_1000067242 284
217 3300005339 Ga0070660_100195619 Ga0070660_1001956192 284
218 3300005344 Ga0070661_100016382 Ga0070661_1000163823 284
219 3300005344 Ga0070661_100143738 Ga0070661_1001437382 284
220 3300005354 Ga0070675_100045990 Ga0070675_1000459903 284
221 3300005355 Ga0070671_100056092 Ga0070671_1000560922 284
222 3300005355 Ga0070671_100307106 Ga0070671_1003071062 284
223 3300005364 Ga0070673_100132170 Ga0070673_1001321701 284
224 3300005366 Ga0070659_100006194 Ga0070659_1000061945 284
225 3300005366 Ga0070659_100007028 Ga0070659_1000070282 284
226 3300005367 Ga0070667_100292379 Ga0070667_1002923792 284
227 3300005434 Ga0070709_10003223 Ga0070709_100032233 284
228 3300005434 Ga0070709_10004418 Ga0070709_100044184 284
229 3300005434 Ga0070709_10274293 Ga0070709_102742932 284
230 3300005434 Ga0070709_10279995 Ga0070709_102799951 284
231 3300005435 Ga0070714_100014642 Ga0070714_1000146424 284
232 3300005436 Ga0070713_100001444 Ga0070713_1000014443 284
233 3300005436 Ga0070713_100023514 Ga0070713_1000235142 284
234 3300005437 Ga0070710_10013842 Ga0070710_100138422 284
235 3300005439 Ga0070711_100002499 Ga0070711_1000024992 284
236 3300005439 Ga0070711_100322533 Ga0070711_1003225331 284
237 3300005439 Ga0070711_100388518 Ga0070711_1003885181 284
238 3300005445 Ga0070708_100035172 Ga0070708_1000351725 284
239 3300005455 Ga0070663_100054629 Ga0070663_1000546292 284
240 3300005455 Ga0070663_100396411 Ga0070663_1003964111 284
241 3300005456 Ga0070678_100013830 Ga0070678_1000138304 284
242 3300005457 Ga0070662_100066627 Ga0070662_1000666272 284
243 3300005457 Ga0070662_100295534 Ga0070662_1002955341 284
244 3300005458 Ga0070681_10007463 Ga0070681_100074633 284
245 3300005458 Ga0070681_10123605 Ga0070681_101236052 284
246 3300005459 Ga0068867_100024034 Ga0068867_1000240342 284
247 3300005467 Ga0070706_100002900 Ga0070706_10000290018 284
248 3300005467 Ga0070706_100045013 Ga0070706_1000450132 284
249 3300005468 Ga0070707_100005573 Ga0070707_1000055732 284
250 3300005468 Ga0070707_100256099 Ga0070707_1002560991 284
251 3300005471 Ga0070698_100002625 Ga0070698_1000026259 284
252 3300005471 Ga0070698_100057408 Ga0070698_1000574083 284
253 3300005471 Ga0070698_100065920 Ga0070698_1000659202 284
254 3300005518 Ga0070699_100251999 Ga0070699_1002519992 284
255 3300005530 Ga0070679_100072203 Ga0070679_1000722031 284
256 3300005530 Ga0070679_100088650 Ga0070679_1000886501 284
257 3300005530 Ga0070679_100117500 Ga0070679_1001175002 284
258 3300005530 Ga0070679_100154565 Ga0070679_1001545652 284
259 3300005530 Ga0070679_100367001 Ga0070679_1003670011 284
260 3300005535 Ga0070684_100000002 Ga0070684_10000000283 284
261 3300005535 Ga0070684_100016895 Ga0070684_1000168953 284
262 3300005536 Ga0070697_100013213 Ga0070697_1000132132 284
263 3300005536 Ga0070697_100318773 Ga0070697_1003187732 284
264 3300005539 Ga0068853_100001128 Ga0068853_10000112818 284
265 3300005539 Ga0068853_100011434 Ga0068853_1000114343 284
266 3300005539 Ga0068853_100073632 Ga0068853_1000736323 284
267 3300005539 Ga0068853_100548759 Ga0068853_1005487591 284
268 3300005543 Ga0070672_100021776 Ga0070672_1000217764 284
269 3300005548 Ga0070665_100018880 Ga0070665_1000188806 284
270 3300005548 Ga0070665_100124781 Ga0070665_1001247813 284
271 3300005563 Ga0068855_100020104 Ga0068855_1000201043 284
272 3300005563 Ga0068855_100074626 Ga0068855_1000746262 284
273 3300005563 Ga0068855_100119528 Ga0068855_1001195282 284
274 3300005563 Ga0068855_100230718 Ga0068855_1002307182 284
275 3300005563 Ga0068855_100559090 Ga0068855_1005590901 284
