F473347
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 276 | 658 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0070516|Ga0436361_0070516_8604_9662 |
| Length | 352 |
| Sequence | MPPSAQFDWIAASSVMPQASTSAGTQKCMSVRTARTGCCLTACRSLIAVFLAAPGLMPWLLQNYVTLCAAILIHLSAYVKTNEETMGTAARYKEGKSQEEFRQYDAQAVPRVAEFYRQQHENMTVEYVLAKEEEYFTLRKGQKTVWEAAEFLNQLVDDSDPDTDLTQIEHLLQTSEAMRRDNLPRWMVLTGFLHDLGKCLCLYGEPQWGVVGDTFPVGCAWSEHIVFHQYFAKNPDRLNPQYQDLYGIYEPNCGLEKVHMSFGHDGYIGEVMQPYLPDEALYMLRFHSFYPWHKHGAYDHLCNDKDRAMKEWVLKFNQYDLYSKGHSKPDLKELKPYYDDLFAEFLPPTIAW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 102 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 187 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 270 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 273 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 2.58 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 0.61 |
| Rhizosphere | 94.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10006251 | 3300003320 | Bacteria | 11598 |
| 2 | rootH2_10183644 | 3300003320 | Bacteria | 2380 |
| 3 | rootL2_10089696 | 3300003322 | Bacteria | 7437 |
| 4 | rootH1_10319382 | 3300003323 | Unclassified | 2456 |
| 5 | Ga0065707_10150079 | 3300005295 | Bacteria | 1668 |
| 6 | Ga0070658_10006654 | 3300005327 | Bacteria | 9365 |
| 7 | Ga0070658_10007325 | 3300005327 | Bacteria | 8911 |
| 8 | Ga0070658_10027817 | 3300005327 | Bacteria | 4538 |
| 9 | Ga0070683_100000008 | 3300005329 | Bacteria | 329206 |
| 10 | Ga0070683_100001085 | 3300005329 | Bacteria | 20449 |
| 11 | Ga0070683_100106880 | 3300005329 | Bacteria | 2638 |
| 12 | Ga0070683_100240011 | 3300005329 | Bacteria | 1724 |
| 13 | Ga0070683_100248932 | 3300005329 | Bacteria | 1690 |
| 14 | Ga0068869_100009742 | 3300005334 | Bacteria | 6239 |
| 15 | Ga0068869_100025813 | 3300005334 | Bacteria | 4083 |
| 16 | Ga0068869_100029502 | 3300005334 | Bacteria | 3844 |
| 17 | Ga0070666_10029166 | 3300005335 | Unclassified | 3625 |
| 18 | Ga0070682_100069155 | 3300005337 | Bacteria | 2254 |
| 19 | Ga0068868_100011969 | 3300005338 | Bacteria | 6331 |
| 20 | Ga0068868_100038942 | 3300005338 | Unclassified | 3691 |
| 21 | Ga0068868_100041785 | 3300005338 | Unclassified | 3574 |
| 22 | Ga0068868_100158878 | 3300005338 | Bacteria | 1866 |
| 23 | Ga0070660_100006724 | 3300005339 | Bacteria | 7976 |
| 24 | Ga0070660_100195619 | 3300005339 | Bacteria | 1639 |
| 25 | Ga0070661_100016382 | 3300005344 | Bacteria | 5239 |
| 26 | Ga0070661_100059118 | 3300005344 | Bacteria | 2810 |
| 27 | Ga0070661_100143738 | 3300005344 | Unclassified | 1799 |
| 28 | Ga0070675_100045990 | 3300005354 | Bacteria | 3573 |
| 29 | Ga0070671_100056092 | 3300005355 | Bacteria | 3278 |
| 30 | Ga0070671_100307106 | 3300005355 | Bacteria | 1351 |
| 31 | Ga0070673_100093952 | 3300005364 | Bacteria | 2457 |
| 32 | Ga0070673_100132170 | 3300005364 | Unclassified | 2096 |
| 33 | Ga0070659_100006194 | 3300005366 | Bacteria | 8642 |
| 34 | Ga0070659_100007028 | 3300005366 | Bacteria | 8151 |
| 35 | Ga0070667_100292379 | 3300005367 | Unclassified | 1465 |
| 36 | Ga0070703_10004502 | 3300005406 | Bacteria | 3923 |
| 37 | Ga0070709_10003223 | 3300005434 | Bacteria | 8766 |
| 38 | Ga0070709_10004418 | 3300005434 | Bacteria | 7585 |
| 39 | Ga0070709_10213377 | 3300005434 | Bacteria | 1373 |
| 40 | Ga0070709_10274293 | 3300005434 | Bacteria | 1223 |
| 41 | Ga0070709_10279995 | 3300005434 | Unclassified | 1212 |
| 42 | Ga0070714_100014642 | 3300005435 | Bacteria | 6303 |
| 43 | Ga0070714_100449729 | 3300005435 | Bacteria | 1223 |
| 44 | Ga0070713_100001444 | 3300005436 | Bacteria | 15235 |
| 45 | Ga0070713_100023514 | 3300005436 | Bacteria | 4783 |
| 46 | Ga0070713_100081141 | 3300005436 | Unclassified | 2767 |
| 47 | Ga0070713_100139246 | 3300005436 | Bacteria | 2148 |
| 48 | Ga0070710_10013842 | 3300005437 | Bacteria | 4049 |
| 49 | Ga0070711_100002499 | 3300005439 | Bacteria | 10495 |
| 50 | Ga0070711_100322533 | 3300005439 | Unclassified | 1235 |
| 51 | Ga0070711_100388518 | 3300005439 | Bacteria | 1130 |
| 52 | Ga0070705_100037839 | 3300005440 | Bacteria | 2725 |
| 53 | Ga0070705_100139845 | 3300005440 | Bacteria | 1592 |
| 54 | Ga0070694_100011619 | 3300005444 | Bacteria | 5451 |
| 55 | Ga0070708_100016490 | 3300005445 | Bacteria | 6132 |
| 56 | Ga0070708_100018101 | 3300005445 | Bacteria | 5894 |
| 57 | Ga0070708_100035172 | 3300005445 | Bacteria | 4363 |
| 58 | Ga0070663_100054629 | 3300005455 | Bacteria | 2855 |
| 59 | Ga0070663_100396411 | 3300005455 | Bacteria | 1127 |
| 60 | Ga0070678_100013830 | 3300005456 | Bacteria | 5072 |
| 61 | Ga0070662_100066627 | 3300005457 | Bacteria | 2642 |
| 62 | Ga0070662_100295534 | 3300005457 | Bacteria | 1314 |
| 63 | Ga0070681_10007463 | 3300005458 | Bacteria | 10688 |
| 64 | Ga0070681_10047671 | 3300005458 | Bacteria | 4283 |
| 65 | Ga0070681_10086352 | 3300005458 | Bacteria | 3090 |
| 66 | Ga0070681_10123605 | 3300005458 | Unclassified | 2520 |
| 67 | Ga0068867_100002168 | 3300005459 | Bacteria | 13782 |
| 68 | Ga0068867_100024034 | 3300005459 | Bacteria | 4367 |
| 69 | Ga0070706_100002900 | 3300005467 | Bacteria | 17069 |
| 70 | Ga0070706_100045013 | 3300005467 | Unclassified | 4076 |
| 71 | Ga0070706_100050232 | 3300005467 | Bacteria | 3848 |
| 72 | Ga0070706_100117947 | 3300005467 | Bacteria | 2472 |
| 73 | Ga0070707_100005573 | 3300005468 | Bacteria | 11759 |
| 74 | Ga0070707_100256099 | 3300005468 | Bacteria | 1703 |
| 75 | Ga0070698_100002625 | 3300005471 | Bacteria | 19805 |
| 76 | Ga0070698_100057408 | 3300005471 | Unclassified | 3939 |
| 77 | Ga0070698_100065920 | 3300005471 | Unclassified | 3646 |
| 78 | Ga0070699_100008871 | 3300005518 | Bacteria | 8708 |
| 79 | Ga0070699_100251999 | 3300005518 | Bacteria | 1577 |
| 80 | Ga0070679_100061073 | 3300005530 | Bacteria | 3757 |
| 81 | Ga0070679_100072203 | 3300005530 | Bacteria | 3443 |
| 82 | Ga0070679_100088650 | 3300005530 | Bacteria | 3081 |
| 83 | Ga0070679_100117500 | 3300005530 | Bacteria | 2644 |
| 84 | Ga0070679_100154565 | 3300005530 | Bacteria | 2269 |
| 85 | Ga0070679_100168347 | 3300005530 | Bacteria | 2164 |
| 86 | Ga0070679_100367001 | 3300005530 | Bacteria | 1387 |
| 87 | Ga0070684_100000002 | 3300005535 | Bacteria | 257669 |
| 88 | Ga0070684_100016895 | 3300005535 | Bacteria | 5976 |
| 89 | Ga0070697_100013036 | 3300005536 | Bacteria | 6516 |
| 90 | Ga0070697_100013213 | 3300005536 | Bacteria | 6473 |
| 91 | Ga0070697_100318773 | 3300005536 | Bacteria | 1338 |
| 92 | Ga0068853_100000464 | 3300005539 | Bacteria | 27728 |
| 93 | Ga0068853_100001128 | 3300005539 | Bacteria | 18922 |
| 94 | Ga0068853_100011434 | 3300005539 | Bacteria | 7212 |
| 95 | Ga0068853_100073632 | 3300005539 | Bacteria | 2979 |
| 96 | Ga0068853_100084650 | 3300005539 | Bacteria | 2779 |
| 97 | Ga0068853_100281836 | 3300005539 | Bacteria | 1532 |
| 98 | Ga0068853_100548759 | 3300005539 | Unclassified | 1095 |
| 99 | Ga0070672_100021776 | 3300005543 | Bacteria | 4695 |
| 100 | Ga0070696_100012720 | 3300005546 | Bacteria | 5652 |
| 101 | Ga0070696_100469541 | 3300005546 | Bacteria | 996 |
| 102 | Ga0070693_100007359 | 3300005547 | Bacteria | 5379 |
| 103 | Ga0070665_100000918 | 3300005548 | Bacteria | 37791 |
| 104 | Ga0070665_100018880 | 3300005548 | Bacteria | 6915 |
| 105 | Ga0070665_100124781 | 3300005548 | Bacteria | 2577 |
| 106 | Ga0070704_100011412 | 3300005549 | Bacteria | 5446 |
| 107 | Ga0068855_100002442 | 3300005563 | Bacteria | 22946 |
| 108 | Ga0068855_100003189 | 3300005563 | Bacteria | 20091 |
| 109 | Ga0068855_100020104 | 3300005563 | Bacteria | 8018 |
| 110 | Ga0068855_100072726 | 3300005563 | Bacteria | 3995 |
| 111 | Ga0068855_100074626 | 3300005563 | Bacteria | 3938 |
| 112 | Ga0068855_100119528 | 3300005563 | Bacteria | 3017 |
| 113 | Ga0068855_100230718 | 3300005563 | Bacteria | 2073 |
| 114 | Ga0068855_100559090 | 3300005563 | Unclassified | 1238 |
| 115 | Ga0068855_100602183 | 3300005563 | Unclassified | 1185 |
| 116 | Ga0070664_100006730 | 3300005564 | Bacteria | 9264 |
| 117 | Ga0070664_100231162 | 3300005564 | Bacteria | 1657 |
| 118 | Ga0070664_100469749 | 3300005564 | Unclassified | 1156 |
| 119 | Ga0068857_100042707 | 3300005577 | Bacteria | 4022 |
| 120 | Ga0068857_100046601 | 3300005577 | Bacteria | 3847 |
| 121 | Ga0068857_100102908 | 3300005577 | Bacteria | 2564 |
| 122 | Ga0068854_100000003 | 3300005578 | Bacteria | 330045 |
| 123 | Ga0068854_100002113 | 3300005578 | Bacteria | 12178 |
| 124 | Ga0068854_100004181 | 3300005578 | Bacteria | 9084 |
| 125 | Ga0068854_100161759 | 3300005578 | Bacteria | 1734 |
| 126 | Ga0068854_100494323 | 3300005578 | Bacteria | 1029 |
| 127 | Ga0068856_100002181 | 3300005614 | Bacteria | 20302 |
| 128 | Ga0068856_100011264 | 3300005614 | Bacteria | 8680 |
| 129 | Ga0068856_100018356 | 3300005614 | Bacteria | 6779 |
| 130 | Ga0068856_100022060 | 3300005614 | Bacteria | 6191 |
| 131 | Ga0068856_100029012 | 3300005614 | Bacteria | 5406 |
| 132 | Ga0068856_100092143 | 3300005614 | Bacteria | 3015 |
| 133 | Ga0068856_100111328 | 3300005614 | Bacteria | 2735 |
| 134 | Ga0068856_100166330 | 3300005614 | Bacteria | 2216 |
| 135 | Ga0068856_100312505 | 3300005614 | Bacteria | 1589 |
| 136 | Ga0068856_100327532 | 3300005614 | Bacteria | 1549 |
| 137 | Ga0068856_100540194 | 3300005614 | Bacteria | 1187 |
| 138 | Ga0068852_100000032 | 3300005616 | Bacteria | 102480 |
| 139 | Ga0068852_100000199 | 3300005616 | Bacteria | 40929 |
| 140 | Ga0068852_100065221 | 3300005616 | Bacteria | 3176 |
| 141 | Ga0068852_100083891 | 3300005616 | Unclassified | 2834 |
| 142 | Ga0068852_100494862 | 3300005616 | Bacteria | 1217 |
| 143 | Ga0068852_100535218 | 3300005616 | Bacteria | 1170 |
| 144 | Ga0068859_100002369 | 3300005617 | Bacteria | 19177 |
| 145 | Ga0068859_100020434 | 3300005617 | Bacteria | 6645 |
| 146 | Ga0068859_100332786 | 3300005617 | Bacteria | 1613 |
| 147 | Ga0068859_100434397 | 3300005617 | Unclassified | 1409 |
| 148 | Ga0068859_100489876 | 3300005617 | Bacteria | 1325 |
| 149 | Ga0068864_100002900 | 3300005618 | Bacteria | 14176 |
| 150 | Ga0068864_100018903 | 3300005618 | Bacteria | 5761 |
| 151 | Ga0068866_10126563 | 3300005718 | Unclassified | 1447 |
| 152 | Ga0068861_100077420 | 3300005719 | Bacteria | 2594 |
| 153 | Ga0068851_10090688 | 3300005834 | Unclassified | 1608 |
| 154 | Ga0068863_100029216 | 3300005841 | Bacteria | 5264 |
| 155 | Ga0068863_100066822 | 3300005841 | Bacteria | 3401 |
| 156 | Ga0068863_100086118 | 3300005841 | Bacteria | 2977 |
| 157 | Ga0068858_100001259 | 3300005842 | Bacteria | 26209 |
| 158 | Ga0068858_100001498 | 3300005842 | Bacteria | 24088 |
| 159 | Ga0068858_100176902 | 3300005842 | Unclassified | 2014 |
| 160 | Ga0068858_100339292 | 3300005842 | Unclassified | 1438 |
| 161 | Ga0068862_100170424 | 3300005844 | Bacteria | 1949 |
| 162 | Ga0081455_10039483 | 3300005937 | Unclassified | 4170 |
| 163 | Ga0081455_10055778 | 3300005937 | Bacteria | 3359 |
| 164 | Ga0070717_10000582 | 3300006028 | Bacteria | 23306 |
| 165 | Ga0070717_10003870 | 3300006028 | Viruses | 10763 |
| 166 | Ga0070717_10005337 | 3300006028 | Bacteria | 9369 |
| 167 | Ga0070716_100013778 | 3300006173 | Bacteria | 4129 |
| 168 | Ga0070716_100135434 | 3300006173 | Unclassified | 1563 |
| 169 | Ga0070712_100002219 | 3300006175 | Bacteria | 11949 |
| 170 | Ga0097621_100015795 | 3300006237 | Bacteria | 5692 |