276 3300005563 Ga0068855_100602183 Ga0068855_1006021832 284
277 3300005564 Ga0070664_100469749 Ga0070664_1004697492 284
278 3300005577 Ga0068857_100046601 Ga0068857_1000466013 284
279 3300005578 Ga0068854_100000003 Ga0068854_100000003175 284
280 3300005578 Ga0068854_100002113 Ga0068854_1000021138 284
281 3300005578 Ga0068854_100494323 Ga0068854_1004943231 284
282 3300005614 Ga0068856_100011264 Ga0068856_1000112645 284
283 3300005614 Ga0068856_100029012 Ga0068856_1000290122 284
284 3300005614 Ga0068856_100092143 Ga0068856_1000921432 284
285 3300005614 Ga0068856_100312505 Ga0068856_1003125052 284
286 3300005614 Ga0068856_100327532 Ga0068856_1003275322 284
287 3300005614 Ga0068856_100540194 Ga0068856_1005401941 284
288 3300005616 Ga0068852_100065221 Ga0068852_1000652213 284
289 3300005616 Ga0068852_100083891 Ga0068852_1000838912 284
290 3300005616 Ga0068852_100494862 Ga0068852_1004948622 284
291 3300005616 Ga0068852_100535218 Ga0068852_1005352182 284
292 3300005617 Ga0068859_100020434 Ga0068859_1000204344 284
293 3300005617 Ga0068859_100332786 Ga0068859_1003327861 284
294 3300005617 Ga0068859_100489876 Ga0068859_1004898761 284
295 3300005618 Ga0068864_100018903 Ga0068864_1000189032 284
296 3300005834 Ga0068851_10090688 Ga0068851_100906882 284
297 3300005841 Ga0068863_100029216 Ga0068863_1000292162 284
298 3300005841 Ga0068863_100086118 Ga0068863_1000861183 284
299 3300005842 Ga0068858_100001498 Ga0068858_1000014987 284
300 3300005842 Ga0068858_100176902 Ga0068858_1001769023 284
301 3300005844 Ga0068862_100170424 Ga0068862_1001704242 284
302 3300005937 Ga0081455_10039483 Ga0081455_100394834 284
303 3300006028 Ga0070717_10005337 Ga0070717_100053373 284
304 3300006173 Ga0070716_100013778 Ga0070716_1000137782 284
305 3300006173 Ga0070716_100135434 Ga0070716_1001354342 284
306 3300006175 Ga0070712_100002219 Ga0070712_1000022193 284
307 3300006237 Ga0097621_100107116 Ga0097621_1001071163 284
308 3300006358 Ga0068871_100339484 Ga0068871_1003394842 284
309 3300006881 Ga0068865_100031172 Ga0068865_1000311723 284
310 3300006931 Ga0097620_100020434 Ga0097620_1000204342 284
311 3300006931 Ga0097620_100332784 Ga0097620_1003327841 284
312 3300006931 Ga0097620_100489893 Ga0097620_1004898931 284
313 3300009093 Ga0105240_10000001 Ga0105240_100000012296 284
314 3300009093 Ga0105240_10017310 Ga0105240_100173106 284
315 3300009093 Ga0105240_10020798 Ga0105240_100207985 284
316 3300009093 Ga0105240_10031912 Ga0105240_100319124 284
317 3300009093 Ga0105240_10085141 Ga0105240_100851412 284
318 3300009093 Ga0105240_10195396 Ga0105240_101953962 284
319 3300009093 Ga0105240_10921485 Ga0105240_109214851 284
320 3300009098 Ga0105245_10020916 Ga0105245_100209163 284
321 3300009174 Ga0105241_10361780 Ga0105241_103617801 284
322 3300009177 Ga0105248_10001668 Ga0105248_1000166810 284
323 3300009177 Ga0105248_10104724 Ga0105248_101047243 284
324 3300009545 Ga0105237_10014461 Ga0105237_100144614 284
325 3300009551 Ga0105238_10023719 Ga0105238_100237192 284
326 3300009551 Ga0105238_10505285 Ga0105238_105052852 284
327 3300009553 Ga0105249_10174381 Ga0105249_101743812 284
328 3300010375 Ga0105239_10079970 Ga0105239_100799702 284
329 3300010375 Ga0105239_10525020 Ga0105239_105250201 284
330 3300013104 Ga0157370_10027433 Ga0157370_100274334 284
331 3300013104 Ga0157370_10044595 Ga0157370_100445952 284
332 3300013104 Ga0157370_10047287 Ga0157370_100472873 284
333 3300013104 Ga0157370_10060654 Ga0157370_100606542 284
334 3300013104 Ga0157370_10090725 Ga0157370_100907252 284
335 3300013105 Ga0157369_10013277 Ga0157369_100132773 284
336 3300013105 Ga0157369_10029511 Ga0157369_100295112 284
337 3300013105 Ga0157369_10032611 Ga0157369_100326115 284
338 3300013105 Ga0157369_10103507 Ga0157369_101035072 284
339 3300013105 Ga0157369_10305573 Ga0157369_103055732 284
340 3300013105 Ga0157369_10336572 Ga0157369_103365722 284
341 3300013296 Ga0157374_10016789 Ga0157374_100167892 284
342 3300013296 Ga0157374_10017924 Ga0157374_100179243 284
343 3300013296 Ga0157374_10119638 Ga0157374_101196382 284
344 3300013297 Ga0157378_10262987 Ga0157378_102629872 284
345 3300013306 Ga0163162_10038339 Ga0163162_100383392 284
346 3300013307 Ga0157372_10002405 Ga0157372_100024055 284
347 3300013307 Ga0157372_10023742 Ga0157372_100237421 284
348 3300013307 Ga0157372_10064666 Ga0157372_100646663 284
349 3300013307 Ga0157372_10117245 Ga0157372_101172452 284
350 3300013307 Ga0157372_10200053 Ga0157372_102000532 284
351 3300013307 Ga0157372_10252388 Ga0157372_102523882 284
352 3300013307 Ga0157372_10316871 Ga0157372_103168712 284
353 3300013308 Ga0157375_10070316 Ga0157375_100703162 284
354 3300013308 Ga0157375_10187695 Ga0157375_101876952 284
355 3300014325 Ga0163163_10022326 Ga0163163_100223264 284
356 3300014968 Ga0157379_10174706 Ga0157379_101747061 284
357 3300014969 Ga0157376_10023861 Ga0157376_100238613 284
358 3300014969 Ga0157376_10044463 Ga0157376_100444633 284
359 3300014969 Ga0157376_10805989 Ga0157376_108059891 284
360 3300017792 Ga0163161_10055232 Ga0163161_100552324 284
361 3300020069 Ga0197907_10130176 Ga0197907_101301761 284
362 3300020069 Ga0197907_10200061 Ga0197907_102000611 284
363 3300020070 Ga0206356_10197226 Ga0206356_101972261 284
364 3300020076 Ga0206355_1393545 Ga0206355_13935451 284
365 3300020076 Ga0206355_1640260 Ga0206355_16402601 284
366 3300020077 Ga0206351_10618912 Ga0206351_106189121 284
367 3300020078 Ga0206352_10915830 Ga0206352_109158301 284
368 3300020080 Ga0206350_11571727 Ga0206350_115717273 284
369 3300020082 Ga0206353_12047086 Ga0206353_120470861 284
370 3300020610 Ga0154015_1398831 Ga0154015_13988312 284
371 3300021361 Ga0213872_10024260 Ga0213872_100242603 284
372 3300021361 Ga0213872_10039843 Ga0213872_100398432 284
373 3300021361 Ga0213872_10063524 Ga0213872_100635242 284
374 3300021388 Ga0213875_10012867 Ga0213875_100128675 284
375 3300022467 Ga0224712_10077080 Ga0224712_100770801 284
376 3300022467 Ga0224712_10191885 Ga0224712_101918851 284
377 3300022467 Ga0224712_10202143 Ga0224712_102021431 284
378 3300024227 Ga0228598_1011194 Ga0228598_10111942 284
379 3300025321 Ga0207656_10050977 Ga0207656_100509772 284
380 3300025898 Ga0207692_10014933 Ga0207692_100149332 284
381 3300025903 Ga0207680_10166360 Ga0207680_101663601 284
382 3300025904 Ga0207647_10003063 Ga0207647_100030638 284
383 3300025904 Ga0207647_10013832 Ga0207647_100138321 284
384 3300025904 Ga0207647_10027843 Ga0207647_100278433 284
385 3300025906 Ga0207699_10285433 Ga0207699_102854332 284
386 3300025909 Ga0207705_10003727 Ga0207705_100037277 284
387 3300025909 Ga0207705_10030086 Ga0207705_100300863 284
388 3300025909 Ga0207705_10031987 Ga0207705_100319873 284
389 3300025909 Ga0207705_10228848 Ga0207705_102288482 284
390 3300025909 Ga0207705_10340632 Ga0207705_103406321 284
391 3300025910 Ga0207684_10001901 Ga0207684_100019013 284
392 3300025910 Ga0207684_10040662 Ga0207684_100406622 284
393 3300025912 Ga0207707_10058238 Ga0207707_100582382 284
394 3300025912 Ga0207707_10090259 Ga0207707_100902592 284
395 3300025912 Ga0207707_10101603 Ga0207707_101016032 284
396 3300025913 Ga0207695_10000001 Ga0207695_100000012299 284