| 171 | Ga0097621_100046311 | 3300006237 | Unclassified | 3519 |
| 172 | Ga0097621_100107116 | 3300006237 | Unclassified | 2358 |
| 173 | Ga0097621_100161562 | 3300006237 | Bacteria | 1926 |
| 174 | Ga0068871_100048371 | 3300006358 | Unclassified | 3433 |
| 175 | Ga0068871_100107333 | 3300006358 | Bacteria | 2345 |
| 176 | Ga0068871_100339484 | 3300006358 | Bacteria | 1326 |
| 177 | Ga0075430_100303111 | 3300006846 | Bacteria | 1321 |
| 178 | Ga0075431_100067137 | 3300006847 | Bacteria | 3702 |
| 179 | Ga0075433_10002750 | 3300006852 | Bacteria | 13457 |
| 180 | Ga0075433_10020438 | 3300006852 | Bacteria | 5536 |
| 181 | Ga0075434_100034834 | 3300006871 | Bacteria | 4974 |
| 182 | Ga0068865_100031172 | 3300006881 | Bacteria | 3553 |
| 183 | Ga0068865_100118821 | 3300006881 | Bacteria | 1962 |
| 184 | Ga0075436_100004130 | 3300006914 | Bacteria | 9961 |
| 185 | Ga0075436_100009950 | 3300006914 | Bacteria | 6505 |
| 186 | Ga0075436_100251254 | 3300006914 | Bacteria | 1259 |
| 187 | Ga0097620_100002369 | 3300006931 | Bacteria | 19177 |
| 188 | Ga0097620_100020434 | 3300006931 | Bacteria | 6645 |
| 189 | Ga0097620_100332784 | 3300006931 | Bacteria | 1613 |
| 190 | Ga0097620_100434453 | 3300006931 | Unclassified | 1409 |
| 191 | Ga0097620_100489893 | 3300006931 | Bacteria | 1325 |
| 192 | Ga0075435_100104544 | 3300007076 | Bacteria | 2349 |
| 193 | Ga0075435_100190720 | 3300007076 | Unclassified | 1735 |
| 194 | Ga0075435_100315346 | 3300007076 | Bacteria | 1338 |
| 195 | Ga0099794_10031748 | 3300007265 | Bacteria | 2475 |
| 196 | Ga0099794_10209153 | 3300007265 | Bacteria | 1000 |
| 197 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 198 | Ga0105240_10000135 | 3300009093 | Bacteria | 151432 |
| 199 | Ga0105240_10017310 | 3300009093 | Bacteria | 9717 |
| 200 | Ga0105240_10020798 | 3300009093 | Bacteria | 8741 |
| 201 | Ga0105240_10031912 | 3300009093 | Bacteria | 6826 |
| 202 | Ga0105240_10054690 | 3300009093 | Bacteria | 5001 |
| 203 | Ga0105240_10076260 | 3300009093 | Unclassified | 4133 |
| 204 | Ga0105240_10085141 | 3300009093 | Bacteria | 3874 |
| 205 | Ga0105240_10125112 | 3300009093 | Bacteria | 3091 |
| 206 | Ga0105240_10195396 | 3300009093 | Bacteria | 2376 |
| 207 | Ga0105240_10225424 | 3300009093 | Bacteria | 2181 |
| 208 | Ga0105240_10921485 | 3300009093 | Bacteria | 939 |
| 209 | Ga0111539_10005961 | 3300009094 | Bacteria | 15739 |
| 210 | Ga0105245_10020916 | 3300009098 | Bacteria | 5736 |
| 211 | Ga0105245_10043376 | 3300009098 | Unclassified | 4012 |
| 212 | Ga0105245_10067429 | 3300009098 | Bacteria | 3241 |
| 213 | Ga0105245_10161177 | 3300009098 | Bacteria | 2129 |
| 214 | Ga0105243_10116909 | 3300009148 | Bacteria | 2241 |
| 215 | Ga0105241_10081792 | 3300009174 | Bacteria | 2531 |
| 216 | Ga0105241_10361780 | 3300009174 | Bacteria | 1263 |
| 217 | Ga0105248_10000319 | 3300009177 | Bacteria | 56800 |
| 218 | Ga0105248_10001668 | 3300009177 | Bacteria | 24702 |
| 219 | Ga0105248_10013472 | 3300009177 | Bacteria | 9004 |
| 220 | Ga0105248_10074437 | 3300009177 | Bacteria | 3817 |
| 221 | Ga0105248_10104724 | 3300009177 | Bacteria | 3190 |
| 222 | Ga0105248_10210392 | 3300009177 | Bacteria | 2191 |
| 223 | Ga0105237_10014461 | 3300009545 | Bacteria | 8250 |
| 224 | Ga0105237_10071127 | 3300009545 | Unclassified | 3474 |
| 225 | Ga0105237_10191985 | 3300009545 | Bacteria | 2042 |
| 226 | Ga0105238_10000726 | 3300009551 | Bacteria | 34413 |
| 227 | Ga0105238_10023719 | 3300009551 | Bacteria | 6253 |
| 228 | Ga0105238_10110247 | 3300009551 | Bacteria | 2733 |
| 229 | Ga0105238_10165817 | 3300009551 | Bacteria | 2185 |
| 230 | Ga0105238_10505285 | 3300009551 | Unclassified | 1210 |
| 231 | Ga0105249_10174381 | 3300009553 | Unclassified | 2087 |
| 232 | Ga0105239_10002093 | 3300010375 | Bacteria | 25850 |
| 233 | Ga0105239_10058528 | 3300010375 | Bacteria | 4229 |
| 234 | Ga0105239_10079970 | 3300010375 | Bacteria | 3597 |
| 235 | Ga0105239_10248459 | 3300010375 | Unclassified | 1998 |
| 236 | Ga0105239_10525020 | 3300010375 | Bacteria | 1347 |
| 237 | Ga0105246_10005875 | 3300011119 | Bacteria | 7487 |
| 238 | Ga0157373_10021622 | 3300013100 | Bacteria | 4670 |
| 239 | Ga0157373_10128449 | 3300013100 | Unclassified | 1782 |
| 240 | Ga0157370_10000023 | 3300013104 | Bacteria | 161359 |
| 241 | Ga0157370_10027433 | 3300013104 | Bacteria | 5614 |
| 242 | Ga0157370_10044595 | 3300013104 | Bacteria | 4260 |
| 243 | Ga0157370_10047287 | 3300013104 | Bacteria | 4125 |
| 244 | Ga0157370_10060654 | 3300013104 | Bacteria | 3591 |
| 245 | Ga0157370_10090725 | 3300013104 | Bacteria | 2869 |
| 246 | Ga0157370_10315182 | 3300013104 | Bacteria | 1443 |
| 247 | Ga0157369_10000010 | 3300013105 | Bacteria | 273443 |
| 248 | Ga0157369_10001298 | 3300013105 | Bacteria | 31051 |
| 249 | Ga0157369_10002224 | 3300013105 | Bacteria | 23356 |
| 250 | Ga0157369_10010557 | 3300013105 | Bacteria | 10509 |
| 251 | Ga0157369_10013277 | 3300013105 | Bacteria | 9321 |
| 252 | Ga0157369_10014377 | 3300013105 | Bacteria | 8938 |
| 253 | Ga0157369_10029511 | 3300013105 | Bacteria | 6060 |
| 254 | Ga0157369_10032611 | 3300013105 | Bacteria | 5727 |
| 255 | Ga0157369_10103507 | 3300013105 | Unclassified | 3033 |
| 256 | Ga0157369_10129140 | 3300013105 | Bacteria | 2679 |
| 257 | Ga0157369_10305573 | 3300013105 | Bacteria | 1654 |
| 258 | Ga0157369_10336572 | 3300013105 | Bacteria | 1568 |
| 259 | Ga0157374_10011786 | 3300013296 | Bacteria | 7585 |
| 260 | Ga0157374_10016789 | 3300013296 | Bacteria | 6441 |
| 261 | Ga0157374_10017924 | 3300013296 | Bacteria | 6240 |
| 262 | Ga0157374_10043305 | 3300013296 | Bacteria | 4158 |
| 263 | Ga0157374_10057426 | 3300013296 | Bacteria | 3635 |
| 264 | Ga0157374_10058451 | 3300013296 | Bacteria | 3603 |
| 265 | Ga0157374_10070498 | 3300013296 | Bacteria | 3294 |
| 266 | Ga0157374_10119638 | 3300013296 | Bacteria | 2540 |
| 267 | Ga0157374_10517090 | 3300013296 | Bacteria | 1199 |
| 268 | Ga0157378_10000263 | 3300013297 | Bacteria | 51475 |
| 269 | Ga0157378_10002951 | 3300013297 | Bacteria | 15127 |
| 270 | Ga0157378_10070302 | 3300013297 | Unclassified | 3142 |
| 271 | Ga0157378_10071073 | 3300013297 | Bacteria | 3125 |
| 272 | Ga0157378_10110347 | 3300013297 | Bacteria | 2521 |
| 273 | Ga0157378_10262987 | 3300013297 | Unclassified | 1656 |
| 274 | Ga0163162_10038339 | 3300013306 | Bacteria | 4782 |
| 275 | Ga0163162_10043586 | 3300013306 | Bacteria | 4493 |
| 276 | Ga0163162_10063172 | 3300013306 | Bacteria | 3744 |
| 277 | Ga0157372_10000055 | 3300013307 | Bacteria | 126308 |
| 278 | Ga0157372_10000982 | 3300013307 | Bacteria | 31143 |
| 279 | Ga0157372_10002405 | 3300013307 | Bacteria | 20274 |
| 280 | Ga0157372_10005506 | 3300013307 | Bacteria | 13460 |
| 281 | Ga0157372_10023742 | 3300013307 | Bacteria | 6652 |
| 282 | Ga0157372_10042665 | 3300013307 | Bacteria | 5019 |
| 283 | Ga0157372_10048425 | 3300013307 | Bacteria | 4725 |
| 284 | Ga0157372_10064666 | 3300013307 | Bacteria | 4104 |
| 285 | Ga0157372_10080653 | 3300013307 | Bacteria | 3683 |
| 286 | Ga0157372_10117245 | 3300013307 | Unclassified | 3054 |
| 287 | Ga0157372_10134615 | 3300013307 | Bacteria | 2845 |
| 288 | Ga0157372_10142527 | 3300013307 | Unclassified | 2762 |
| 289 | Ga0157372_10200053 | 3300013307 | Unclassified | 2314 |
| 290 | Ga0157372_10252388 | 3300013307 | Bacteria | 2048 |
| 291 | Ga0157372_10316871 | 3300013307 | Bacteria | 1816 |
| 292 | Ga0157372_10345843 | 3300013307 | Bacteria | 1733 |
| 293 | Ga0157375_10070316 | 3300013308 | Bacteria | 3510 |
| 294 | Ga0157375_10098750 | 3300013308 | Bacteria | 2997 |
| 295 | Ga0157375_10187695 | 3300013308 | Bacteria | 2221 |
| 296 | Ga0157375_10473362 | 3300013308 | Bacteria | 1418 |
| 297 | Ga0163163_10022326 | 3300014325 | Bacteria | 5989 |
| 298 | Ga0163163_10132651 | 3300014325 | Bacteria | 2531 |
| 299 | Ga0157379_10030324 | 3300014968 | Bacteria | 4813 |
| 300 | Ga0157379_10174706 | 3300014968 | Bacteria | 1939 |
| 301 | Ga0157376_10000041 | 3300014969 | Bacteria | 120988 |
| 302 | Ga0157376_10023861 | 3300014969 | Bacteria | 4795 |
| 303 | Ga0157376_10042803 | 3300014969 | Bacteria | 3713 |
| 304 | Ga0157376_10044463 | 3300014969 | Bacteria | 3651 |
| 305 | Ga0157376_10805989 | 3300014969 | Bacteria | 952 |
| 306 | Ga0163161_10055232 | 3300017792 | Bacteria | 2883 |
| 307 | Ga0197907_10130176 | 3300020069 | Bacteria | 1112 |
| 308 | Ga0197907_10200061 | 3300020069 | Bacteria | 1372 |
| 309 | Ga0206356_10197226 | 3300020070 | Bacteria | 1029 |
| 310 | Ga0206355_1393545 | 3300020076 | Bacteria | 970 |
| 311 | Ga0206355_1640260 | 3300020076 | Bacteria | 1747 |
| 312 | Ga0206351_10618912 | 3300020077 | Bacteria | 1135 |
| 313 | Ga0206352_10915830 | 3300020078 | Bacteria | 1118 |
| 314 | Ga0206350_11571727 | 3300020080 | Bacteria | 2170 |
| 315 | Ga0206353_12047086 | 3300020082 | Unclassified | 1045 |
| 316 | Ga0154015_1398831 | 3300020610 | Unclassified | 1833 |
| 317 | Ga0213872_10003517 | 3300021361 | Bacteria | 8657 |
| 318 | Ga0213872_10024260 | 3300021361 | Unclassified | 2789 |
| 319 | Ga0213872_10039843 | 3300021361 | Bacteria | 2144 |
| 320 | Ga0213872_10063524 | 3300021361 | Unclassified | 1668 |
| 321 | Ga0213875_10000017 | 3300021388 | Bacteria | 239813 |
| 322 | Ga0213875_10012867 | 3300021388 | Bacteria | 4123 |
| 323 | Ga0213875_10076329 | 3300021388 | Bacteria | 1564 |
| 324 | Ga0213871_10038393 | 3300021441 | Bacteria | 1278 |
| 325 | Ga0224712_10077080 | 3300022467 | Bacteria | 1367 |
| 326 | Ga0224712_10128408 | 3300022467 | Bacteria | 1105 |
| 327 | Ga0224712_10191885 | 3300022467 | Bacteria | 925 |
| 328 | Ga0224712_10202143 | 3300022467 | Bacteria | 903 |
| 329 | Ga0228598_1011194 | 3300024227 | Bacteria | 1786 |
| 330 | Ga0207656_10050977 | 3300025321 | Bacteria | 1789 |
| 331 | Ga0207653_10008013 | 3300025885 | Bacteria | 3292 |
| 332 | Ga0207692_10014933 | 3300025898 | Bacteria | 3405 |
| 333 | Ga0207680_10166360 | 3300025903 | Bacteria | 1482 |
| 334 | Ga0207647_10003063 | 3300025904 | Bacteria | 12562 |
| 335 | Ga0207647_10013832 | 3300025904 | Bacteria | 5588 |
| 336 | Ga0207647_10025602 | 3300025904 | Bacteria | 3873 |
| 337 | Ga0207647_10027843 | 3300025904 | Bacteria | 3680 |
| 338 | Ga0207699_10285433 | 3300025906 | Unclassified | 1148 |
| 339 | Ga0207643_10019835 | 3300025908 | Bacteria | 3685 |
| 340 | Ga0207705_10003727 | 3300025909 | Bacteria | 11601 |
| 341 | Ga0207705_10030086 | 3300025909 | Bacteria | 3873 |
| 342 | Ga0207705_10031987 | 3300025909 | Bacteria | 3758 |
| 343 | Ga0207705_10228848 | 3300025909 | Unclassified | 1414 |
| 344 | Ga0207705_10340632 | 3300025909 | Bacteria | 1154 |
| 345 | Ga0207684_10001901 | 3300025910 | Bacteria | 21698 |
| 346 | Ga0207684_10015475 | 3300025910 | Bacteria | 6563 |
| 347 | Ga0207684_10040662 | 3300025910 | Unclassified | 3941 |
| 348 | Ga0207684_10044538 | 3300025910 | Bacteria | 3763 |
| 349 | Ga0207654_10000350 | 3300025911 | Bacteria | 27453 |
| 350 | Ga0207654_10083341 | 3300025911 | Bacteria | 1930 |
| 351 | Ga0207707_10016653 | 3300025912 | Bacteria | 6407 |
| 352 | Ga0207707_10058238 | 3300025912 | Bacteria | 3362 |
| 353 | Ga0207707_10061328 | 3300025912 | Bacteria | 3272 |
| 354 | Ga0207707_10090259 | 3300025912 | Bacteria | 2678 |
| 355 | Ga0207707_10101603 | 3300025912 | Unclassified | 2513 |