397 3300025913 Ga0207695_10000177 Ga0207695_1000017767 284
398 3300025913 Ga0207695_10023116 Ga0207695_100231163 284
399 3300025913 Ga0207695_10084966 Ga0207695_100849662 284
400 3300025913 Ga0207695_10129495 Ga0207695_101294953 284
401 3300025913 Ga0207695_10329851 Ga0207695_103298511 284
402 3300025914 Ga0207671_10027024 Ga0207671_100270242 284
403 3300025914 Ga0207671_10051647 Ga0207671_100516473 284
404 3300025914 Ga0207671_10059752 Ga0207671_100597523 284
405 3300025914 Ga0207671_10092267 Ga0207671_100922672 284
406 3300025914 Ga0207671_10100994 Ga0207671_101009942 284
407 3300025915 Ga0207693_10002318 Ga0207693_100023188 284
408 3300025915 Ga0207693_10047808 Ga0207693_100478083 284
409 3300025915 Ga0207693_10208619 Ga0207693_102086191 284
410 3300025916 Ga0207663_10000716 Ga0207663_100007162 284
411 3300025917 Ga0207660_10014861 Ga0207660_100148612 284
412 3300025919 Ga0207657_10001188 Ga0207657_1000118810 284
413 3300025919 Ga0207657_10039381 Ga0207657_100393811 284
414 3300025919 Ga0207657_10233532 Ga0207657_102335322 284
415 3300025920 Ga0207649_10158915 Ga0207649_101589152 284
416 3300025920 Ga0207649_10214116 Ga0207649_102141162 284
417 3300025921 Ga0207652_10019678 Ga0207652_100196781 284
418 3300025922 Ga0207646_10075160 Ga0207646_100751602 284
419 3300025922 Ga0207646_10239272 Ga0207646_102392722 284
420 3300025924 Ga0207694_10082987 Ga0207694_100829872 284
421 3300025926 Ga0207659_10427694 Ga0207659_104276941 284
422 3300025929 Ga0207664_10053848 Ga0207664_100538482 284
423 3300025929 Ga0207664_10152319 Ga0207664_101523192 284
424 3300025929 Ga0207664_10185904 Ga0207664_101859041 284
425 3300025931 Ga0207644_10019102 Ga0207644_100191024 284
426 3300025932 Ga0207690_10003397 Ga0207690_100033973 284
427 3300025932 Ga0207690_10020087 Ga0207690_100200872 284
428 3300025933 Ga0207706_10021352 Ga0207706_100213525 284
429 3300025938 Ga0207704_10145718 Ga0207704_101457182 284
430 3300025939 Ga0207665_10014502 Ga0207665_100145022 284
431 3300025939 Ga0207665_10271740 Ga0207665_102717401 284
432 3300025941 Ga0207711_10062341 Ga0207711_100623411 284
433 3300025941 Ga0207711_10667878 Ga0207711_106678781 284
434 3300025942 Ga0207689_10036312 Ga0207689_100363121 284
435 3300025942 Ga0207689_10144450 Ga0207689_101444502 284
436 3300025944 Ga0207661_10000008 Ga0207661_1000000893 284
437 3300025944 Ga0207661_10019594 Ga0207661_100195943 284
438 3300025944 Ga0207661_10296383 Ga0207661_102963831 284
439 3300025949 Ga0207667_10000251 Ga0207667_1000025119 284
440 3300025949 Ga0207667_10022480 Ga0207667_100224805 284
441 3300025949 Ga0207667_10240988 Ga0207667_102409882 284
442 3300025949 Ga0207667_10270016 Ga0207667_102700161 284
443 3300025949 Ga0207667_10356585 Ga0207667_103565852 284
444 3300025949 Ga0207667_10433034 Ga0207667_104330342 284
445 3300025949 Ga0207667_10469016 Ga0207667_104690162 284
446 3300025972 Ga0207668_10252083 Ga0207668_102520832 284
447 3300025981 Ga0207640_10000002 Ga0207640_10000002333 284
448 3300025981 Ga0207640_10333582 Ga0207640_103335821 284
449 3300026023 Ga0207677_10085924 Ga0207677_100859242 284
450 3300026023 Ga0207677_10128172 Ga0207677_101281722 284
451 3300026035 Ga0207703_10001373 Ga0207703_100013734 284
452 3300026035 Ga0207703_10210257 Ga0207703_102102571 284
453 3300026041 Ga0207639_10000011 Ga0207639_10000011207 284
454 3300026041 Ga0207639_10078842 Ga0207639_100788422 284
455 3300026041 Ga0207639_10112542 Ga0207639_101125422 284
456 3300026067 Ga0207678_10000939 Ga0207678_100009398 284
457 3300026067 Ga0207678_10001450 Ga0207678_1000145010 284
458 3300026067 Ga0207678_10002208 Ga0207678_100022086 284
459 3300026067 Ga0207678_10103054 Ga0207678_101030542 284
460 3300026067 Ga0207678_10119063 Ga0207678_101190632 284
461 3300026067 Ga0207678_10195653 Ga0207678_101956532 284
462 3300026078 Ga0207702_10001578 Ga0207702_1000157813 284
463 3300026078 Ga0207702_10383903 Ga0207702_103839031 284
464 3300026078 Ga0207702_10479433 Ga0207702_104794331 284
465 3300026088 Ga0207641_10033103 Ga0207641_100331033 284
466 3300026088 Ga0207641_10054514 Ga0207641_100545143 284
467 3300026088 Ga0207641_10207608 Ga0207641_102076081 284
468 3300026089 Ga0207648_10026270 Ga0207648_100262702 284
469 3300026089 Ga0207648_10435950 Ga0207648_104359501 284
470 3300026095 Ga0207676_10096187 Ga0207676_100961872 284
471 3300026095 Ga0207676_10107474 Ga0207676_101074743 284
472 3300026116 Ga0207674_10001500 Ga0207674_100015009 284
473 3300026116 Ga0207674_10523908 Ga0207674_105239081 284
474 3300026121 Ga0207683_10007557 Ga0207683_100075578 284
475 3300026142 Ga0207698_10122389 Ga0207698_101223893 284
476 3300026142 Ga0207698_10207725 Ga0207698_102077252 284
477 3300028379 Ga0268266_10016406 Ga0268266_100164062 284
478 3300028380 Ga0268265_10182032 Ga0268265_101820321 284
479 3300028381 Ga0268264_10006871 Ga0268264_100068713 284
480 3300028800 Ga0265338_10189767 Ga0265338_101897672 284
481 3300031239 Ga0265328_10050767 Ga0265328_100507672 284
482 3300031249 Ga0265339_10000694 Ga0265339_1000069419 284
483 3300031595 Ga0265313_10116693 Ga0265313_101166931 284
484 3300033180 Ga0307510_10057547 Ga0307510_100575471 284
485 3300036401 Ga0373937_0495471 Ga0373937_0495471_62_928 284
486 3300037418 Ga0395900_0096834 Ga0395900_0096834_1590_2459 284
487 3300037466 Ga0395898_0026273 Ga0395898_0026273_1270_2130 284
488 3300037466 Ga0395898_0514315 Ga0395898_0514315_253_1113 284
489 3300037853 Ga0436364_0609851 Ga0436364_0609851_1270_2142 284
490 3300037853 Ga0436364_0787170 Ga0436364_0787170_141_998 284
491 3300037853 Ga0436364_0814149 Ga0436364_0814149_49_906 284
492 3300039438 Ga0436360_0111215 Ga0436360_0111215_6821_7690 284
493 3300039438 Ga0436360_0654204 Ga0436360_0654204_270_1139 284
494 3300039438 Ga0436360_0673809 Ga0436360_0673809_116_985 284
495 3300039447 Ga0436361_0070516 Ga0436361_0070516_8604_9662 284
496 3300039447 Ga0436361_0195153 Ga0436361_0195153_614_1471 284
497 3300039447 Ga0436361_0248901 Ga0436361_0248901_3176_4045 284
498 3300039447 Ga0436361_0761235 Ga0436361_0761235_85110_85967 284
499 3300044684 Ga0466966_0025506 Ga0466966_0025506_686_1546 284
500 3300044706 Ga0466964_0024177 Ga0466964_0024177_309_1169 284
501 3300045976 Ga0466967_0463958 Ga0466967_0463958_220_1080 284
502 3300045976 Ga0466967_0486052 Ga0466967_0486052_260_1120 284
503 3300046455 Ga0495603_0001049 Ga0495603_0001049_5994_6857 284
504 3300046459 Ga0495629_0040041 Ga0495629_0040041_805_1662 284
505 3300046459 Ga0495629_0046247 Ga0495629_0046247_1280_2146 284
506 3300046462 Ga0495651_0000991 Ga0495651_0000991_8880_9743 284
507 3300046472 Ga0495580_0058448 Ga0495580_0058448_521_1384 284
508 3300046472 Ga0495580_0271764 Ga0495580_0271764_244_1104 284
509 3300046473 Ga0495582_0002882 Ga0495582_0002882_5787_6650 284
510 3300046476 Ga0495662_0001218 Ga0495662_0001218_11050_11913 284
511 3300046477 Ga0495664_0007921 Ga0495664_0007921_465_1328 284
512 3300046499 Ga0495594_0000311 Ga0495594_0000311_15274_16137 284
513 3300046499 Ga0495594_0007732 Ga0495594_0007732_4106_4969 284
514 3300046506 Ga0495583_0040724 Ga0495583_0040724_1269_2132 284
515 3300046514 Ga0495618_0133075 Ga0495618_0133075_255_1118 284