| 356 | Ga0207707_10288165 | 3300025912 | Bacteria | 1421 |
| 357 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 358 | Ga0207695_10000050 | 3300025913 | Bacteria | 405727 |
| 359 | Ga0207695_10000177 | 3300025913 | Bacteria | 185955 |
| 360 | Ga0207695_10000188 | 3300025913 | Bacteria | 178721 |
| 361 | Ga0207695_10000787 | 3300025913 | Bacteria | 59756 |
| 362 | Ga0207695_10023116 | 3300025913 | Bacteria | 7035 |
| 363 | Ga0207695_10057750 | 3300025913 | Bacteria | 4031 |
| 364 | Ga0207695_10057769 | 3300025913 | Bacteria | 4030 |
| 365 | Ga0207695_10084966 | 3300025913 | Bacteria | 3194 |
| 366 | Ga0207695_10129495 | 3300025913 | Bacteria | 2482 |
| 367 | Ga0207695_10329851 | 3300025913 | Bacteria | 1415 |
| 368 | Ga0207671_10000324 | 3300025914 | Bacteria | 70145 |
| 369 | Ga0207671_10027024 | 3300025914 | Bacteria | 4293 |
| 370 | Ga0207671_10051647 | 3300025914 | Bacteria | 3047 |
| 371 | Ga0207671_10059752 | 3300025914 | Bacteria | 2827 |
| 372 | Ga0207671_10092267 | 3300025914 | Bacteria | 2283 |
| 373 | Ga0207671_10100994 | 3300025914 | Bacteria | 2185 |
| 374 | Ga0207671_10245443 | 3300025914 | Bacteria | 1407 |
| 375 | Ga0207693_10002318 | 3300025915 | Bacteria | 16545 |
| 376 | Ga0207693_10047808 | 3300025915 | Bacteria | 3361 |
| 377 | Ga0207693_10208619 | 3300025915 | Bacteria | 1536 |
| 378 | Ga0207663_10000716 | 3300025916 | Bacteria | 14786 |
| 379 | Ga0207660_10014861 | 3300025917 | Bacteria | 5131 |
| 380 | Ga0207660_10340310 | 3300025917 | Bacteria | 1201 |
| 381 | Ga0207657_10001188 | 3300025919 | Bacteria | 27666 |
| 382 | Ga0207657_10039381 | 3300025919 | Bacteria | 4201 |
| 383 | Ga0207657_10107113 | 3300025919 | Bacteria | 2312 |
| 384 | Ga0207657_10233532 | 3300025919 | Bacteria | 1470 |
| 385 | Ga0207649_10041209 | 3300025920 | Bacteria | 2810 |
| 386 | Ga0207649_10158915 | 3300025920 | Unclassified | 1564 |
| 387 | Ga0207649_10214116 | 3300025920 | Bacteria | 1368 |
| 388 | Ga0207652_10019678 | 3300025921 | Bacteria | 5554 |
| 389 | Ga0207652_10175829 | 3300025921 | Bacteria | 1923 |
| 390 | Ga0207652_10587535 | 3300025921 | Bacteria | 999 |
| 391 | Ga0207646_10075160 | 3300025922 | Unclassified | 3019 |
| 392 | Ga0207646_10239272 | 3300025922 | Bacteria | 1640 |
| 393 | Ga0207694_10000083 | 3300025924 | Bacteria | 109611 |
| 394 | Ga0207694_10013782 | 3300025924 | Bacteria | 6094 |
| 395 | Ga0207694_10014157 | 3300025924 | Bacteria | 6014 |
| 396 | Ga0207694_10082987 | 3300025924 | Bacteria | 2519 |
| 397 | Ga0207659_10427694 | 3300025926 | Unclassified | 1111 |
| 398 | Ga0207687_10041781 | 3300025927 | Bacteria | 3151 |
| 399 | Ga0207687_10274703 | 3300025927 | Bacteria | 1348 |
| 400 | Ga0207700_10034308 | 3300025928 | Bacteria | 3642 |
| 401 | Ga0207664_10053848 | 3300025929 | Unclassified | 3187 |
| 402 | Ga0207664_10152319 | 3300025929 | Bacteria | 1965 |
| 403 | Ga0207664_10185904 | 3300025929 | Bacteria | 1786 |
| 404 | Ga0207644_10019102 | 3300025931 | Bacteria | 4646 |
| 405 | Ga0207690_10003397 | 3300025932 | Bacteria | 9510 |
| 406 | Ga0207690_10020087 | 3300025932 | Bacteria | 4122 |
| 407 | Ga0207706_10021352 | 3300025933 | Bacteria | 5817 |
| 408 | Ga0207686_10103748 | 3300025934 | Unclassified | 1903 |
| 409 | Ga0207709_10063461 | 3300025935 | Bacteria | 2315 |
| 410 | Ga0207704_10145718 | 3300025938 | Unclassified | 1663 |
| 411 | Ga0207665_10001965 | 3300025939 | Bacteria | 13839 |
| 412 | Ga0207665_10006036 | 3300025939 | Bacteria | 8048 |
| 413 | Ga0207665_10014502 | 3300025939 | Bacteria | 5191 |
| 414 | Ga0207665_10271740 | 3300025939 | Unclassified | 1259 |
| 415 | Ga0207711_10000225 | 3300025941 | Bacteria | 60644 |
| 416 | Ga0207711_10015831 | 3300025941 | Bacteria | 6256 |
| 417 | Ga0207711_10061798 | 3300025941 | Bacteria | 3230 |
| 418 | Ga0207711_10062341 | 3300025941 | Bacteria | 3216 |
| 419 | Ga0207711_10667878 | 3300025941 | Bacteria | 969 |
| 420 | Ga0207689_10036312 | 3300025942 | Bacteria | 4092 |
| 421 | Ga0207689_10144450 | 3300025942 | Bacteria | 1960 |
| 422 | Ga0207661_10000008 | 3300025944 | Bacteria | 451211 |
| 423 | Ga0207661_10019594 | 3300025944 | Bacteria | 5047 |
| 424 | Ga0207661_10065336 | 3300025944 | Bacteria | 2953 |
| 425 | Ga0207661_10120618 | 3300025944 | Bacteria | 2232 |
| 426 | Ga0207661_10296383 | 3300025944 | Bacteria | 1449 |
| 427 | Ga0207679_10037403 | 3300025945 | Bacteria | 3450 |
| 428 | Ga0207667_10000251 | 3300025949 | Bacteria | 75691 |
| 429 | Ga0207667_10003852 | 3300025949 | Bacteria | 18451 |
| 430 | Ga0207667_10021968 | 3300025949 | Bacteria | 7062 |
| 431 | Ga0207667_10022480 | 3300025949 | Bacteria | 6966 |
| 432 | Ga0207667_10041383 | 3300025949 | Bacteria | 4901 |
| 433 | Ga0207667_10114593 | 3300025949 | Bacteria | 2778 |
| 434 | Ga0207667_10240988 | 3300025949 | Bacteria | 1851 |
| 435 | Ga0207667_10270016 | 3300025949 | Bacteria | 1739 |
| 436 | Ga0207667_10356585 | 3300025949 | Unclassified | 1491 |
| 437 | Ga0207667_10433034 | 3300025949 | Bacteria | 1337 |
| 438 | Ga0207667_10469016 | 3300025949 | Unclassified | 1278 |
| 439 | Ga0207668_10252083 | 3300025972 | Bacteria | 1434 |
| 440 | Ga0207640_10000002 | 3300025981 | Bacteria | 524211 |
| 441 | Ga0207640_10030970 | 3300025981 | Bacteria | 3301 |
| 442 | Ga0207640_10159441 | 3300025981 | Unclassified | 1667 |
| 443 | Ga0207640_10333582 | 3300025981 | Bacteria | 1212 |
| 444 | Ga0207677_10006069 | 3300026023 | Bacteria | 6591 |
| 445 | Ga0207677_10085924 | 3300026023 | Bacteria | 2272 |
| 446 | Ga0207677_10128172 | 3300026023 | Unclassified | 1921 |
| 447 | Ga0207677_10370796 | 3300026023 | Bacteria | 1205 |
| 448 | Ga0207677_10595188 | 3300026023 | Bacteria | 970 |
| 449 | Ga0207703_10001373 | 3300026035 | Bacteria | 22244 |
| 450 | Ga0207703_10210257 | 3300026035 | Unclassified | 1734 |
| 451 | Ga0207639_10000011 | 3300026041 | Bacteria | 381897 |
| 452 | Ga0207639_10000027 | 3300026041 | Bacteria | 197829 |
| 453 | Ga0207639_10078842 | 3300026041 | Bacteria | 2601 |
| 454 | Ga0207639_10112542 | 3300026041 | Unclassified | 2221 |
| 455 | Ga0207678_10000939 | 3300026067 | Bacteria | 26562 |
| 456 | Ga0207678_10001450 | 3300026067 | Bacteria | 21798 |
| 457 | Ga0207678_10002208 | 3300026067 | Bacteria | 17582 |
| 458 | Ga0207678_10103054 | 3300026067 | Bacteria | 2436 |
| 459 | Ga0207678_10119063 | 3300026067 | Bacteria | 2253 |
| 460 | Ga0207678_10195653 | 3300026067 | Bacteria | 1728 |
| 461 | Ga0207702_10001494 | 3300026078 | Bacteria | 23124 |
| 462 | Ga0207702_10001578 | 3300026078 | Bacteria | 22564 |
| 463 | Ga0207702_10012061 | 3300026078 | Bacteria | 7187 |
| 464 | Ga0207702_10185384 | 3300026078 | Bacteria | 1919 |
| 465 | Ga0207702_10383903 | 3300026078 | Bacteria | 1351 |
| 466 | Ga0207702_10479433 | 3300026078 | Bacteria | 1210 |
| 467 | Ga0207641_10031687 | 3300026088 | Unclassified | 4385 |
| 468 | Ga0207641_10033103 | 3300026088 | Bacteria | 4294 |
| 469 | Ga0207641_10054514 | 3300026088 | Bacteria | 3393 |
| 470 | Ga0207641_10207608 | 3300026088 | Bacteria | 1810 |
| 471 | Ga0207641_10248438 | 3300026088 | Bacteria | 1660 |
| 472 | Ga0207648_10014946 | 3300026089 | Bacteria | 7153 |
| 473 | Ga0207648_10026270 | 3300026089 | Bacteria | 5176 |
| 474 | Ga0207648_10435950 | 3300026089 | Bacteria | 1191 |
| 475 | Ga0207676_10096187 | 3300026095 | Bacteria | 2444 |
| 476 | Ga0207676_10107474 | 3300026095 | Bacteria | 2327 |
| 477 | Ga0207676_10236698 | 3300026095 | Bacteria | 1635 |
| 478 | Ga0207674_10000560 | 3300026116 | Bacteria | 48628 |
| 479 | Ga0207674_10001500 | 3300026116 | Bacteria | 30118 |
| 480 | Ga0207674_10013356 | 3300026116 | Bacteria | 9117 |
| 481 | Ga0207674_10523908 | 3300026116 | Bacteria | 1145 |
| 482 | Ga0207683_10007557 | 3300026121 | Bacteria | 9314 |
| 483 | Ga0207698_10000008 | 3300026142 | Bacteria | 281991 |
| 484 | Ga0207698_10000237 | 3300026142 | Bacteria | 34479 |
| 485 | Ga0207698_10122389 | 3300026142 | Bacteria | 2205 |
| 486 | Ga0207698_10207725 | 3300026142 | Bacteria | 1759 |
| 487 | Ga0209588_1012353 | 3300027671 | Bacteria | 2592 |
| 488 | Ga0207428_10041838 | 3300027907 | Bacteria | 3708 |
| 489 | Ga0268266_10000144 | 3300028379 | Bacteria | 135508 |
| 490 | Ga0268266_10016406 | 3300028379 | Bacteria | 6332 |
| 491 | Ga0268266_10092298 | 3300028379 | Bacteria | 2656 |
| 492 | Ga0268266_10283844 | 3300028379 | Unclassified | 1540 |
| 493 | Ga0268266_10392128 | 3300028379 | Bacteria | 1311 |
| 494 | Ga0268265_10182032 | 3300028380 | Bacteria | 1806 |
| 495 | Ga0268264_10006871 | 3300028381 | Bacteria | 9551 |
| 496 | Ga0268264_10049888 | 3300028381 | Bacteria | 3484 |
| 497 | Ga0265338_10189767 | 3300028800 | Unclassified | 1559 |
| 498 | Ga0265328_10050767 | 3300031239 | Unclassified | 1523 |
| 499 | Ga0265339_10000694 | 3300031249 | Bacteria | 26062 |
| 500 | Ga0265313_10116693 | 3300031595 | Unclassified | 1168 |
| 501 | Ga0307413_10152124 | 3300031824 | Eukaryota | 1614 |
| 502 | Ga0307510_10057547 | 3300033180 | Bacteria | 4034 |
| 503 | Ga0307510_10090625 | 3300033180 | Bacteria | 2903 |
| 504 | Ga0307510_10198442 | 3300033180 | Bacteria | 1545 |
| 505 | Ga0373926_0004932 | 3300035083 | Bacteria | 4382 |
| 506 | Ga0373946_0019411 | 3300035171 | Unclassified | 2619 |
| 507 | Ga0373927_0003524 | 3300035695 | Bacteria | 11200 |
| 508 | Ga0373927_0068300 | 3300035695 | Unclassified | 2300 |
| 509 | Ga0373947_0006601 | 3300035725 | Bacteria | 6734 |
| 510 | Ga0373937_0013743 | 3300036401 | Bacteria | 7134 |
| 511 | Ga0373937_0495471 | 3300036401 | Unclassified | 1161 |
| 512 | Ga0373925_0004006 | 3300037068 | Bacteria | 11208 |
| 513 | Ga0395900_0096834 | 3300037418 | Bacteria | 3032 |
| 514 | Ga0395898_0026273 | 3300037466 | Bacteria | 5861 |
| 515 | Ga0395898_0514315 | 3300037466 | Bacteria | 1138 |
| 516 | Ga0436364_0074911 | 3300037853 | Bacteria | 2024 |
| 517 | Ga0436364_0103870 | 3300037853 | Bacteria | 1759 |
| 518 | Ga0436364_0339530 | 3300037853 | Bacteria | 240640 |
| 519 | Ga0436364_0609851 | 3300037853 | Bacteria | 5444 |
| 520 | Ga0436364_0787170 | 3300037853 | Bacteria | 16621 |
| 521 | Ga0436364_0814149 | 3300037853 | Bacteria | 1378 |
| 522 | Ga0436364_0880534 | 3300037853 | Bacteria | 127762 |
| 523 | Ga0436364_1041147 | 3300037853 | Unclassified | 2890 |
| 524 | Ga0436365_0894537 | 3300039437 | Bacteria | 3691 |
| 525 | Ga0436365_0960146 | 3300039437 | Bacteria | 4727 |
| 526 | Ga0436365_1584098 | 3300039437 | Bacteria | 3527 |
| 527 | Ga0436360_0111215 | 3300039438 | Bacteria | 8281 |
| 528 | Ga0436360_0654204 | 3300039438 | Bacteria | 2128 |
| 529 | Ga0436360_0673809 | 3300039438 | Unclassified | 2750 |
| 530 | Ga0436360_1304700 | 3300039438 | Bacteria | 20254 |
| 531 | Ga0436361_0070516 | 3300039447 | Bacteria | 11016 |
| 532 | Ga0436361_0195153 | 3300039447 | Bacteria | 2318 |
| 533 | Ga0436361_0248901 | 3300039447 | Bacteria | 25197 |
| 534 | Ga0436361_0539608 | 3300039447 | Bacteria | 3865 |
| 535 | Ga0436361_0761235 | 3300039447 | Bacteria | 90297 |
| 536 | Ga0436363_0226217 | 3300039450 | Bacteria | 903 |
| 537 | Ga0436363_1398555 | 3300039450 | Bacteria | 2225 |
| 538 | Ga0436362_0626017 | 3300039453 | Bacteria | 2784 |
| 539 | Ga0439448_0006572 | 3300042005 | Unclassified | 3348 |
| 540 | Ga0451577_0204118 | 3300042876 | Unclassified | 1784 |
| 541 | Ga0466966_0025506 | 3300044684 | Bacteria | 3860 |
| 542 | Ga0466964_0024177 | 3300044706 | Bacteria | 2366 |