516 3300046516 Ga0495628_0164220 Ga0495628_0164220_772_1635 284
517 3300046523 Ga0495644_0001019 Ga0495644_0001019_7787_8650 284
518 3300046526 Ga0495666_0002474 Ga0495666_0002474_56_919 284
519 3300046528 Ga0495642_0120638 Ga0495642_0120638_105_968 284
520 3300046536 Ga0495587_0098916 Ga0495587_0098916_420_1286 284
521 3300046538 Ga0495609_0008328 Ga0495609_0008328_3833_4696 284
522 3300046557 Ga0495622_0040610 Ga0495622_0040610_1039_1902 284
523 3300046558 Ga0495633_0012427 Ga0495633_0012427_3528_4391 284
524 3300046642 Ga0495634_0001013 Ga0495634_0001013_11837_12700 284
525 3300046660 Ga0495625_0158440 Ga0495625_0158440_19_882 284
526 3300046678 Ga0495599_0001904 Ga0495599_0001904_2726_3589 284
527 3300046684 Ga0495669_0003529 Ga0495669_0003529_3071_3934 284
528 3300046689 Ga0495613_0005291 Ga0495613_0005291_5663_6526 284
529 3300046690 Ga0495624_0003225 Ga0495624_0003225_11245_12108 284
530 3300046809 Ga0495600_0079203 Ga0495600_0079203_546_1409 284
531 3300047315 Ga0495581_0001414 Ga0495581_0001414_4126_4989 284
532 3300047321 Ga0495676_0000384 Ga0495676_0000384_23139_24002 284
533 3300047323 Ga0495683_0093917 Ga0495683_0093917_295_1158 284
534 3300047444 Ga0495675_0002097 Ga0495675_0002097_149_1012 284
535 3300047446 Ga0495679_063778 Ga0495679_063778_192_1055 284
536 3300048089 Ga0495614_0000029 Ga0495614_0000029_28209_29072 284
537 3300048908 Ga0496105_0015591 Ga0496105_0015591_803_1660 284
538 3300048915 Ga0496112_0103579 Ga0496112_0103579_409_1293 284
539 3300048917 Ga0496114_0008141 Ga0496114_0008141_6893_7750 284
540 3300048929 Ga0496126_0000333 Ga0496126_0000333_56675_57535 284
541 3300048929 Ga0496126_0102647 Ga0496126_0102647_124_984 284
542 3300049589 Ga0501073_0232615 Ga0501073_0232615_191_1051 284
543 3300053093 Ga0500651_0000007 Ga0500651_0000007_244234_245094 284
544 3300055283 Ga0500661_000345 Ga0500661_000345_5235_6095 284
545 3300059508 Ga0587088_019594 Ga0587088_019594_104_973 284
546 3300059512 Ga0587092_016174 Ga0587092_016174_156_1025 284
547 3300059640 Ga0587067_015700 Ga0587067_015700_35_904 284
548 3300060353 Ga0501082_0000192 Ga0501082_0000192_40509_41366 284
549 3300005436 Ga0070713_100139246 Ga0070713_1001392462 285
550 3300013296 Ga0157374_10043305 Ga0157374_100433053 285
551 3300014969 Ga0157376_10000041 Ga0157376_1000004187 285
552 3300025928 Ga0207700_10034308 Ga0207700_100343081 285
553 3300025939 Ga0207665_10006036 Ga0207665_100060367 285
554 3300035083 Ga0373926_0004932 Ga0373926_0004932_1604_2476 285
555 3300035171 Ga0373946_0019411 Ga0373946_0019411_978_1850 285
556 3300035695 Ga0373927_0003524 Ga0373927_0003524_1427_2299 285
557 3300035695 Ga0373927_0068300 Ga0373927_0068300_151_1014 285
558 3300035725 Ga0373947_0006601 Ga0373947_0006601_5407_6279 285
559 3300037068 Ga0373925_0004006 Ga0373925_0004006_1422_2294 285
560 3300037853 Ga0436364_0339530 Ga0436364_0339530_107758_108627 285
561 3300039438 Ga0436360_1304700 Ga0436360_1304700_5710_6570 285
562 3300046473 Ga0495582_0000192 Ga0495582_0000192_25579_26577 285
563 3300047321 Ga0495676_0134384 Ga0495676_0134384_215_1087 285
564 3300048918 Ga0496115_0036296 Ga0496115_0036296_2688_3554 285
565 3300050514 nmdc:mga08x19_188_c1 nmdc:mga08x19_188_c1_8105_8977 285
566 3300003320 rootH2_10006251 rootH2_100062518 286
567 3300003320 rootH2_10183644 rootH2_101836442 286
568 3300005329 Ga0070683_100106880 Ga0070683_1001068802 286
569 3300005458 Ga0070681_10086352 Ga0070681_100863524 286
570 3300005467 Ga0070706_100117947 Ga0070706_1001179472 286
571 3300005539 Ga0068853_100000464 Ga0068853_10000046410 286