| 543 | Ga0453684_0337075 | 3300044712 | Unclassified | 1704 |
| 544 | Ga0451576_0062811 | 3300045051 | Bacteria | 3871 |
| 545 | Ga0466967_0463958 | 3300045976 | Bacteria | 1239 |
| 546 | Ga0466967_0486052 | 3300045976 | Bacteria | 1210 |
| 547 | Ga0495603_0001049 | 3300046455 | Bacteria | 15997 |
| 548 | Ga0495629_0040041 | 3300046459 | Bacteria | 3297 |
| 549 | Ga0495629_0046247 | 3300046459 | Bacteria | 3053 |
| 550 | Ga0495651_0000991 | 3300046462 | Bacteria | 22040 |
| 551 | Ga0495651_0082688 | 3300046462 | Bacteria | 2423 |
| 552 | Ga0495650_0001419 | 3300046471 | Bacteria | 23297 |
| 553 | Ga0495580_0046668 | 3300046472 | Bacteria | 3073 |
| 554 | Ga0495580_0058448 | 3300046472 | Bacteria | 2712 |
| 555 | Ga0495580_0271764 | 3300046472 | Archaea | 1157 |
| 556 | Ga0495582_0000192 | 3300046473 | Bacteria | 33815 |
| 557 | Ga0495582_0002882 | 3300046473 | Bacteria | 9615 |
| 558 | Ga0495662_0001218 | 3300046476 | Bacteria | 12657 |
| 559 | Ga0495664_0007921 | 3300046477 | Bacteria | 5914 |
| 560 | Ga0495594_0000311 | 3300046499 | Bacteria | 23929 |
| 561 | Ga0495594_0007732 | 3300046499 | Bacteria | 5528 |
| 562 | Ga0495583_0040724 | 3300046506 | Bacteria | 2180 |
| 563 | Ga0495606_0176823 | 3300046507 | Bacteria | 1234 |
| 564 | Ga0495618_0133075 | 3300046514 | Bacteria | 1591 |
| 565 | Ga0495618_0290983 | 3300046514 | Bacteria | 1017 |
| 566 | Ga0495628_0164220 | 3300046516 | Bacteria | 1686 |
| 567 | Ga0495644_0001019 | 3300046523 | Bacteria | 11688 |
| 568 | Ga0495666_0002474 | 3300046526 | Bacteria | 9179 |
| 569 | Ga0495642_0120638 | 3300046528 | Bacteria | 1125 |
| 570 | Ga0495640_0014874 | 3300046533 | Bacteria | 5870 |
| 571 | Ga0495587_0098916 | 3300046536 | Bacteria | 1682 |
| 572 | Ga0495587_0173080 | 3300046536 | Bacteria | 1226 |
| 573 | Ga0495609_0008328 | 3300046538 | Bacteria | 5082 |
| 574 | Ga0495645_0016767 | 3300046543 | Bacteria | 5240 |
| 575 | Ga0495622_0040610 | 3300046557 | Bacteria | 2165 |
| 576 | Ga0495633_0012427 | 3300046558 | Bacteria | 4529 |
| 577 | Ga0495634_0001013 | 3300046642 | Bacteria | 26400 |
| 578 | Ga0495625_0002508 | 3300046660 | Bacteria | 19770 |
| 579 | Ga0495625_0017649 | 3300046660 | Bacteria | 5585 |
| 580 | Ga0495625_0158440 | 3300046660 | Bacteria | 1518 |
| 581 | Ga0495599_0001904 | 3300046678 | Bacteria | 12082 |
| 582 | Ga0495658_0001341 | 3300046683 | Bacteria | 12919 |
| 583 | Ga0495669_0003529 | 3300046684 | Bacteria | 6453 |
| 584 | Ga0495613_0002687 | 3300046689 | Bacteria | 13349 |
| 585 | Ga0495613_0005291 | 3300046689 | Bacteria | 9694 |
| 586 | Ga0495624_0003225 | 3300046690 | Bacteria | 12159 |
| 587 | Ga0495671_0133217 | 3300046692 | Bacteria | 1212 |
| 588 | Ga0495649_0078066 | 3300046694 | Bacteria | 1772 |
| 589 | Ga0495649_0232175 | 3300046694 | Bacteria | 952 |
| 590 | Ga0495600_0079203 | 3300046809 | Bacteria | 2145 |
| 591 | Ga0495581_0001414 | 3300047315 | Bacteria | 13303 |
| 592 | Ga0495674_0106197 | 3300047319 | Bacteria | 2385 |
| 593 | Ga0495676_0000384 | 3300047321 | Bacteria | 35933 |
| 594 | Ga0495676_0134384 | 3300047321 | Unclassified | 1781 |
| 595 | Ga0495683_0093917 | 3300047323 | Bacteria | 1450 |
| 596 | Ga0495675_0002097 | 3300047444 | Bacteria | 11889 |
| 597 | Ga0495679_063778 | 3300047446 | Bacteria | 1075 |
| 598 | Ga0495614_0000029 | 3300048089 | Bacteria | 41379 |
| 599 | Ga0496105_0015591 | 3300048908 | Bacteria | 6060 |
| 600 | Ga0496112_0103579 | 3300048915 | Bacteria | 2816 |
| 601 | Ga0496114_0008141 | 3300048917 | Bacteria | 8306 |
| 602 | Ga0496115_0036296 | 3300048918 | Bacteria | 3902 |
| 603 | Ga0496126_0000187 | 3300048929 | Bacteria | 139670 |
| 604 | Ga0496126_0000333 | 3300048929 | Bacteria | 100416 |
| 605 | Ga0496126_0002227 | 3300048929 | Bacteria | 26819 |
| 606 | Ga0496126_0102647 | 3300048929 | Unclassified | 2500 |
| 607 | Ga0495682_0004897 | 3300049460 | Bacteria | 5641 |
| 608 | Ga0501031_0063959 | 3300049568 | Bacteria | 2396 |
| 609 | Ga0501032_0000623 | 3300049569 | Bacteria | 28778 |
| 610 | Ga0501034_0006263 | 3300049571 | Bacteria | 12801 |
| 611 | Ga0501034_0036896 | 3300049571 | Bacteria | 4949 |
| 612 | Ga0501036_0027879 | 3300049572 | Bacteria | 4774 |
| 613 | Ga0501037_0017055 | 3300049573 | Bacteria | 5342 |
| 614 | Ga0501038_0043408 | 3300049574 | Bacteria | 3909 |
| 615 | Ga0501038_0082067 | 3300049574 | Bacteria | 2715 |
| 616 | Ga0501043_0005499 | 3300049579 | Bacteria | 10233 |
| 617 | Ga0501043_0009525 | 3300049579 | Bacteria | 7613 |
| 618 | Ga0501046_0005952 | 3300049580 | Bacteria | 10859 |
| 619 | Ga0501046_0069161 | 3300049580 | Bacteria | 2748 |
| 620 | Ga0501047_0076345 | 3300049581 | Bacteria | 3224 |
| 621 | Ga0501048_0118252 | 3300049582 | Bacteria | 1872 |
| 622 | Ga0501048_0316619 | 3300049582 | Unclassified | 1111 |
| 623 | Ga0501067_0108586 | 3300049583 | Bacteria | 1542 |
| 624 | Ga0501068_0000526 | 3300049584 | Bacteria | 19398 |
| 625 | Ga0501069_0000364 | 3300049585 | Bacteria | 20387 |
| 626 | Ga0501070_0011024 | 3300049586 | Bacteria | 7630 |
| 627 | Ga0501070_0107489 | 3300049586 | Unclassified | 2306 |
| 628 | Ga0501072_0000479 | 3300049588 | Bacteria | 28715 |
| 629 | Ga0501073_0000613 | 3300049589 | Bacteria | 25120 |
| 630 | Ga0501073_0232615 | 3300049589 | Bacteria | 1273 |
| 631 | Ga0501079_0005764 | 3300049741 | Bacteria | 9258 |
| 632 | Ga0501080_0000055 | 3300049742 | Bacteria | 72931 |
| 633 | Ga0501080_0340684 | 3300049742 | Unclassified | 1355 |
| 634 | Ga0501083_0089591 | 3300049744 | Bacteria | 2032 |
| 635 | Ga0501035_0034854 | 3300049822 | Bacteria | 4572 |
| 636 | Ga0501035_0222351 | 3300049822 | Bacteria | 1611 |
| 637 | Ga0501044_0030201 | 3300049823 | Bacteria | 5712 |
| 638 | Ga0501044_0113587 | 3300049823 | Unclassified | 2715 |
| 639 | nmdc:mga05p37_404163_c1 | 3300050507 | Bacteria | 1594 |
| 640 | nmdc:mga0qj67_162642_c1 | 3300050509 | Bacteria | 1812 |
| 641 | nmdc:mga08y16_60202_c1 | 3300050511 | Bacteria | 3967 |
| 642 | nmdc:mga0n895_11278_c1 | 3300050512 | Bacteria | 7964 |
| 643 | nmdc:mga08x19_10818_c1 | 3300050514 | Bacteria | 5487 |
| 644 | nmdc:mga08x19_188_c1 | 3300050514 | Bacteria | 49158 |
| 645 | nmdc:mga08x19_7537_c1 | 3300050514 | Bacteria | 6467 |
| 646 | nmdc:mga0a205_10484_c1 | 3300050515 | Bacteria | 8515 |
| 647 | Ga0495601_0021998 | 3300053077 | Bacteria | 3911 |
| 648 | Ga0495612_0032994 | 3300053078 | Bacteria | 2094 |
| 649 | Ga0500644_0016613 | 3300053088 | Unclassified | 2121 |
| 650 | Ga0500651_0000007 | 3300053093 | Bacteria | 295019 |
| 651 | Ga0500595_035608 | 3300053119 | Unclassified | 1637 |
| 652 | Ga0501084_0001465 | 3300054114 | Bacteria | 18734 |
| 653 | Ga0500661_000345 | 3300055283 | Bacteria | 8445 |
| 654 | Ga0587088_019594 | 3300059508 | Bacteria | 1114 |
| 655 | Ga0587092_016174 | 3300059512 | Bacteria | 1102 |
| 656 | Ga0587067_015700 | 3300059640 | Bacteria | 1232 |
| 657 | Ga0501082_0000192 | 3300060353 | Bacteria | 52678 |
| 658 | Ga0501082_0012178 | 3300060353 | Bacteria | 7389 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021441 | Ga0213871_10038393 | Ga0213871_100383932 | 272 |
| 2 | iso_pu_bacteria | 2977232053 | 2977233308 | 276 |
| 3 | 3300005564 | Ga0070664_100231162 | Ga0070664_1002311621 | 277 |
| 4 | 3300013105 | Ga0157369_10010557 | Ga0157369_100105576 | 278 |
| 5 | 3300028379 | Ga0268266_10283844 | Ga0268266_102838442 | 279 |
| 6 | 3300033180 | Ga0307510_10198442 | Ga0307510_101984423 | 279 |
| 7 | iso_pu_bacteria | 2884215851 | 2884219309 | 279 |
| 8 | 3300009093 | Ga0105240_10225424 | Ga0105240_102254242 | 280 |
| 9 | 3300009545 | Ga0105237_10071127 | Ga0105237_100711274 | 280 |
| 10 | 3300025913 | Ga0207695_10057769 | Ga0207695_100577691 | 280 |
| 11 | 3300049568 | Ga0501031_0063959 | Ga0501031_0063959_218_1066 | 280 |
| 12 | 3300049569 | Ga0501032_0000623 | Ga0501032_0000623_16824_17672 | 280 |
| 13 | 3300049571 | Ga0501034_0036896 | Ga0501034_0036896_2655_3503 | 280 |
| 14 | 3300049572 | Ga0501036_0027879 | Ga0501036_0027879_603_1451 | 280 |
| 15 | 3300049573 | Ga0501037_0017055 | Ga0501037_0017055_4328_5176 | 280 |
| 16 | 3300049574 | Ga0501038_0043408 | Ga0501038_0043408_2767_3615 | 280 |
| 17 | 3300049579 | Ga0501043_0005499 | Ga0501043_0005499_4632_5480 | 280 |
| 18 | 3300049580 | Ga0501046_0005952 | Ga0501046_0005952_603_1451 | 280 |
| 19 | 3300049581 | Ga0501047_0076345 | Ga0501047_0076345_2210_3058 | 280 |
| 20 | 3300049582 | Ga0501048_0118252 | Ga0501048_0118252_42_890 | 280 |
| 21 | 3300049583 | Ga0501067_0108586 | Ga0501067_0108586_604_1452 | 280 |
| 22 | 3300049584 | Ga0501068_0000526 | Ga0501068_0000526_15133_15981 | 280 |
| 23 | 3300049585 | Ga0501069_0000364 | Ga0501069_0000364_16451_17299 | 280 |
| 24 | 3300049588 | Ga0501072_0000479 | Ga0501072_0000479_14990_15838 | 280 |
| 25 | 3300049589 | Ga0501073_0000613 | Ga0501073_0000613_3324_4172 | 280 |
| 26 | 3300049741 | Ga0501079_0005764 | Ga0501079_0005764_3907_4755 | 280 |
| 27 | 3300049742 | Ga0501080_0000055 | Ga0501080_0000055_4632_5480 | 280 |
| 28 | 3300049744 | Ga0501083_0089591 | Ga0501083_0089591_1018_1866 | 280 |
| 29 | 3300049822 | Ga0501035_0222351 | Ga0501035_0222351_454_1302 | 280 |
| 30 | 3300049823 | Ga0501044_0030201 | Ga0501044_0030201_2210_3058 | 280 |
| 31 | 3300054114 | Ga0501084_0001465 | Ga0501084_0001465_5055_5903 | 280 |
| 32 | 3300060353 | Ga0501082_0012178 | Ga0501082_0012178_4632_5480 | 280 |
| 33 | 3300005338 | Ga0068868_100038942 | Ga0068868_1000389421 | 281 |
| 34 | 3300005718 | Ga0068866_10126563 | Ga0068866_101265631 | 281 |
| 35 | 3300006237 | Ga0097621_100046311 | Ga0097621_1000463115 | 281 |
| 36 | 3300006358 | Ga0068871_100048371 | Ga0068871_1000483712 | 281 |
| 37 | 3300006852 | Ga0075433_10002750 | Ga0075433_100027508 | 281 |
| 38 | 3300009093 | Ga0105240_10125112 | Ga0105240_101251123 | 281 |
| 39 | 3300009094 | Ga0111539_10005961 | Ga0111539_100059615 | 281 |
| 40 | 3300009098 | Ga0105245_10043376 | Ga0105245_100433761 | 281 |
| 41 | 3300009177 | Ga0105248_10074437 | Ga0105248_100744372 | 281 |
| 42 | 3300010375 | Ga0105239_10248459 | Ga0105239_102484592 | 281 |
| 43 | 3300013296 | Ga0157374_10517090 | Ga0157374_105170901 | 281 |
| 44 | 3300013297 | Ga0157378_10070302 | Ga0157378_100703022 | 281 |
| 45 | 3300013306 | Ga0163162_10063172 | Ga0163162_100631722 | 281 |
| 46 | 3300025927 | Ga0207687_10041781 | Ga0207687_100417812 | 281 |
| 47 | 3300025934 | Ga0207686_10103748 | Ga0207686_101037481 | 281 |
| 48 | 3300025941 | Ga0207711_10061798 | Ga0207711_100617982 | 281 |
| 49 | 3300025981 | Ga0207640_10159441 | Ga0207640_101594411 | 281 |
| 50 | 3300026023 | Ga0207677_10370796 | Ga0207677_103707961 | 281 |
| 51 | 3300027907 | Ga0207428_10041838 | Ga0207428_100418382 | 281 |
| 52 | 3300039447 | Ga0436361_0539608 | Ga0436361_0539608_1492_2352 | 281 |
| 53 | 3300046514 | Ga0495618_0290983 | Ga0495618_0290983_18_902 | 281 |
| 54 | 3300046533 | Ga0495640_0014874 | Ga0495640_0014874_2427_3311 | 281 |
| 55 | 3300046543 | Ga0495645_0016767 | Ga0495645_0016767_389_1306 | 281 |
| 56 | 3300046683 | Ga0495658_0001341 | Ga0495658_0001341_10584_11468 | 281 |
| 57 | 3300046689 | Ga0495613_0002687 | Ga0495613_0002687_10096_10980 | 281 |
| 58 | 3300050511 | nmdc:mga08y16_60202_c1 | nmdc:mga08y16_60202_c1_1016_1885 | 281 |
| 59 | 3300050515 | nmdc:mga0a205_10484_c1 | nmdc:mga0a205_10484_c1_7585_8436 | 281 |