572 3300005539 Ga0068853_100084650 Ga0068853_1000846502 286
573 3300005563 Ga0068855_100003189 Ga0068855_1000031899 286
574 3300005563 Ga0068855_100072726 Ga0068855_1000727264 286
575 3300005577 Ga0068857_100042707 Ga0068857_1000427072 286
576 3300005578 Ga0068854_100004181 Ga0068854_1000041816 286
577 3300005578 Ga0068854_100161759 Ga0068854_1001617591 286
578 3300005614 Ga0068856_100018356 Ga0068856_1000183562 286
579 3300005614 Ga0068856_100111328 Ga0068856_1001113282 286
580 3300005614 Ga0068856_100166330 Ga0068856_1001663301 286
581 3300005616 Ga0068852_100000032 Ga0068852_10000003255 286
582 3300005616 Ga0068852_100000199 Ga0068852_10000019936 286
583 3300006028 Ga0070717_10003870 Ga0070717_100038704 286
584 3300006237 Ga0097621_100161562 Ga0097621_1001615622 286
585 3300006358 Ga0068871_100107333 Ga0068871_1001073332 286
586 3300009093 Ga0105240_10000135 Ga0105240_1000013592 286
587 3300009093 Ga0105240_10054690 Ga0105240_100546902 286
588 3300009098 Ga0105245_10161177 Ga0105245_101611772 286
589 3300009177 Ga0105248_10013472 Ga0105248_100134726 286
590 3300009545 Ga0105237_10191985 Ga0105237_101919852 286
591 3300009551 Ga0105238_10000726 Ga0105238_1000072612 286
592 3300009551 Ga0105238_10110247 Ga0105238_101102472 286
593 3300009551 Ga0105238_10165817 Ga0105238_101658172 286
594 3300010375 Ga0105239_10002093 Ga0105239_1000209318 286
595 3300010375 Ga0105239_10058528 Ga0105239_100585282 286
596 3300011119 Ga0105246_10005875 Ga0105246_100058752 286
597 3300013100 Ga0157373_10021622 Ga0157373_100216222 286
598 3300013100 Ga0157373_10128449 Ga0157373_101284491 286
599 3300013104 Ga0157370_10000023 Ga0157370_1000002338 286
600 3300013105 Ga0157369_10000010 Ga0157369_10000010116 286
601 3300013105 Ga0157369_10001298 Ga0157369_100012984 286
602 3300013105 Ga0157369_10002224 Ga0157369_100022244 286
603 3300013105 Ga0157369_10014377 Ga0157369_100143776 286
604 3300013105 Ga0157369_10129140 Ga0157369_101291403 286
605 3300013296 Ga0157374_10011786 Ga0157374_100117862 286
606 3300013296 Ga0157374_10058451 Ga0157374_100584512 286
607 3300013296 Ga0157374_10070498 Ga0157374_100704982 286
608 3300013297 Ga0157378_10071073 Ga0157378_100710732 286
609 3300013297 Ga0157378_10110347 Ga0157378_101103472 286
610 3300013306 Ga0163162_10043586 Ga0163162_100435861 286
611 3300013307 Ga0157372_10000055 Ga0157372_1000005595 286
612 3300013307 Ga0157372_10005506 Ga0157372_100055065 286
613 3300013307 Ga0157372_10042665 Ga0157372_100426653 286
614 3300013307 Ga0157372_10048425 Ga0157372_100484252 286
615 3300013307 Ga0157372_10134615 Ga0157372_101346152 286
616 3300013307 Ga0157372_10345843 Ga0157372_103458432 286
617 3300014968 Ga0157379_10030324 Ga0157379_100303242 286
618 3300014969 Ga0157376_10042803 Ga0157376_100428036 286
619 3300021361 Ga0213872_10003517 Ga0213872_100035174 286
620 3300022467 Ga0224712_10128408 Ga0224712_101284081 286
621 3300025910 Ga0207684_10044538 Ga0207684_100445381 286
622 3300025911 Ga0207654_10000350 Ga0207654_1000035019 286
623 3300025912 Ga0207707_10061328 Ga0207707_100613283 286
624 3300025913 Ga0207695_10000050 Ga0207695_1000005097 286
625 3300025913 Ga0207695_10000188 Ga0207695_10000188151 286
626 3300025913 Ga0207695_10000787 Ga0207695_1000078736 286
627 3300025913 Ga0207695_10057750 Ga0207695_100577503 286
628 3300025914 Ga0207671_10000324 Ga0207671_1000032420 286
629 3300025917 Ga0207660_10340310 Ga0207660_103403102 286
630 3300025919 Ga0207657_10107113 Ga0207657_101071132 286
631 3300025924 Ga0207694_10000083 Ga0207694_1000008310 286