| 60 | 3300053077 | Ga0495601_0021998 | Ga0495601_0021998_1580_2497 | 281 |
| 61 | 3300053078 | Ga0495612_0032994 | Ga0495612_0032994_839_1756 | 281 |
| 62 | 3300006846 | Ga0075430_100303111 | Ga0075430_1003031112 | 282 |
| 63 | 3300006847 | Ga0075431_100067137 | Ga0075431_1000671371 | 282 |
| 64 | 3300006914 | Ga0075436_100009950 | Ga0075436_1000099503 | 282 |
| 65 | 3300009093 | Ga0105240_10076260 | Ga0105240_100762604 | 282 |
| 66 | 3300009148 | Ga0105243_10116909 | Ga0105243_101169092 | 282 |
| 67 | 3300009177 | Ga0105248_10000319 | Ga0105248_1000031927 | 282 |
| 68 | 3300013307 | Ga0157372_10080653 | Ga0157372_100806534 | 282 |
| 69 | 3300013307 | Ga0157372_10142527 | Ga0157372_101425273 | 282 |
| 70 | 3300021388 | Ga0213875_10076329 | Ga0213875_100763292 | 282 |
| 71 | 3300025935 | Ga0207709_10063461 | Ga0207709_100634612 | 282 |
| 72 | 3300025941 | Ga0207711_10000225 | Ga0207711_1000022551 | 282 |
| 73 | 3300031824 | Ga0307413_10152124 | Ga0307413_101521242 | 282 |
| 74 | 3300033180 | Ga0307510_10090625 | Ga0307510_100906252 | 282 |
| 75 | 3300037853 | Ga0436364_0103870 | Ga0436364_0103870_272_1123 | 282 |
| 76 | 3300037853 | Ga0436364_0880534 | Ga0436364_0880534_17912_18772 | 282 |
| 77 | 3300042876 | Ga0451577_0204118 | Ga0451577_0204118_515_1366 | 282 |
| 78 | 3300044712 | Ga0453684_0337075 | Ga0453684_0337075_102_953 | 282 |
| 79 | 3300045051 | Ga0451576_0062811 | Ga0451576_0062811_455_1306 | 282 |
| 80 | 3300048929 | Ga0496126_0002227 | Ga0496126_0002227_15428_16279 | 282 |
| 81 | 3300050509 | nmdc:mga0qj67_162642_c1 | nmdc:mga0qj67_162642_c1_852_1703 | 282 |
| 82 | 3300053088 | Ga0500644_0016613 | Ga0500644_0016613_716_1576 | 282 |
| 83 | 3300053119 | Ga0500595_035608 | Ga0500595_035608_579_1439 | 282 |
| 84 | 3300003322 | rootL2_10089696 | rootL2_100896963 | 283 |
| 85 | 3300005295 | Ga0065707_10150079 | Ga0065707_101500792 | 283 |
| 86 | 3300005329 | Ga0070683_100240011 | Ga0070683_1002400111 | 283 |
| 87 | 3300005334 | Ga0068869_100009742 | Ga0068869_1000097426 | 283 |
| 88 | 3300005338 | Ga0068868_100011969 | Ga0068868_1000119696 | 283 |
| 89 | 3300005344 | Ga0070661_100059118 | Ga0070661_1000591182 | 283 |
| 90 | 3300005364 | Ga0070673_100093952 | Ga0070673_1000939521 | 283 |
| 91 | 3300005406 | Ga0070703_10004502 | Ga0070703_100045022 | 283 |
| 92 | 3300005434 | Ga0070709_10213377 | Ga0070709_102133771 | 283 |
| 93 | 3300005435 | Ga0070714_100449729 | Ga0070714_1004497292 | 283 |
| 94 | 3300005436 | Ga0070713_100081141 | Ga0070713_1000811412 | 283 |
| 95 | 3300005440 | Ga0070705_100037839 | Ga0070705_1000378393 | 283 |
| 96 | 3300005440 | Ga0070705_100139845 | Ga0070705_1001398452 | 283 |
| 97 | 3300005444 | Ga0070694_100011619 | Ga0070694_1000116193 | 283 |
| 98 | 3300005445 | Ga0070708_100016490 | Ga0070708_1000164902 | 283 |
| 99 | 3300005445 | Ga0070708_100018101 | Ga0070708_1000181012 | 283 |
| 100 | 3300005458 | Ga0070681_10047671 | Ga0070681_100476714 | 283 |
| 101 | 3300005459 | Ga0068867_100002168 | Ga0068867_10000216812 | 283 |
| 102 | 3300005467 | Ga0070706_100050232 | Ga0070706_1000502322 | 283 |
| 103 | 3300005518 | Ga0070699_100008871 | Ga0070699_1000088713 | 283 |
| 104 | 3300005530 | Ga0070679_100061073 | Ga0070679_1000610733 | 283 |
| 105 | 3300005530 | Ga0070679_100168347 | Ga0070679_1001683472 | 283 |
| 106 | 3300005536 | Ga0070697_100013036 | Ga0070697_1000130362 | 283 |
| 107 | 3300005539 | Ga0068853_100281836 | Ga0068853_1002818362 | 283 |
| 108 | 3300005546 | Ga0070696_100012720 | Ga0070696_1000127203 | 283 |
| 109 | 3300005546 | Ga0070696_100469541 | Ga0070696_1004695411 | 283 |
| 110 | 3300005547 | Ga0070693_100007359 | Ga0070693_1000073592 | 283 |
| 111 | 3300005548 | Ga0070665_100000918 | Ga0070665_10000091828 | 283 |
| 112 | 3300005549 | Ga0070704_100011412 | Ga0070704_1000114122 | 283 |
| 113 | 3300005563 | Ga0068855_100002442 | Ga0068855_1000024427 | 283 |
| 114 | 3300005564 | Ga0070664_100006730 | Ga0070664_1000067304 | 283 |
| 115 | 3300005577 | Ga0068857_100102908 | Ga0068857_1001029082 | 283 |
| 116 | 3300005614 | Ga0068856_100002181 | Ga0068856_1000021817 | 283 |
| 117 | 3300005614 | Ga0068856_100022060 | Ga0068856_1000220605 | 283 |
| 118 | 3300005617 | Ga0068859_100002369 | Ga0068859_10000236921 | 283 |
| 119 | 3300005617 | Ga0068859_100434397 | Ga0068859_1004343972 | 283 |
| 120 | 3300005618 | Ga0068864_100002900 | Ga0068864_10000290015 | 283 |
| 121 | 3300005719 | Ga0068861_100077420 | Ga0068861_1000774202 | 283 |
| 122 | 3300005841 | Ga0068863_100066822 | Ga0068863_1000668222 | 283 |
| 123 | 3300005842 | Ga0068858_100001259 | Ga0068858_10000125937 | 283 |
| 124 | 3300005842 | Ga0068858_100339292 | Ga0068858_1003392922 | 283 |
| 125 | 3300005937 | Ga0081455_10055778 | Ga0081455_100557781 | 283 |
| 126 | 3300006028 | Ga0070717_10000582 | Ga0070717_100005825 | 283 |
| 127 | 3300006237 | Ga0097621_100015795 | Ga0097621_1000157952 | 283 |
| 128 | 3300006852 | Ga0075433_10020438 | Ga0075433_100204384 | 283 |
| 129 | 3300006871 | Ga0075434_100034834 | Ga0075434_1000348342 | 283 |
| 130 | 3300006881 | Ga0068865_100118821 | Ga0068865_1001188213 | 283 |
| 131 | 3300006914 | Ga0075436_100004130 | Ga0075436_1000041303 | 283 |
| 132 | 3300006914 | Ga0075436_100251254 | Ga0075436_1002512542 | 283 |
| 133 | 3300006931 | Ga0097620_100002369 | Ga0097620_1000023694 | 283 |
| 134 | 3300006931 | Ga0097620_100434453 | Ga0097620_1004344532 | 283 |
| 135 | 3300007076 | Ga0075435_100104544 | Ga0075435_1001045442 | 283 |
| 136 | 3300007076 | Ga0075435_100190720 | Ga0075435_1001907202 | 283 |
| 137 | 3300007076 | Ga0075435_100315346 | Ga0075435_1003153462 | 283 |
| 138 | 3300007265 | Ga0099794_10031748 | Ga0099794_100317482 | 283 |
| 139 | 3300007265 | Ga0099794_10209153 | Ga0099794_102091531 | 283 |
| 140 | 3300009098 | Ga0105245_10067429 | Ga0105245_100674294 | 283 |
| 141 | 3300009174 | Ga0105241_10081792 | Ga0105241_100817922 | 283 |
| 142 | 3300009177 | Ga0105248_10210392 | Ga0105248_102103922 | 283 |
| 143 | 3300013104 | Ga0157370_10315182 | Ga0157370_103151822 | 283 |
| 144 | 3300013296 | Ga0157374_10057426 | Ga0157374_100574263 | 283 |
| 145 | 3300013297 | Ga0157378_10000263 | Ga0157378_100002638 | 283 |
| 146 | 3300013297 | Ga0157378_10002951 | Ga0157378_1000295113 | 283 |
| 147 | 3300013307 | Ga0157372_10000982 | Ga0157372_1000098232 | 283 |
| 148 | 3300013308 | Ga0157375_10098750 | Ga0157375_100987503 | 283 |
| 149 | 3300013308 | Ga0157375_10473362 | Ga0157375_104733622 | 283 |
| 150 | 3300014325 | Ga0163163_10132651 | Ga0163163_101326512 | 283 |
| 151 | 3300021388 | Ga0213875_10000017 | Ga0213875_10000017114 | 283 |
| 152 | 3300025885 | Ga0207653_10008013 | Ga0207653_100080132 | 283 |
| 153 | 3300025904 | Ga0207647_10025602 | Ga0207647_100256024 | 283 |
| 154 | 3300025908 | Ga0207643_10019835 | Ga0207643_100198351 | 283 |
| 155 | 3300025910 | Ga0207684_10015475 | Ga0207684_100154753 | 283 |
| 156 | 3300025911 | Ga0207654_10083341 | Ga0207654_100833412 | 283 |
| 157 | 3300025912 | Ga0207707_10016653 | Ga0207707_100166534 | 283 |
| 158 | 3300025912 | Ga0207707_10288165 | Ga0207707_102881652 | 283 |
| 159 | 3300025914 | Ga0207671_10245443 | Ga0207671_102454432 | 283 |
| 160 | 3300025920 | Ga0207649_10041209 | Ga0207649_100412093 | 283 |
| 161 | 3300025921 | Ga0207652_10175829 | Ga0207652_101758291 | 283 |
| 162 | 3300025921 | Ga0207652_10587535 | Ga0207652_105875351 | 283 |
| 163 | 3300025927 | Ga0207687_10274703 | Ga0207687_102747032 | 283 |
| 164 | 3300025944 | Ga0207661_10065336 | Ga0207661_100653362 | 283 |
| 165 | 3300025945 | Ga0207679_10037403 | Ga0207679_100374032 | 283 |
| 166 | 3300026023 | Ga0207677_10006069 | Ga0207677_100060693 | 283 |
| 167 | 3300026078 | Ga0207702_10012061 | Ga0207702_100120612 | 283 |
| 168 | 3300026088 | Ga0207641_10031687 | Ga0207641_100316872 | 283 |
| 169 | 3300026088 | Ga0207641_10248438 | Ga0207641_102484382 | 283 |
| 170 | 3300026089 | Ga0207648_10014946 | Ga0207648_100149465 | 283 |
| 171 | 3300026095 | Ga0207676_10236698 | Ga0207676_102366981 | 283 |
| 172 | 3300026116 | Ga0207674_10000560 | Ga0207674_1000056044 | 283 |
| 173 | 3300027671 | Ga0209588_1012353 | Ga0209588_10123533 | 283 |
| 174 | 3300028379 | Ga0268266_10000144 | Ga0268266_10000144113 | 283 |
| 175 | 3300028379 | Ga0268266_10392128 | Ga0268266_103921281 | 283 |
| 176 | 3300028381 | Ga0268264_10049888 | Ga0268264_100498882 | 283 |
| 177 | 3300037853 | Ga0436364_0074911 | Ga0436364_0074911_741_1595 | 283 |
| 178 | 3300037853 | Ga0436364_1041147 | Ga0436364_1041147_556_1410 | 283 |
| 179 | 3300039437 | Ga0436365_0894537 | Ga0436365_0894537_1369_2223 | 283 |
| 180 | 3300039437 | Ga0436365_0960146 | Ga0436365_0960146_1433_2287 | 283 |
| 181 | 3300039437 | Ga0436365_1584098 | Ga0436365_1584098_724_1578 | 283 |
| 182 | 3300039450 | Ga0436363_0226217 | Ga0436363_0226217_29_883 | 283 |
| 183 | 3300039450 | Ga0436363_1398555 | Ga0436363_1398555_1039_1893 | 283 |
| 184 | 3300039453 | Ga0436362_0626017 | Ga0436362_0626017_1290_2144 | 283 |
| 185 | 3300046462 | Ga0495651_0082688 | Ga0495651_0082688_1383_2237 | 283 |
| 186 | 3300046471 | Ga0495650_0001419 | Ga0495650_0001419_18604_19464 | 283 |
| 187 | 3300046472 | Ga0495580_0046668 | Ga0495580_0046668_1616_2470 | 283 |
| 188 | 3300046536 | Ga0495587_0173080 | Ga0495587_0173080_321_1175 | 283 |
| 189 | 3300046660 | Ga0495625_0002508 | Ga0495625_0002508_4647_5507 | 283 |
| 190 | 3300046694 | Ga0495649_0232175 | Ga0495649_0232175_55_912 | 283 |
| 191 | 3300049571 | Ga0501034_0006263 | Ga0501034_0006263_5575_6441 | 283 |
| 192 | 3300049574 | Ga0501038_0082067 | Ga0501038_0082067_436_1302 | 283 |
| 193 | 3300049579 | Ga0501043_0009525 | Ga0501043_0009525_1243_2109 | 283 |
| 194 | 3300049580 | Ga0501046_0069161 | Ga0501046_0069161_1857_2723 | 283 |
| 195 | 3300049582 | Ga0501048_0316619 | Ga0501048_0316619_14_880 | 283 |
| 196 | 3300049586 | Ga0501070_0011024 | Ga0501070_0011024_2592_3458 | 283 |
| 197 | 3300049586 | Ga0501070_0107489 | Ga0501070_0107489_225_1082 | 283 |
| 198 | 3300049742 | Ga0501080_0340684 | Ga0501080_0340684_100_966 | 283 |
| 199 | 3300049822 | Ga0501035_0034854 | Ga0501035_0034854_2519_3385 | 283 |
| 200 | 3300049823 | Ga0501044_0113587 | Ga0501044_0113587_1736_2602 | 283 |
| 201 | 3300050512 | nmdc:mga0n895_11278_c1 | nmdc:mga0n895_11278_c1_3809_4663 | 283 |
| 202 | 3300050514 | nmdc:mga08x19_7537_c1 | nmdc:mga08x19_7537_c1_3385_4239 | 283 |
| 203 | 3300003323 | rootH1_10319382 | rootH1_103193823 | 284 |
| 204 | 3300005327 | Ga0070658_10006654 | Ga0070658_100066542 | 284 |
| 205 | 3300005327 | Ga0070658_10007325 | Ga0070658_100073259 | 284 |
| 206 | 3300005327 | Ga0070658_10027817 | Ga0070658_100278174 | 284 |
| 207 | 3300005329 | Ga0070683_100000008 | Ga0070683_10000000893 | 284 |
| 208 | 3300005329 | Ga0070683_100001085 | Ga0070683_1000010858 | 284 |
| 209 | 3300005329 | Ga0070683_100248932 | Ga0070683_1002489322 | 284 |
| 210 | 3300005334 | Ga0068869_100025813 | Ga0068869_1000258131 | 284 |
| 211 | 3300005334 | Ga0068869_100029502 | Ga0068869_1000295022 | 284 |
| 212 | 3300005335 | Ga0070666_10029166 | Ga0070666_100291662 | 284 |
| 213 | 3300005337 | Ga0070682_100069155 | Ga0070682_1000691552 | 284 |
| 214 | 3300005338 | Ga0068868_100041785 | Ga0068868_1000417853 | 284 |
| 215 | 3300005338 | Ga0068868_100158878 | Ga0068868_1001588782 | 284 |
| 216 | 3300005339 | Ga0070660_100006724 | Ga0070660_1000067242 | 284 |
| 217 | 3300005339 | Ga0070660_100195619 | Ga0070660_1001956192 | 284 |
| 218 | 3300005344 | Ga0070661_100016382 | Ga0070661_1000163823 | 284 |
| 219 | 3300005344 | Ga0070661_100143738 | Ga0070661_1001437382 | 284 |
| 220 | 3300005354 | Ga0070675_100045990 | Ga0070675_1000459903 | 284 |
| 221 | 3300005355 | Ga0070671_100056092 | Ga0070671_1000560922 | 284 |
| 222 | 3300005355 | Ga0070671_100307106 | Ga0070671_1003071062 | 284 |
| 223 | 3300005364 | Ga0070673_100132170 | Ga0070673_1001321701 | 284 |
| 224 | 3300005366 | Ga0070659_100006194 | Ga0070659_1000061945 | 284 |
| 225 | 3300005366 | Ga0070659_100007028 | Ga0070659_1000070282 | 284 |
| 226 | 3300005367 | Ga0070667_100292379 | Ga0070667_1002923792 | 284 |
| 227 | 3300005434 | Ga0070709_10003223 | Ga0070709_100032233 | 284 |
| 228 | 3300005434 | Ga0070709_10004418 | Ga0070709_100044184 | 284 |
| 229 | 3300005434 | Ga0070709_10274293 | Ga0070709_102742932 | 284 |
| 230 | 3300005434 | Ga0070709_10279995 | Ga0070709_102799951 | 284 |
| 231 | 3300005435 | Ga0070714_100014642 | Ga0070714_1000146424 | 284 |
| 232 | 3300005436 | Ga0070713_100001444 | Ga0070713_1000014443 | 284 |
| 233 | 3300005436 | Ga0070713_100023514 | Ga0070713_1000235142 | 284 |
| 234 | 3300005437 | Ga0070710_10013842 | Ga0070710_100138422 | 284 |
| 235 | 3300005439 | Ga0070711_100002499 | Ga0070711_1000024992 | 284 |
| 236 | 3300005439 | Ga0070711_100322533 | Ga0070711_1003225331 | 284 |
| 237 | 3300005439 | Ga0070711_100388518 | Ga0070711_1003885181 | 284 |
| 238 | 3300005445 | Ga0070708_100035172 | Ga0070708_1000351725 | 284 |
| 239 | 3300005455 | Ga0070663_100054629 | Ga0070663_1000546292 | 284 |
| 240 | 3300005455 | Ga0070663_100396411 | Ga0070663_1003964111 | 284 |
| 241 | 3300005456 | Ga0070678_100013830 | Ga0070678_1000138304 | 284 |
| 242 | 3300005457 | Ga0070662_100066627 | Ga0070662_1000666272 | 284 |
| 243 | 3300005457 | Ga0070662_100295534 | Ga0070662_1002955341 | 284 |
| 244 | 3300005458 | Ga0070681_10007463 | Ga0070681_100074633 | 284 |
| 245 | 3300005458 | Ga0070681_10123605 | Ga0070681_101236052 | 284 |
| 246 | 3300005459 | Ga0068867_100024034 | Ga0068867_1000240342 | 284 |
| 247 | 3300005467 | Ga0070706_100002900 | Ga0070706_10000290018 | 284 |
| 248 | 3300005467 | Ga0070706_100045013 | Ga0070706_1000450132 | 284 |
| 249 | 3300005468 | Ga0070707_100005573 | Ga0070707_1000055732 | 284 |
| 250 | 3300005468 | Ga0070707_100256099 | Ga0070707_1002560991 | 284 |
| 251 | 3300005471 | Ga0070698_100002625 | Ga0070698_1000026259 | 284 |
| 252 | 3300005471 | Ga0070698_100057408 | Ga0070698_1000574083 | 284 |
| 253 | 3300005471 | Ga0070698_100065920 | Ga0070698_1000659202 | 284 |
| 254 | 3300005518 | Ga0070699_100251999 | Ga0070699_1002519992 | 284 |
| 255 | 3300005530 | Ga0070679_100072203 | Ga0070679_1000722031 | 284 |
| 256 | 3300005530 | Ga0070679_100088650 | Ga0070679_1000886501 | 284 |
| 257 | 3300005530 | Ga0070679_100117500 | Ga0070679_1001175002 | 284 |
| 258 | 3300005530 | Ga0070679_100154565 | Ga0070679_1001545652 | 284 |
| 259 | 3300005530 | Ga0070679_100367001 | Ga0070679_1003670011 | 284 |
| 260 | 3300005535 | Ga0070684_100000002 | Ga0070684_10000000283 | 284 |
| 261 | 3300005535 | Ga0070684_100016895 | Ga0070684_1000168953 | 284 |
| 262 | 3300005536 | Ga0070697_100013213 | Ga0070697_1000132132 | 284 |
| 263 | 3300005536 | Ga0070697_100318773 | Ga0070697_1003187732 | 284 |
| 264 | 3300005539 | Ga0068853_100001128 | Ga0068853_10000112818 | 284 |
| 265 | 3300005539 | Ga0068853_100011434 | Ga0068853_1000114343 | 284 |
| 266 | 3300005539 | Ga0068853_100073632 | Ga0068853_1000736323 | 284 |
| 267 | 3300005539 | Ga0068853_100548759 | Ga0068853_1005487591 | 284 |
| 268 | 3300005543 | Ga0070672_100021776 | Ga0070672_1000217764 | 284 |
| 269 | 3300005548 | Ga0070665_100018880 | Ga0070665_1000188806 | 284 |
| 270 | 3300005548 | Ga0070665_100124781 | Ga0070665_1001247813 | 284 |
| 271 | 3300005563 | Ga0068855_100020104 | Ga0068855_1000201043 | 284 |
| 272 | 3300005563 | Ga0068855_100074626 | Ga0068855_1000746262 | 284 |
| 273 | 3300005563 | Ga0068855_100119528 | Ga0068855_1001195282 | 284 |
| 274 | 3300005563 | Ga0068855_100230718 | Ga0068855_1002307182 | 284 |
| 275 | 3300005563 | Ga0068855_100559090 | Ga0068855_1005590901 | 284 |
| 276 | 3300005563 | Ga0068855_100602183 | Ga0068855_1006021832 | 284 |
| 277 | 3300005564 | Ga0070664_100469749 | Ga0070664_1004697492 | 284 |
| 278 | 3300005577 | Ga0068857_100046601 | Ga0068857_1000466013 | 284 |
| 279 | 3300005578 | Ga0068854_100000003 | Ga0068854_100000003175 | 284 |
| 280 | 3300005578 | Ga0068854_100002113 | Ga0068854_1000021138 | 284 |
| 281 | 3300005578 | Ga0068854_100494323 | Ga0068854_1004943231 | 284 |
| 282 | 3300005614 | Ga0068856_100011264 | Ga0068856_1000112645 | 284 |
| 283 | 3300005614 | Ga0068856_100029012 | Ga0068856_1000290122 | 284 |
| 284 | 3300005614 | Ga0068856_100092143 | Ga0068856_1000921432 | 284 |
| 285 | 3300005614 | Ga0068856_100312505 | Ga0068856_1003125052 | 284 |
| 286 | 3300005614 | Ga0068856_100327532 | Ga0068856_1003275322 | 284 |
| 287 | 3300005614 | Ga0068856_100540194 | Ga0068856_1005401941 | 284 |
| 288 | 3300005616 | Ga0068852_100065221 | Ga0068852_1000652213 | 284 |
| 289 | 3300005616 | Ga0068852_100083891 | Ga0068852_1000838912 | 284 |
| 290 | 3300005616 | Ga0068852_100494862 | Ga0068852_1004948622 | 284 |
| 291 | 3300005616 | Ga0068852_100535218 | Ga0068852_1005352182 | 284 |
| 292 | 3300005617 | Ga0068859_100020434 | Ga0068859_1000204344 | 284 |
| 293 | 3300005617 | Ga0068859_100332786 | Ga0068859_1003327861 | 284 |
| 294 | 3300005617 | Ga0068859_100489876 | Ga0068859_1004898761 | 284 |
| 295 | 3300005618 | Ga0068864_100018903 | Ga0068864_1000189032 | 284 |
| 296 | 3300005834 | Ga0068851_10090688 | Ga0068851_100906882 | 284 |
| 297 | 3300005841 | Ga0068863_100029216 | Ga0068863_1000292162 | 284 |
| 298 | 3300005841 | Ga0068863_100086118 | Ga0068863_1000861183 | 284 |
| 299 | 3300005842 | Ga0068858_100001498 | Ga0068858_1000014987 | 284 |
| 300 | 3300005842 | Ga0068858_100176902 | Ga0068858_1001769023 | 284 |
| 301 | 3300005844 | Ga0068862_100170424 | Ga0068862_1001704242 | 284 |
| 302 | 3300005937 | Ga0081455_10039483 | Ga0081455_100394834 | 284 |
| 303 | 3300006028 | Ga0070717_10005337 | Ga0070717_100053373 | 284 |
| 304 | 3300006173 | Ga0070716_100013778 | Ga0070716_1000137782 | 284 |
| 305 | 3300006173 | Ga0070716_100135434 | Ga0070716_1001354342 | 284 |
| 306 | 3300006175 | Ga0070712_100002219 | Ga0070712_1000022193 | 284 |
| 307 | 3300006237 | Ga0097621_100107116 | Ga0097621_1001071163 | 284 |
| 308 | 3300006358 | Ga0068871_100339484 | Ga0068871_1003394842 | 284 |
| 309 | 3300006881 | Ga0068865_100031172 | Ga0068865_1000311723 | 284 |
| 310 | 3300006931 | Ga0097620_100020434 | Ga0097620_1000204342 | 284 |
| 311 | 3300006931 | Ga0097620_100332784 | Ga0097620_1003327841 | 284 |
| 312 | 3300006931 | Ga0097620_100489893 | Ga0097620_1004898931 | 284 |
| 313 | 3300009093 | Ga0105240_10000001 | Ga0105240_100000012296 | 284 |
| 314 | 3300009093 | Ga0105240_10017310 | Ga0105240_100173106 | 284 |
| 315 | 3300009093 | Ga0105240_10020798 | Ga0105240_100207985 | 284 |
| 316 | 3300009093 | Ga0105240_10031912 | Ga0105240_100319124 | 284 |
| 317 | 3300009093 | Ga0105240_10085141 | Ga0105240_100851412 | 284 |
| 318 | 3300009093 | Ga0105240_10195396 | Ga0105240_101953962 | 284 |
| 319 | 3300009093 | Ga0105240_10921485 | Ga0105240_109214851 | 284 |
| 320 | 3300009098 | Ga0105245_10020916 | Ga0105245_100209163 | 284 |
| 321 | 3300009174 | Ga0105241_10361780 | Ga0105241_103617801 | 284 |
| 322 | 3300009177 | Ga0105248_10001668 | Ga0105248_1000166810 | 284 |
| 323 | 3300009177 | Ga0105248_10104724 | Ga0105248_101047243 | 284 |
| 324 | 3300009545 | Ga0105237_10014461 | Ga0105237_100144614 | 284 |
| 325 | 3300009551 | Ga0105238_10023719 | Ga0105238_100237192 | 284 |
| 326 | 3300009551 | Ga0105238_10505285 | Ga0105238_105052852 | 284 |
| 327 | 3300009553 | Ga0105249_10174381 | Ga0105249_101743812 | 284 |
| 328 | 3300010375 | Ga0105239_10079970 | Ga0105239_100799702 | 284 |
| 329 | 3300010375 | Ga0105239_10525020 | Ga0105239_105250201 | 284 |
| 330 | 3300013104 | Ga0157370_10027433 | Ga0157370_100274334 | 284 |
| 331 | 3300013104 | Ga0157370_10044595 | Ga0157370_100445952 | 284 |
| 332 | 3300013104 | Ga0157370_10047287 | Ga0157370_100472873 | 284 |
| 333 | 3300013104 | Ga0157370_10060654 | Ga0157370_100606542 | 284 |
| 334 | 3300013104 | Ga0157370_10090725 | Ga0157370_100907252 | 284 |
| 335 | 3300013105 | Ga0157369_10013277 | Ga0157369_100132773 | 284 |
| 336 | 3300013105 | Ga0157369_10029511 | Ga0157369_100295112 | 284 |
| 337 | 3300013105 | Ga0157369_10032611 | Ga0157369_100326115 | 284 |
| 338 | 3300013105 | Ga0157369_10103507 | Ga0157369_101035072 | 284 |
| 339 | 3300013105 | Ga0157369_10305573 | Ga0157369_103055732 | 284 |
| 340 | 3300013105 | Ga0157369_10336572 | Ga0157369_103365722 | 284 |
| 341 | 3300013296 | Ga0157374_10016789 | Ga0157374_100167892 | 284 |
| 342 | 3300013296 | Ga0157374_10017924 | Ga0157374_100179243 | 284 |
| 343 | 3300013296 | Ga0157374_10119638 | Ga0157374_101196382 | 284 |
| 344 | 3300013297 | Ga0157378_10262987 | Ga0157378_102629872 | 284 |
| 345 | 3300013306 | Ga0163162_10038339 | Ga0163162_100383392 | 284 |
| 346 | 3300013307 | Ga0157372_10002405 | Ga0157372_100024055 | 284 |
| 347 | 3300013307 | Ga0157372_10023742 | Ga0157372_100237421 | 284 |
| 348 | 3300013307 | Ga0157372_10064666 | Ga0157372_100646663 | 284 |
| 349 | 3300013307 | Ga0157372_10117245 | Ga0157372_101172452 | 284 |
| 350 | 3300013307 | Ga0157372_10200053 | Ga0157372_102000532 | 284 |
| 351 | 3300013307 | Ga0157372_10252388 | Ga0157372_102523882 | 284 |
| 352 | 3300013307 | Ga0157372_10316871 | Ga0157372_103168712 | 284 |
| 353 | 3300013308 | Ga0157375_10070316 | Ga0157375_100703162 | 284 |
| 354 | 3300013308 | Ga0157375_10187695 | Ga0157375_101876952 | 284 |
| 355 | 3300014325 | Ga0163163_10022326 | Ga0163163_100223264 | 284 |
| 356 | 3300014968 | Ga0157379_10174706 | Ga0157379_101747061 | 284 |
| 357 | 3300014969 | Ga0157376_10023861 | Ga0157376_100238613 | 284 |
| 358 | 3300014969 | Ga0157376_10044463 | Ga0157376_100444633 | 284 |
| 359 | 3300014969 | Ga0157376_10805989 | Ga0157376_108059891 | 284 |
| 360 | 3300017792 | Ga0163161_10055232 | Ga0163161_100552324 | 284 |
| 361 | 3300020069 | Ga0197907_10130176 | Ga0197907_101301761 | 284 |
| 362 | 3300020069 | Ga0197907_10200061 | Ga0197907_102000611 | 284 |
| 363 | 3300020070 | Ga0206356_10197226 | Ga0206356_101972261 | 284 |
| 364 | 3300020076 | Ga0206355_1393545 | Ga0206355_13935451 | 284 |
| 365 | 3300020076 | Ga0206355_1640260 | Ga0206355_16402601 | 284 |
| 366 | 3300020077 | Ga0206351_10618912 | Ga0206351_106189121 | 284 |
| 367 | 3300020078 | Ga0206352_10915830 | Ga0206352_109158301 | 284 |
| 368 | 3300020080 | Ga0206350_11571727 | Ga0206350_115717273 | 284 |
| 369 | 3300020082 | Ga0206353_12047086 | Ga0206353_120470861 | 284 |
| 370 | 3300020610 | Ga0154015_1398831 | Ga0154015_13988312 | 284 |
| 371 | 3300021361 | Ga0213872_10024260 | Ga0213872_100242603 | 284 |
| 372 | 3300021361 | Ga0213872_10039843 | Ga0213872_100398432 | 284 |
| 373 | 3300021361 | Ga0213872_10063524 | Ga0213872_100635242 | 284 |
| 374 | 3300021388 | Ga0213875_10012867 | Ga0213875_100128675 | 284 |