632 3300025924 Ga0207694_10013782 Ga0207694_100137824 286
633 3300025924 Ga0207694_10014157 Ga0207694_100141571 286
634 3300025939 Ga0207665_10001965 Ga0207665_100019652 286
635 3300025941 Ga0207711_10015831 Ga0207711_100158313 286
636 3300025944 Ga0207661_10120618 Ga0207661_101206182 286
637 3300025949 Ga0207667_10003852 Ga0207667_100038524 286
638 3300025949 Ga0207667_10021968 Ga0207667_100219684 286
639 3300025949 Ga0207667_10041383 Ga0207667_100413833 286
640 3300025949 Ga0207667_10114593 Ga0207667_101145932 286
641 3300025981 Ga0207640_10030970 Ga0207640_100309701 286
642 3300026023 Ga0207677_10595188 Ga0207677_105951881 286
643 3300026041 Ga0207639_10000027 Ga0207639_1000002716 286
644 3300026078 Ga0207702_10001494 Ga0207702_1000149420 286
645 3300026078 Ga0207702_10185384 Ga0207702_101853842 286
646 3300026116 Ga0207674_10013356 Ga0207674_100133566 286
647 3300026142 Ga0207698_10000008 Ga0207698_10000008174 286
648 3300026142 Ga0207698_10000237 Ga0207698_1000023719 286
649 3300028379 Ga0268266_10092298 Ga0268266_100922982 286
650 3300036401 Ga0373937_0013743 Ga0373937_0013743_3576_4436 286
651 3300042005 Ga0439448_0006572 Ga0439448_0006572_2160_3026 286
652 3300046507 Ga0495606_0176823 Ga0495606_0176823_246_1136 286
653 3300046660 Ga0495625_0017649 Ga0495625_0017649_244_1134 286
654 3300046692 Ga0495671_0133217 Ga0495671_0133217_153_1028 286
655 3300046694 Ga0495649_0078066 Ga0495649_0078066_531_1421 286
656 3300047319 Ga0495674_0106197 Ga0495674_0106197_92_973 286
657 3300048929 Ga0496126_0000187 Ga0496126_0000187_28027_28899 286
658 3300049460 Ga0495682_0004897 Ga0495682_0004897_2719_3609 286
659 3300050507 nmdc:mga05p37_404163_c1 nmdc:mga05p37_404163_c1_246_1133 286
660 3300050514 nmdc:mga08x19_10818_c1 nmdc:mga08x19_10818_c1_2045_2932 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05153

MIOX

Myo-inositol oxygenase

109

352

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2huo-assembly1.cif.gz_A crystal structure of mouse myo-inositol oxygenase in complex with substrate 0.9569 35 286
2ibn-assembly1.cif.gz_A crystal structure of human myo-inositol oxygenase (miox) 0.9497 45 286
2ibn-assembly2.cif.gz_B crystal structure of human myo-inositol oxygenase (miox) 0.9358 45 286
2ibn-assembly1.cif.gz_A crystal structure of human myo-inositol oxygenase (miox) 0.9343 45 286
2huo-assembly1.cif.gz_A crystal structure of mouse myo-inositol oxygenase in complex with substrate 0.9317 35 286
ID Description Score Start End Superfamily
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9706 44 286 1.10.3210.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9675 44 286 1.10.3210.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.941 44 286 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9329 44 286 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5318 82 274 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2W0BBD3-F1-model_v4 Inositol oxygenase 0.9965 104 286 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A4S4KQN7-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9861 102 286 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A2W0BBD3-F1-model_v4 Inositol oxygenase 0.9857 104 286 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A3M6XG58-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9821 102 281 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A2N1MRT8-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9818 77 286 GO:0005506
GO:0005737
GO:0019310
GO:0050113

Feature Viewer

pLDDT pTM Quality
85.4 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map