| 375 | 3300022467 | Ga0224712_10077080 | Ga0224712_100770801 | 284 |
| 376 | 3300022467 | Ga0224712_10191885 | Ga0224712_101918851 | 284 |
| 377 | 3300022467 | Ga0224712_10202143 | Ga0224712_102021431 | 284 |
| 378 | 3300024227 | Ga0228598_1011194 | Ga0228598_10111942 | 284 |
| 379 | 3300025321 | Ga0207656_10050977 | Ga0207656_100509772 | 284 |
| 380 | 3300025898 | Ga0207692_10014933 | Ga0207692_100149332 | 284 |
| 381 | 3300025903 | Ga0207680_10166360 | Ga0207680_101663601 | 284 |
| 382 | 3300025904 | Ga0207647_10003063 | Ga0207647_100030638 | 284 |
| 383 | 3300025904 | Ga0207647_10013832 | Ga0207647_100138321 | 284 |
| 384 | 3300025904 | Ga0207647_10027843 | Ga0207647_100278433 | 284 |
| 385 | 3300025906 | Ga0207699_10285433 | Ga0207699_102854332 | 284 |
| 386 | 3300025909 | Ga0207705_10003727 | Ga0207705_100037277 | 284 |
| 387 | 3300025909 | Ga0207705_10030086 | Ga0207705_100300863 | 284 |
| 388 | 3300025909 | Ga0207705_10031987 | Ga0207705_100319873 | 284 |
| 389 | 3300025909 | Ga0207705_10228848 | Ga0207705_102288482 | 284 |
| 390 | 3300025909 | Ga0207705_10340632 | Ga0207705_103406321 | 284 |
| 391 | 3300025910 | Ga0207684_10001901 | Ga0207684_100019013 | 284 |
| 392 | 3300025910 | Ga0207684_10040662 | Ga0207684_100406622 | 284 |
| 393 | 3300025912 | Ga0207707_10058238 | Ga0207707_100582382 | 284 |
| 394 | 3300025912 | Ga0207707_10090259 | Ga0207707_100902592 | 284 |
| 395 | 3300025912 | Ga0207707_10101603 | Ga0207707_101016032 | 284 |
| 396 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000012299 | 284 |
| 397 | 3300025913 | Ga0207695_10000177 | Ga0207695_1000017767 | 284 |
| 398 | 3300025913 | Ga0207695_10023116 | Ga0207695_100231163 | 284 |
| 399 | 3300025913 | Ga0207695_10084966 | Ga0207695_100849662 | 284 |
| 400 | 3300025913 | Ga0207695_10129495 | Ga0207695_101294953 | 284 |
| 401 | 3300025913 | Ga0207695_10329851 | Ga0207695_103298511 | 284 |
| 402 | 3300025914 | Ga0207671_10027024 | Ga0207671_100270242 | 284 |
| 403 | 3300025914 | Ga0207671_10051647 | Ga0207671_100516473 | 284 |
| 404 | 3300025914 | Ga0207671_10059752 | Ga0207671_100597523 | 284 |
| 405 | 3300025914 | Ga0207671_10092267 | Ga0207671_100922672 | 284 |
| 406 | 3300025914 | Ga0207671_10100994 | Ga0207671_101009942 | 284 |
| 407 | 3300025915 | Ga0207693_10002318 | Ga0207693_100023188 | 284 |
| 408 | 3300025915 | Ga0207693_10047808 | Ga0207693_100478083 | 284 |
| 409 | 3300025915 | Ga0207693_10208619 | Ga0207693_102086191 | 284 |
| 410 | 3300025916 | Ga0207663_10000716 | Ga0207663_100007162 | 284 |
| 411 | 3300025917 | Ga0207660_10014861 | Ga0207660_100148612 | 284 |
| 412 | 3300025919 | Ga0207657_10001188 | Ga0207657_1000118810 | 284 |
| 413 | 3300025919 | Ga0207657_10039381 | Ga0207657_100393811 | 284 |
| 414 | 3300025919 | Ga0207657_10233532 | Ga0207657_102335322 | 284 |
| 415 | 3300025920 | Ga0207649_10158915 | Ga0207649_101589152 | 284 |
| 416 | 3300025920 | Ga0207649_10214116 | Ga0207649_102141162 | 284 |
| 417 | 3300025921 | Ga0207652_10019678 | Ga0207652_100196781 | 284 |
| 418 | 3300025922 | Ga0207646_10075160 | Ga0207646_100751602 | 284 |
| 419 | 3300025922 | Ga0207646_10239272 | Ga0207646_102392722 | 284 |
| 420 | 3300025924 | Ga0207694_10082987 | Ga0207694_100829872 | 284 |
| 421 | 3300025926 | Ga0207659_10427694 | Ga0207659_104276941 | 284 |
| 422 | 3300025929 | Ga0207664_10053848 | Ga0207664_100538482 | 284 |
| 423 | 3300025929 | Ga0207664_10152319 | Ga0207664_101523192 | 284 |
| 424 | 3300025929 | Ga0207664_10185904 | Ga0207664_101859041 | 284 |
| 425 | 3300025931 | Ga0207644_10019102 | Ga0207644_100191024 | 284 |
| 426 | 3300025932 | Ga0207690_10003397 | Ga0207690_100033973 | 284 |
| 427 | 3300025932 | Ga0207690_10020087 | Ga0207690_100200872 | 284 |
| 428 | 3300025933 | Ga0207706_10021352 | Ga0207706_100213525 | 284 |
| 429 | 3300025938 | Ga0207704_10145718 | Ga0207704_101457182 | 284 |
| 430 | 3300025939 | Ga0207665_10014502 | Ga0207665_100145022 | 284 |
| 431 | 3300025939 | Ga0207665_10271740 | Ga0207665_102717401 | 284 |
| 432 | 3300025941 | Ga0207711_10062341 | Ga0207711_100623411 | 284 |
| 433 | 3300025941 | Ga0207711_10667878 | Ga0207711_106678781 | 284 |
| 434 | 3300025942 | Ga0207689_10036312 | Ga0207689_100363121 | 284 |
| 435 | 3300025942 | Ga0207689_10144450 | Ga0207689_101444502 | 284 |
| 436 | 3300025944 | Ga0207661_10000008 | Ga0207661_1000000893 | 284 |
| 437 | 3300025944 | Ga0207661_10019594 | Ga0207661_100195943 | 284 |
| 438 | 3300025944 | Ga0207661_10296383 | Ga0207661_102963831 | 284 |
| 439 | 3300025949 | Ga0207667_10000251 | Ga0207667_1000025119 | 284 |
| 440 | 3300025949 | Ga0207667_10022480 | Ga0207667_100224805 | 284 |
| 441 | 3300025949 | Ga0207667_10240988 | Ga0207667_102409882 | 284 |
| 442 | 3300025949 | Ga0207667_10270016 | Ga0207667_102700161 | 284 |
| 443 | 3300025949 | Ga0207667_10356585 | Ga0207667_103565852 | 284 |
| 444 | 3300025949 | Ga0207667_10433034 | Ga0207667_104330342 | 284 |
| 445 | 3300025949 | Ga0207667_10469016 | Ga0207667_104690162 | 284 |
| 446 | 3300025972 | Ga0207668_10252083 | Ga0207668_102520832 | 284 |
| 447 | 3300025981 | Ga0207640_10000002 | Ga0207640_10000002333 | 284 |
| 448 | 3300025981 | Ga0207640_10333582 | Ga0207640_103335821 | 284 |
| 449 | 3300026023 | Ga0207677_10085924 | Ga0207677_100859242 | 284 |
| 450 | 3300026023 | Ga0207677_10128172 | Ga0207677_101281722 | 284 |
| 451 | 3300026035 | Ga0207703_10001373 | Ga0207703_100013734 | 284 |
| 452 | 3300026035 | Ga0207703_10210257 | Ga0207703_102102571 | 284 |
| 453 | 3300026041 | Ga0207639_10000011 | Ga0207639_10000011207 | 284 |
| 454 | 3300026041 | Ga0207639_10078842 | Ga0207639_100788422 | 284 |
| 455 | 3300026041 | Ga0207639_10112542 | Ga0207639_101125422 | 284 |
| 456 | 3300026067 | Ga0207678_10000939 | Ga0207678_100009398 | 284 |
| 457 | 3300026067 | Ga0207678_10001450 | Ga0207678_1000145010 | 284 |
| 458 | 3300026067 | Ga0207678_10002208 | Ga0207678_100022086 | 284 |
| 459 | 3300026067 | Ga0207678_10103054 | Ga0207678_101030542 | 284 |
| 460 | 3300026067 | Ga0207678_10119063 | Ga0207678_101190632 | 284 |
| 461 | 3300026067 | Ga0207678_10195653 | Ga0207678_101956532 | 284 |
| 462 | 3300026078 | Ga0207702_10001578 | Ga0207702_1000157813 | 284 |
| 463 | 3300026078 | Ga0207702_10383903 | Ga0207702_103839031 | 284 |
| 464 | 3300026078 | Ga0207702_10479433 | Ga0207702_104794331 | 284 |
| 465 | 3300026088 | Ga0207641_10033103 | Ga0207641_100331033 | 284 |
| 466 | 3300026088 | Ga0207641_10054514 | Ga0207641_100545143 | 284 |
| 467 | 3300026088 | Ga0207641_10207608 | Ga0207641_102076081 | 284 |
| 468 | 3300026089 | Ga0207648_10026270 | Ga0207648_100262702 | 284 |
| 469 | 3300026089 | Ga0207648_10435950 | Ga0207648_104359501 | 284 |
| 470 | 3300026095 | Ga0207676_10096187 | Ga0207676_100961872 | 284 |
| 471 | 3300026095 | Ga0207676_10107474 | Ga0207676_101074743 | 284 |
| 472 | 3300026116 | Ga0207674_10001500 | Ga0207674_100015009 | 284 |
| 473 | 3300026116 | Ga0207674_10523908 | Ga0207674_105239081 | 284 |
| 474 | 3300026121 | Ga0207683_10007557 | Ga0207683_100075578 | 284 |
| 475 | 3300026142 | Ga0207698_10122389 | Ga0207698_101223893 | 284 |
| 476 | 3300026142 | Ga0207698_10207725 | Ga0207698_102077252 | 284 |
| 477 | 3300028379 | Ga0268266_10016406 | Ga0268266_100164062 | 284 |
| 478 | 3300028380 | Ga0268265_10182032 | Ga0268265_101820321 | 284 |
| 479 | 3300028381 | Ga0268264_10006871 | Ga0268264_100068713 | 284 |
| 480 | 3300028800 | Ga0265338_10189767 | Ga0265338_101897672 | 284 |
| 481 | 3300031239 | Ga0265328_10050767 | Ga0265328_100507672 | 284 |
| 482 | 3300031249 | Ga0265339_10000694 | Ga0265339_1000069419 | 284 |
| 483 | 3300031595 | Ga0265313_10116693 | Ga0265313_101166931 | 284 |
| 484 | 3300033180 | Ga0307510_10057547 | Ga0307510_100575471 | 284 |
| 485 | 3300036401 | Ga0373937_0495471 | Ga0373937_0495471_62_928 | 284 |
| 486 | 3300037418 | Ga0395900_0096834 | Ga0395900_0096834_1590_2459 | 284 |
| 487 | 3300037466 | Ga0395898_0026273 | Ga0395898_0026273_1270_2130 | 284 |
| 488 | 3300037466 | Ga0395898_0514315 | Ga0395898_0514315_253_1113 | 284 |
| 489 | 3300037853 | Ga0436364_0609851 | Ga0436364_0609851_1270_2142 | 284 |
| 490 | 3300037853 | Ga0436364_0787170 | Ga0436364_0787170_141_998 | 284 |
| 491 | 3300037853 | Ga0436364_0814149 | Ga0436364_0814149_49_906 | 284 |
| 492 | 3300039438 | Ga0436360_0111215 | Ga0436360_0111215_6821_7690 | 284 |
| 493 | 3300039438 | Ga0436360_0654204 | Ga0436360_0654204_270_1139 | 284 |
| 494 | 3300039438 | Ga0436360_0673809 | Ga0436360_0673809_116_985 | 284 |
| 495 | 3300039447 | Ga0436361_0070516 | Ga0436361_0070516_8604_9662 | 284 |
| 496 | 3300039447 | Ga0436361_0195153 | Ga0436361_0195153_614_1471 | 284 |
| 497 | 3300039447 | Ga0436361_0248901 | Ga0436361_0248901_3176_4045 | 284 |
| 498 | 3300039447 | Ga0436361_0761235 | Ga0436361_0761235_85110_85967 | 284 |
| 499 | 3300044684 | Ga0466966_0025506 | Ga0466966_0025506_686_1546 | 284 |
| 500 | 3300044706 | Ga0466964_0024177 | Ga0466964_0024177_309_1169 | 284 |
| 501 | 3300045976 | Ga0466967_0463958 | Ga0466967_0463958_220_1080 | 284 |
| 502 | 3300045976 | Ga0466967_0486052 | Ga0466967_0486052_260_1120 | 284 |
| 503 | 3300046455 | Ga0495603_0001049 | Ga0495603_0001049_5994_6857 | 284 |
| 504 | 3300046459 | Ga0495629_0040041 | Ga0495629_0040041_805_1662 | 284 |
| 505 | 3300046459 | Ga0495629_0046247 | Ga0495629_0046247_1280_2146 | 284 |
| 506 | 3300046462 | Ga0495651_0000991 | Ga0495651_0000991_8880_9743 | 284 |
| 507 | 3300046472 | Ga0495580_0058448 | Ga0495580_0058448_521_1384 | 284 |
| 508 | 3300046472 | Ga0495580_0271764 | Ga0495580_0271764_244_1104 | 284 |
| 509 | 3300046473 | Ga0495582_0002882 | Ga0495582_0002882_5787_6650 | 284 |
| 510 | 3300046476 | Ga0495662_0001218 | Ga0495662_0001218_11050_11913 | 284 |
| 511 | 3300046477 | Ga0495664_0007921 | Ga0495664_0007921_465_1328 | 284 |
| 512 | 3300046499 | Ga0495594_0000311 | Ga0495594_0000311_15274_16137 | 284 |
| 513 | 3300046499 | Ga0495594_0007732 | Ga0495594_0007732_4106_4969 | 284 |
| 514 | 3300046506 | Ga0495583_0040724 | Ga0495583_0040724_1269_2132 | 284 |
| 515 | 3300046514 | Ga0495618_0133075 | Ga0495618_0133075_255_1118 | 284 |
| 516 | 3300046516 | Ga0495628_0164220 | Ga0495628_0164220_772_1635 | 284 |
| 517 | 3300046523 | Ga0495644_0001019 | Ga0495644_0001019_7787_8650 | 284 |
| 518 | 3300046526 | Ga0495666_0002474 | Ga0495666_0002474_56_919 | 284 |
| 519 | 3300046528 | Ga0495642_0120638 | Ga0495642_0120638_105_968 | 284 |
| 520 | 3300046536 | Ga0495587_0098916 | Ga0495587_0098916_420_1286 | 284 |
| 521 | 3300046538 | Ga0495609_0008328 | Ga0495609_0008328_3833_4696 | 284 |
| 522 | 3300046557 | Ga0495622_0040610 | Ga0495622_0040610_1039_1902 | 284 |
| 523 | 3300046558 | Ga0495633_0012427 | Ga0495633_0012427_3528_4391 | 284 |
| 524 | 3300046642 | Ga0495634_0001013 | Ga0495634_0001013_11837_12700 | 284 |
| 525 | 3300046660 | Ga0495625_0158440 | Ga0495625_0158440_19_882 | 284 |
| 526 | 3300046678 | Ga0495599_0001904 | Ga0495599_0001904_2726_3589 | 284 |
| 527 | 3300046684 | Ga0495669_0003529 | Ga0495669_0003529_3071_3934 | 284 |
| 528 | 3300046689 | Ga0495613_0005291 | Ga0495613_0005291_5663_6526 | 284 |
| 529 | 3300046690 | Ga0495624_0003225 | Ga0495624_0003225_11245_12108 | 284 |
| 530 | 3300046809 | Ga0495600_0079203 | Ga0495600_0079203_546_1409 | 284 |
| 531 | 3300047315 | Ga0495581_0001414 | Ga0495581_0001414_4126_4989 | 284 |
| 532 | 3300047321 | Ga0495676_0000384 | Ga0495676_0000384_23139_24002 | 284 |
| 533 | 3300047323 | Ga0495683_0093917 | Ga0495683_0093917_295_1158 | 284 |
| 534 | 3300047444 | Ga0495675_0002097 | Ga0495675_0002097_149_1012 | 284 |
| 535 | 3300047446 | Ga0495679_063778 | Ga0495679_063778_192_1055 | 284 |
| 536 | 3300048089 | Ga0495614_0000029 | Ga0495614_0000029_28209_29072 | 284 |
| 537 | 3300048908 | Ga0496105_0015591 | Ga0496105_0015591_803_1660 | 284 |
| 538 | 3300048915 | Ga0496112_0103579 | Ga0496112_0103579_409_1293 | 284 |
| 539 | 3300048917 | Ga0496114_0008141 | Ga0496114_0008141_6893_7750 | 284 |
| 540 | 3300048929 | Ga0496126_0000333 | Ga0496126_0000333_56675_57535 | 284 |
| 541 | 3300048929 | Ga0496126_0102647 | Ga0496126_0102647_124_984 | 284 |
| 542 | 3300049589 | Ga0501073_0232615 | Ga0501073_0232615_191_1051 | 284 |
| 543 | 3300053093 | Ga0500651_0000007 | Ga0500651_0000007_244234_245094 | 284 |
| 544 | 3300055283 | Ga0500661_000345 | Ga0500661_000345_5235_6095 | 284 |
| 545 | 3300059508 | Ga0587088_019594 | Ga0587088_019594_104_973 | 284 |
| 546 | 3300059512 | Ga0587092_016174 | Ga0587092_016174_156_1025 | 284 |
| 547 | 3300059640 | Ga0587067_015700 | Ga0587067_015700_35_904 | 284 |
| 548 | 3300060353 | Ga0501082_0000192 | Ga0501082_0000192_40509_41366 | 284 |
| 549 | 3300005436 | Ga0070713_100139246 | Ga0070713_1001392462 | 285 |
| 550 | 3300013296 | Ga0157374_10043305 | Ga0157374_100433053 | 285 |
| 551 | 3300014969 | Ga0157376_10000041 | Ga0157376_1000004187 | 285 |
| 552 | 3300025928 | Ga0207700_10034308 | Ga0207700_100343081 | 285 |
| 553 | 3300025939 | Ga0207665_10006036 | Ga0207665_100060367 | 285 |
| 554 | 3300035083 | Ga0373926_0004932 | Ga0373926_0004932_1604_2476 | 285 |
| 555 | 3300035171 | Ga0373946_0019411 | Ga0373946_0019411_978_1850 | 285 |
| 556 | 3300035695 | Ga0373927_0003524 | Ga0373927_0003524_1427_2299 | 285 |
| 557 | 3300035695 | Ga0373927_0068300 | Ga0373927_0068300_151_1014 | 285 |
| 558 | 3300035725 | Ga0373947_0006601 | Ga0373947_0006601_5407_6279 | 285 |
| 559 | 3300037068 | Ga0373925_0004006 | Ga0373925_0004006_1422_2294 | 285 |
| 560 | 3300037853 | Ga0436364_0339530 | Ga0436364_0339530_107758_108627 | 285 |
| 561 | 3300039438 | Ga0436360_1304700 | Ga0436360_1304700_5710_6570 | 285 |
| 562 | 3300046473 | Ga0495582_0000192 | Ga0495582_0000192_25579_26577 | 285 |
| 563 | 3300047321 | Ga0495676_0134384 | Ga0495676_0134384_215_1087 | 285 |
| 564 | 3300048918 | Ga0496115_0036296 | Ga0496115_0036296_2688_3554 | 285 |
| 565 | 3300050514 | nmdc:mga08x19_188_c1 | nmdc:mga08x19_188_c1_8105_8977 | 285 |
| 566 | 3300003320 | rootH2_10006251 | rootH2_100062518 | 286 |
| 567 | 3300003320 | rootH2_10183644 | rootH2_101836442 | 286 |
| 568 | 3300005329 | Ga0070683_100106880 | Ga0070683_1001068802 | 286 |
| 569 | 3300005458 | Ga0070681_10086352 | Ga0070681_100863524 | 286 |
| 570 | 3300005467 | Ga0070706_100117947 | Ga0070706_1001179472 | 286 |
| 571 | 3300005539 | Ga0068853_100000464 | Ga0068853_10000046410 | 286 |
| 572 | 3300005539 | Ga0068853_100084650 | Ga0068853_1000846502 | 286 |
| 573 | 3300005563 | Ga0068855_100003189 | Ga0068855_1000031899 | 286 |
| 574 | 3300005563 | Ga0068855_100072726 | Ga0068855_1000727264 | 286 |
| 575 | 3300005577 | Ga0068857_100042707 | Ga0068857_1000427072 | 286 |
| 576 | 3300005578 | Ga0068854_100004181 | Ga0068854_1000041816 | 286 |
| 577 | 3300005578 | Ga0068854_100161759 | Ga0068854_1001617591 | 286 |
| 578 | 3300005614 | Ga0068856_100018356 | Ga0068856_1000183562 | 286 |
| 579 | 3300005614 | Ga0068856_100111328 | Ga0068856_1001113282 | 286 |
| 580 | 3300005614 | Ga0068856_100166330 | Ga0068856_1001663301 | 286 |
| 581 | 3300005616 | Ga0068852_100000032 | Ga0068852_10000003255 | 286 |
| 582 | 3300005616 | Ga0068852_100000199 | Ga0068852_10000019936 | 286 |
| 583 | 3300006028 | Ga0070717_10003870 | Ga0070717_100038704 | 286 |
| 584 | 3300006237 | Ga0097621_100161562 | Ga0097621_1001615622 | 286 |
| 585 | 3300006358 | Ga0068871_100107333 | Ga0068871_1001073332 | 286 |
| 586 | 3300009093 | Ga0105240_10000135 | Ga0105240_1000013592 | 286 |
| 587 | 3300009093 | Ga0105240_10054690 | Ga0105240_100546902 | 286 |
| 588 | 3300009098 | Ga0105245_10161177 | Ga0105245_101611772 | 286 |
| 589 | 3300009177 | Ga0105248_10013472 | Ga0105248_100134726 | 286 |
| 590 | 3300009545 | Ga0105237_10191985 | Ga0105237_101919852 | 286 |
| 591 | 3300009551 | Ga0105238_10000726 | Ga0105238_1000072612 | 286 |
| 592 | 3300009551 | Ga0105238_10110247 | Ga0105238_101102472 | 286 |
| 593 | 3300009551 | Ga0105238_10165817 | Ga0105238_101658172 | 286 |
| 594 | 3300010375 | Ga0105239_10002093 | Ga0105239_1000209318 | 286 |
| 595 | 3300010375 | Ga0105239_10058528 | Ga0105239_100585282 | 286 |
| 596 | 3300011119 | Ga0105246_10005875 | Ga0105246_100058752 | 286 |
| 597 | 3300013100 | Ga0157373_10021622 | Ga0157373_100216222 | 286 |
| 598 | 3300013100 | Ga0157373_10128449 | Ga0157373_101284491 | 286 |
| 599 | 3300013104 | Ga0157370_10000023 | Ga0157370_1000002338 | 286 |
| 600 | 3300013105 | Ga0157369_10000010 | Ga0157369_10000010116 | 286 |
| 601 | 3300013105 | Ga0157369_10001298 | Ga0157369_100012984 | 286 |
| 602 | 3300013105 | Ga0157369_10002224 | Ga0157369_100022244 | 286 |
| 603 | 3300013105 | Ga0157369_10014377 | Ga0157369_100143776 | 286 |
| 604 | 3300013105 | Ga0157369_10129140 | Ga0157369_101291403 | 286 |
| 605 | 3300013296 | Ga0157374_10011786 | Ga0157374_100117862 | 286 |
| 606 | 3300013296 | Ga0157374_10058451 | Ga0157374_100584512 | 286 |
| 607 | 3300013296 | Ga0157374_10070498 | Ga0157374_100704982 | 286 |
| 608 | 3300013297 | Ga0157378_10071073 | Ga0157378_100710732 | 286 |
| 609 | 3300013297 | Ga0157378_10110347 | Ga0157378_101103472 | 286 |
| 610 | 3300013306 | Ga0163162_10043586 | Ga0163162_100435861 | 286 |
| 611 | 3300013307 | Ga0157372_10000055 | Ga0157372_1000005595 | 286 |
| 612 | 3300013307 | Ga0157372_10005506 | Ga0157372_100055065 | 286 |
| 613 | 3300013307 | Ga0157372_10042665 | Ga0157372_100426653 | 286 |
| 614 | 3300013307 | Ga0157372_10048425 | Ga0157372_100484252 | 286 |
| 615 | 3300013307 | Ga0157372_10134615 | Ga0157372_101346152 | 286 |
| 616 | 3300013307 | Ga0157372_10345843 | Ga0157372_103458432 | 286 |
| 617 | 3300014968 | Ga0157379_10030324 | Ga0157379_100303242 | 286 |
| 618 | 3300014969 | Ga0157376_10042803 | Ga0157376_100428036 | 286 |
| 619 | 3300021361 | Ga0213872_10003517 | Ga0213872_100035174 | 286 |
| 620 | 3300022467 | Ga0224712_10128408 | Ga0224712_101284081 | 286 |
| 621 | 3300025910 | Ga0207684_10044538 | Ga0207684_100445381 | 286 |
| 622 | 3300025911 | Ga0207654_10000350 | Ga0207654_1000035019 | 286 |
| 623 | 3300025912 | Ga0207707_10061328 | Ga0207707_100613283 | 286 |
| 624 | 3300025913 | Ga0207695_10000050 | Ga0207695_1000005097 | 286 |
| 625 | 3300025913 | Ga0207695_10000188 | Ga0207695_10000188151 | 286 |
| 626 | 3300025913 | Ga0207695_10000787 | Ga0207695_1000078736 | 286 |
| 627 | 3300025913 | Ga0207695_10057750 | Ga0207695_100577503 | 286 |
| 628 | 3300025914 | Ga0207671_10000324 | Ga0207671_1000032420 | 286 |
| 629 | 3300025917 | Ga0207660_10340310 | Ga0207660_103403102 | 286 |
| 630 | 3300025919 | Ga0207657_10107113 | Ga0207657_101071132 | 286 |
| 631 | 3300025924 | Ga0207694_10000083 | Ga0207694_1000008310 | 286 |
| 632 | 3300025924 | Ga0207694_10013782 | Ga0207694_100137824 | 286 |
| 633 | 3300025924 | Ga0207694_10014157 | Ga0207694_100141571 | 286 |
| 634 | 3300025939 | Ga0207665_10001965 | Ga0207665_100019652 | 286 |
| 635 | 3300025941 | Ga0207711_10015831 | Ga0207711_100158313 | 286 |
| 636 | 3300025944 | Ga0207661_10120618 | Ga0207661_101206182 | 286 |
| 637 | 3300025949 | Ga0207667_10003852 | Ga0207667_100038524 | 286 |
| 638 | 3300025949 | Ga0207667_10021968 | Ga0207667_100219684 | 286 |
| 639 | 3300025949 | Ga0207667_10041383 | Ga0207667_100413833 | 286 |
| 640 | 3300025949 | Ga0207667_10114593 | Ga0207667_101145932 | 286 |
| 641 | 3300025981 | Ga0207640_10030970 | Ga0207640_100309701 | 286 |
| 642 | 3300026023 | Ga0207677_10595188 | Ga0207677_105951881 | 286 |
| 643 | 3300026041 | Ga0207639_10000027 | Ga0207639_1000002716 | 286 |
| 644 | 3300026078 | Ga0207702_10001494 | Ga0207702_1000149420 | 286 |
| 645 | 3300026078 | Ga0207702_10185384 | Ga0207702_101853842 | 286 |
| 646 | 3300026116 | Ga0207674_10013356 | Ga0207674_100133566 | 286 |
| 647 | 3300026142 | Ga0207698_10000008 | Ga0207698_10000008174 | 286 |
| 648 | 3300026142 | Ga0207698_10000237 | Ga0207698_1000023719 | 286 |
| 649 | 3300028379 | Ga0268266_10092298 | Ga0268266_100922982 | 286 |
| 650 | 3300036401 | Ga0373937_0013743 | Ga0373937_0013743_3576_4436 | 286 |
| 651 | 3300042005 | Ga0439448_0006572 | Ga0439448_0006572_2160_3026 | 286 |
| 652 | 3300046507 | Ga0495606_0176823 | Ga0495606_0176823_246_1136 | 286 |
| 653 | 3300046660 | Ga0495625_0017649 | Ga0495625_0017649_244_1134 | 286 |
| 654 | 3300046692 | Ga0495671_0133217 | Ga0495671_0133217_153_1028 | 286 |
| 655 | 3300046694 | Ga0495649_0078066 | Ga0495649_0078066_531_1421 | 286 |
| 656 | 3300047319 | Ga0495674_0106197 | Ga0495674_0106197_92_973 | 286 |
| 657 | 3300048929 | Ga0496126_0000187 | Ga0496126_0000187_28027_28899 | 286 |
| 658 | 3300049460 | Ga0495682_0004897 | Ga0495682_0004897_2719_3609 | 286 |
| 659 | 3300050507 | nmdc:mga05p37_404163_c1 | nmdc:mga05p37_404163_c1_246_1133 | 286 |
| 660 | 3300050514 | nmdc:mga08x19_10818_c1 | nmdc:mga08x19_10818_c1_2045_2932 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2huo-assembly1.cif.gz_A | crystal structure of mouse myo-inositol oxygenase in complex with substrate | 0.9569 | 35 | 286 |
| 2ibn-assembly1.cif.gz_A | crystal structure of human myo-inositol oxygenase (miox) | 0.9497 | 45 | 286 |
| 2ibn-assembly2.cif.gz_B | crystal structure of human myo-inositol oxygenase (miox) | 0.9358 | 45 | 286 |
| 2ibn-assembly1.cif.gz_A | crystal structure of human myo-inositol oxygenase (miox) | 0.9343 | 45 | 286 |
| 2huo-assembly1.cif.gz_A | crystal structure of mouse myo-inositol oxygenase in complex with substrate | 0.9317 | 35 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6P1M6_55_306_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9706 | 44 | 286 | 1.10.3210.10 |
| af_Q9QXN4_37_285_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9675 | 44 | 286 | 1.10.3210.10 |
| af_Q9QXN4_37_285_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.941 | 44 | 286 | 1.10.3210.10 |
| af_A0A1D6P1M6_55_306_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9329 | 44 | 286 | 1.10.3210.10 |
| af_Q2FZ08_320_474_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5318 | 82 | 274 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W0BBD3-F1-model_v4 | Inositol oxygenase | 0.9965 | 104 | 286 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A4S4KQN7-F1-model_v4 | Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) | 0.9861 | 102 | 286 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A2W0BBD3-F1-model_v4 | Inositol oxygenase | 0.9857 | 104 | 286 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A3M6XG58-F1-model_v4 | Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) | 0.9821 | 102 | 281 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A2N1MRT8-F1-model_v4 | Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) | 0.9818 | 77 | 286 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar