metagRoot

F473310

General Info

Members	Datasets	Scaffolds	Average Seq Length
660	289	659	112

Family's Representative Sequence

Representative Sequence	3300005434\|Ga0070709_11209736\|Ga0070709_112097362
Length	120
Sequence	LSITEGRAEVPVSKPTDLVQGTVDLLILKIVALEPIHGWAVAQRIQQVSKDVLKLNQSSLYPALHRLEKQGWVQSEWGASEHGRRAKYYSLTKAGHKRLEKELADWKRLSSAITLVTRLA

Samples

	Sample ID	Description	Type	Environment
1	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
2	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
3	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
4	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
5	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
22	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
23	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
24	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
25	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
49	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
66	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
67	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
68	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
69	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
70	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
71	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
72	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
73	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
74	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
76	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
77	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
78	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
79	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
80	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
81	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
82	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
83	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
85	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
86	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
87	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
89	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
90	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
91	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
92	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
93	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
94	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
95	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
96	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
97	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
98	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
99	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
100	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
101	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
102	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
103	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
104	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
107	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
111	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
112	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
113	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
167	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
168	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
172	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
173	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
174	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
175	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
176	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
177	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
178	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
179	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
180	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
181	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
182	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
183	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
184	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
185	3300033544	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5	Metagenome	Unclassified
186	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
187	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
188	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
189	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
190	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
191	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
192	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
193	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
194	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
195	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
196	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
197	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
198	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
199	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
200	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
201	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
202	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
203	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
204	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
205	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
206	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
207	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
208	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
209	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
210	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
211	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
212	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
213	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
214	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
215	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
216	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
217	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
218	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
219	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
220	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
221	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
222	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
223	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
224	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
225	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
226	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
227	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
228	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
229	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
230	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
231	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
232	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
233	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
234	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
235	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
236	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
237	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
238	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
239	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
240	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
241	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
242	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
243	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
244	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
245	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
246	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
247	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
248	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
249	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
250	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
251	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
252	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
253	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
254	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
255	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
256	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
257	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
258	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
259	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
260	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
261	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
262	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
263	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
264	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
265	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
266	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
267	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
268	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
269	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
270	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
271	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
272	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
273	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
274	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
275	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
276	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
277	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
278	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
279	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
280	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
281	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
282	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
283	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
284	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
285	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
286	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
287	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
288	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
289	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.85
Metatranscriptomes	0.15
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.06
Nodule	0
Rhizoplane	4.09
Rhizosphere	93.79
Stem	0
Stem Tuber	0
Unclassified	1.06

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJNas_1001492	3300000546	Bacteria	3311
2	JGI24743J22301_10011702	3300001991	Bacteria	1586
3	rootH2_10227083	3300003320	Unclassified	1104
4	Ga0065712_10137762	3300005290	Unclassified	1480
5	Ga0065715_10182714	3300005293	Bacteria	1465
6	Ga0070658_10233116	3300005327	Bacteria	1559
7	Ga0070658_10777637	3300005327	Unclassified	831
8	Ga0070658_11228370	3300005327	Unclassified	651
9	Ga0070683_100000055	3300005329	Bacteria	86882
10	Ga0070683_100061390	3300005329	Unclassified	3495
11	Ga0070683_100246013	3300005329	Bacteria	1701
12	Ga0070670_100288296	3300005331	Bacteria	1434
13	Ga0070670_101271617	3300005331	Unclassified	673
14	Ga0068869_100003494	3300005334	Bacteria	9625
15	Ga0070666_10655293	3300005335	Unclassified	768
16	Ga0070680_100107309	3300005336	Unclassified	2322
17	Ga0070680_100623154	3300005336	Bacteria	926
18	Ga0068868_100000946	3300005338	Bacteria	19740
19	Ga0068868_102282052	3300005338	Bacteria	516
20	Ga0070661_100080887	3300005344	Unclassified	2398
21	Ga0070661_100415512	3300005344	Bacteria	1066
22	Ga0070661_101182145	3300005344	Bacteria	639
23	Ga0070669_101474860	3300005353	Bacteria	591
24	Ga0070671_100000919	3300005355	Bacteria	21487
25	Ga0070674_100466168	3300005356	Bacteria	1045
26	Ga0070674_101197158	3300005356	Unclassified	674
27	Ga0070674_101572155	3300005356	Bacteria	592
28	Ga0070673_101551954	3300005364	Unclassified	625
29	Ga0070688_100109077	3300005365	Bacteria	1838
30	Ga0070688_100580674	3300005365	Bacteria	856
31	Ga0070688_101085523	3300005365	Bacteria	639
32	Ga0070659_101939099	3300005366	Unclassified	528
33	Ga0070667_100000566	3300005367	Bacteria	36566
34	Ga0070703_10222437	3300005406	Bacteria	752
35	Ga0070709_10000006	3300005434	Bacteria	186534
36	Ga0070709_10087715	3300005434	Bacteria	2045
37	Ga0070709_11209736	3300005434	Bacteria	607
38	Ga0070714_100056805	3300005435	Bacteria	3348
39	Ga0070714_100521792	3300005435	Unclassified	1135
40	Ga0070713_100006929	3300005436	Bacteria	7911
41	Ga0070713_100043854	3300005436	Unclassified	3659
42	Ga0070713_100115186	3300005436	Bacteria	2349
43	Ga0070713_100482201	3300005436	Unclassified	1168
44	Ga0070713_100639900	3300005436	Bacteria	1012
45	Ga0070713_101264080	3300005436	Unclassified	715
46	Ga0070710_10073995	3300005437	Unclassified	1971
47	Ga0070710_10180016	3300005437	Bacteria	1323
48	Ga0070711_100165530	3300005439	Bacteria	1680
49	Ga0070711_100283349	3300005439	Bacteria	1312
50	Ga0070705_100310609	3300005440	Bacteria	1134
51	Ga0070705_101407563	3300005440	Unclassified	581
52	Ga0070700_101650481	3300005441	Bacteria	549
53	Ga0070694_100001588	3300005444	Bacteria	13372
54	Ga0070694_100353279	3300005444	Bacteria	1139
55	Ga0070694_100506720	3300005444	Bacteria	961
56	Ga0070694_101153931	3300005444	Bacteria	648
57	Ga0070694_101247842	3300005444	Bacteria	624
58	Ga0070708_100105035	3300005445	Bacteria	2591
59	Ga0070708_100321282	3300005445	Bacteria	1458
60	Ga0070708_101068170	3300005445	Bacteria	756
61	Ga0070708_101256750	3300005445	Bacteria	692
62	Ga0070663_100271156	3300005455	Bacteria	1349
63	Ga0070663_100473050	3300005455	Bacteria	1036
64	Ga0070663_100866538	3300005455	Bacteria	778
65	Ga0070678_100289996	3300005456	Bacteria	1387
66	Ga0070678_101356886	3300005456	Bacteria	663
67	Ga0070662_100326551	3300005457	Bacteria	1252
68	Ga0070662_100372311	3300005457	Bacteria	1174
69	Ga0070681_10134772	3300005458	Bacteria	2400
70	Ga0070681_11596790	3300005458	Unclassified	578
71	Ga0068867_101287504	3300005459	Bacteria	674
72	Ga0070685_10866142	3300005466	Unclassified	670
73	Ga0070706_101611584	3300005467	Unclassified	592
74	Ga0070706_101615861	3300005467	Bacteria	591
75	Ga0070707_100024002	3300005468	Bacteria	5771
76	Ga0070707_100523368	3300005468	Unclassified	1148
77	Ga0070707_100625507	3300005468	Bacteria	1039
78	Ga0070707_101746453	3300005468	Unclassified	589
79	Ga0070698_100032002	3300005471	Bacteria	5451
80	Ga0070698_101653037	3300005471	Bacteria	593
81	Ga0070699_100112923	3300005518	Bacteria	2387
82	Ga0070699_100140051	3300005518	Unclassified	2136
83	Ga0070679_100257799	3300005530	Unclassified	1699
84	Ga0070679_101292211	3300005530	Unclassified	675
85	Ga0070684_100000153	3300005535	Bacteria	47114
86	Ga0070684_100028387	3300005535	Bacteria	4734
87	Ga0070684_100064778	3300005535	Bacteria	3206
88	Ga0070684_100396225	3300005535	Bacteria	1273
89	Ga0070697_101056921	3300005536	Unclassified	722
90	Ga0070697_101109892	3300005536	Bacteria	704
91	Ga0070697_101434893	3300005536	Bacteria	616
92	Ga0068853_100098783	3300005539	Bacteria	2578
93	Ga0070672_101129617	3300005543	Bacteria	697
94	Ga0070672_101172373	3300005543	Bacteria	684
95	Ga0070695_100000737	3300005545	Bacteria	17463
96	Ga0070695_101050295	3300005545	Bacteria	665
97	Ga0070696_100021909	3300005546	Unclassified	4335
98	Ga0070693_100032242	3300005547	Unclassified	2880
99	Ga0070693_100466874	3300005547	Bacteria	889
100	Ga0070665_100398819	3300005548	Bacteria	1383
101	Ga0070665_100514723	3300005548	Bacteria	1208
102	Ga0070704_100113751	3300005549	Unclassified	2064
103	Ga0070704_100290292	3300005549	Bacteria	1359
104	Ga0070704_100587634	3300005549	Bacteria	977
105	Ga0070704_100982158	3300005549	Bacteria	763
106	Ga0070704_101453804	3300005549	Bacteria	630
107	Ga0068855_100000842	3300005563	Bacteria	37998
108	Ga0068855_100003222	3300005563	Bacteria	19974
109	Ga0068855_100716557	3300005563	Bacteria	1069
110	Ga0070664_100681258	3300005564	Unclassified	957
111	Ga0070664_100956394	3300005564	Bacteria	804
112	Ga0068857_100000243	3300005577	Bacteria	36451
113	Ga0068854_100072374	3300005578	Bacteria	2524
114	Ga0068856_100001360	3300005614	Bacteria	25702
115	Ga0068856_100001480	3300005614	Bacteria	24601
116	Ga0068856_100081017	3300005614	Bacteria	3220
117	Ga0068856_100358376	3300005614	Bacteria	1477
118	Ga0068856_101724443	3300005614	Bacteria	638
119	Ga0068852_100000054	3300005616	Bacteria	78608
120	Ga0068852_100022712	3300005616	Bacteria	5037
121	Ga0068852_101414988	3300005616	Bacteria	717
122	Ga0068859_100004590	3300005617	Bacteria	14089
123	Ga0068859_100355820	3300005617	Unclassified	1559
124	Ga0068859_100387045	3300005617	Bacteria	1494
125	Ga0068859_101405511	3300005617	Bacteria	770
126	Ga0068864_100000397	3300005618	Bacteria	37701
127	Ga0068864_101050300	3300005618	Unclassified	809
128	Ga0068851_10184539	3300005834	Bacteria	1157
129	Ga0068851_10894393	3300005834	Bacteria	556
130	Ga0068863_100000681	3300005841	Bacteria	34370
131	Ga0068863_101068173	3300005841	Bacteria	811
132	Ga0068858_100001479	3300005842	Bacteria	24177
133	Ga0068858_101304782	3300005842	Bacteria	714
134	Ga0068860_100000031	3300005843	Bacteria	255068
135	Ga0068860_102508280	3300005843	Unclassified	535
136	Ga0068862_100103664	3300005844	Bacteria	2491
137	Ga0068862_100538493	3300005844	Unclassified	1113
138	Ga0068862_100977320	3300005844	Unclassified	836
139	Ga0068862_101273329	3300005844	Bacteria	736
140	Ga0081455_10063446	3300005937	Bacteria	3100
141	Ga0081540_1031110	3300005983	Bacteria	2942
142	Ga0081540_1078498	3300005983	Unclassified	1496
143	Ga0081539_10013543	3300005985	Bacteria	6135
144	Ga0070717_10043832	3300006028	Unclassified	3652
145	Ga0070717_10224163	3300006028	Bacteria	1653
146	Ga0070717_10621259	3300006028	Bacteria	980
147	Ga0070717_10745776	3300006028	Unclassified	890
148	Ga0070717_10776969	3300006028	Bacteria	871
149	Ga0070717_10910458	3300006028	Unclassified	801
150	Ga0070717_10935682	3300006028	Unclassified	789
151	Ga0075364_10198059	3300006051	Bacteria	1361
152	Ga0075364_10888016	3300006051	Bacteria	607
153	Ga0075432_10518505	3300006058	Unclassified	534
154	Ga0070715_10031835	3300006163	Bacteria	2143
155	Ga0070715_10354133	3300006163	Unclassified	803
156	Ga0070716_100036593	3300006173	Bacteria	2707
157	Ga0070716_100494039	3300006173	Bacteria	901
158	Ga0070712_100077713	3300006175	Bacteria	2393
159	Ga0070712_100571780	3300006175	Bacteria	954
160	Ga0070712_101082732	3300006175	Bacteria	695
161	Ga0070712_101911946	3300006175	Bacteria	520
162	Ga0075366_10633390	3300006195	Bacteria	663
163	Ga0075366_10891630	3300006195	Bacteria	554
164	Ga0097621_100000168	3300006237	Bacteria	41208
165	Ga0097621_100105612	3300006237	Bacteria	2375
166	Ga0097621_100691122	3300006237	Bacteria	939
167	Ga0068871_100067233	3300006358	Bacteria	2939
168	Ga0075428_100012052	3300006844	Bacteria	9618
169	Ga0075428_100028815	3300006844	Bacteria	6145
170	Ga0075428_100207060	3300006844	Bacteria	2120
171	Ga0075428_100273212	3300006844	Bacteria	1818
172	Ga0075428_100519145	3300006844	Bacteria	1274
173	Ga0075428_100717357	3300006844	Bacteria	1065
174	Ga0075428_100806123	3300006844	Unclassified	998
175	Ga0075428_101234150	3300006844	Bacteria	787
176	Ga0075430_100022880	3300006846	Bacteria	5315
177	Ga0075430_100034932	3300006846	Bacteria	4268
178	Ga0075430_100054864	3300006846	Bacteria	3353
179	Ga0075430_100381177	3300006846	Bacteria	1164
180	Ga0075430_100538397	3300006846	Bacteria	963
181	Ga0075430_100713186	3300006846	Unclassified	827
182	Ga0075430_100906681	3300006846	Bacteria	726
183	Ga0075431_100004810	3300006847	Bacteria	13295
184	Ga0075431_100063265	3300006847	Bacteria	3818
185	Ga0075431_100076676	3300006847	Bacteria	3450
186	Ga0075431_100308427	3300006847	Unclassified	1598
187	Ga0075431_100468313	3300006847	Bacteria	1254
188	Ga0075431_100672043	3300006847	Bacteria	1015
189	Ga0075433_10108944	3300006852	Bacteria	2457
190	Ga0075433_10319727	3300006852	Unclassified	1373
191	Ga0075433_10489228	3300006852	Bacteria	1083
192	Ga0075433_10694670	3300006852	Bacteria	891
193	Ga0075434_100186121	3300006871	Unclassified	2097
194	Ga0075434_100242862	3300006871	Unclassified	1821
195	Ga0075434_100514676	3300006871	Bacteria	1217
196	Ga0075429_100002884	3300006880	Bacteria	14565
197	Ga0075429_100008270	3300006880	Bacteria	9044
198	Ga0075429_100399435	3300006880	Bacteria	1204
199	Ga0075429_100670918	3300006880	Bacteria	908
200	Ga0075429_100674660	3300006880	Bacteria	905
201	Ga0075429_100745433	3300006880	Bacteria	858
202	Ga0075436_100001602	3300006914	Bacteria	15472
203	Ga0075436_100008801	3300006914	Bacteria	6904
204	Ga0075436_100041703	3300006914	Bacteria	3167
205	Ga0075436_100180210	3300006914	Bacteria	1493
206	Ga0097620_100004589	3300006931	Bacteria	14089
207	Ga0097620_100355784	3300006931	Unclassified	1559
208	Ga0097620_100387051	3300006931	Bacteria	1494
209	Ga0097620_101405739	3300006931	Bacteria	770
210	Ga0075435_100080460	3300007076	Bacteria	2675
211	Ga0075435_100141765	3300007076	Bacteria	2017
212	Ga0075435_100887779	3300007076	Unclassified	777
213	Ga0075435_100903831	3300007076	Bacteria	770
214	Ga0075435_101060796	3300007076	Bacteria	708
215	Ga0099794_10248044	3300007265	Unclassified	918
216	Ga0105240_10000116	3300009093	Bacteria	165524
217	Ga0105240_10000171	3300009093	Bacteria	132604
218	Ga0105240_10002467	3300009093	Bacteria	29726
219	Ga0105240_10006077	3300009093	Bacteria	17834
220	Ga0105240_10024772	3300009093	Bacteria	7902
221	Ga0105240_10040545	3300009093	Bacteria	5954
222	Ga0105240_10359967	3300009093	Bacteria	1648
223	Ga0105240_10506516	3300009093	Bacteria	1342
224	Ga0105240_10882699	3300009093	Bacteria	963
225	Ga0105240_11458781	3300009093	Unclassified	718
226	Ga0105240_11530169	3300009093	Bacteria	699
227	Ga0111539_10043610	3300009094	Bacteria	5376
228	Ga0111539_10359743	3300009094	Bacteria	1694
229	Ga0111539_10975408	3300009094	Bacteria	985
230	Ga0111539_12508988	3300009094	Bacteria	598
231	Ga0105245_10000297	3300009098	Bacteria	47567
232	Ga0105245_11141813	3300009098	Unclassified	826
233	Ga0105245_12576461	3300009098	Unclassified	562
234	Ga0105245_12932776	3300009098	Bacteria	529
235	Ga0105247_10001010	3300009101	Bacteria	21268
236	Ga0105247_10182966	3300009101	Bacteria	1399
237	Ga0114129_10002900	3300009147	Bacteria	23999
238	Ga0114129_10003283	3300009147	Bacteria	22705
239	Ga0114129_10025086	3300009147	Bacteria	8449
240	Ga0114129_10071724	3300009147	Bacteria	4829
241	Ga0114129_10080682	3300009147	Bacteria	4522
242	Ga0114129_10228976	3300009147	Bacteria	2504
243	Ga0114129_10278119	3300009147	Bacteria	2237
244	Ga0114129_10334519	3300009147	Bacteria	2010
245	Ga0114129_10591545	3300009147	Bacteria	1439
246	Ga0114129_10670466	3300009147	Bacteria	1336
247	Ga0114129_10862998	3300009147	Bacteria	1150
248	Ga0114129_11174495	3300009147	Bacteria	957
249	Ga0114129_11910124	3300009147	Unclassified	720
250	Ga0114129_13286362	3300009147	Bacteria	523
251	Ga0105241_10000061	3300009174	Bacteria	83048
252	Ga0105241_10000380	3300009174	Bacteria	33883
253	Ga0105241_10359721	3300009174	Bacteria	1266
254	Ga0105241_10507990	3300009174	Bacteria	1076
255	Ga0105241_11239178	3300009174	Bacteria	708
256	Ga0105241_11703784	3300009174	Bacteria	613
257	Ga0105248_10184280	3300009177	Unclassified	2353
258	Ga0105248_10734771	3300009177	Bacteria	1114
259	Ga0105237_10001729	3300009545	Bacteria	28215
260	Ga0105237_10095436	3300009545	Bacteria	2963
261	Ga0105237_10147194	3300009545	Bacteria	2350
262	Ga0105237_11137527	3300009545	Unclassified	787
263	Ga0105238_10000024	3300009551	Bacteria	196322
264	Ga0105238_10121367	3300009551	Bacteria	2593
265	Ga0105238_10410208	3300009551	Bacteria	1348
266	Ga0105238_11223949	3300009551	Bacteria	776
267	Ga0105249_11345628	3300009553	Bacteria	786
268	Ga0105239_10090517	3300010375	Bacteria	3375
269	Ga0105239_10351804	3300010375	Bacteria	1663
270	Ga0105239_10369843	3300010375	Bacteria	1620
271	Ga0105239_10608531	3300010375	Bacteria	1247
272	Ga0105239_12648819	3300010375	Unclassified	585
273	Ga0105239_13591354	3300010375	Bacteria	504
274	Ga0105246_10000176	3300011119	Bacteria	31076
275	Ga0105246_11346202	3300011119	Bacteria	664
276	Ga0157373_11000812	3300013100	Unclassified	624
277	Ga0157373_11527537	3300013100	Unclassified	510
278	Ga0157370_10000019	3300013104	Bacteria	167473
279	Ga0157370_10064203	3300013104	Bacteria	3477
280	Ga0157370_10127310	3300013104	Unclassified	2377
281	Ga0157370_10238478	3300013104	Bacteria	1683
282	Ga0157369_10000081	3300013105	Bacteria	132630
283	Ga0157369_10007598	3300013105	Bacteria	12474
284	Ga0157369_10042738	3300013105	Bacteria	4943
285	Ga0157369_10079678	3300013105	Unclassified	3508
286	Ga0157369_10161864	3300013105	Bacteria	2362
287	Ga0157369_10431270	3300013105	Bacteria	1366
288	Ga0157369_10567384	3300013105	Bacteria	1172
289	Ga0157369_11063978	3300013105	Bacteria	827
290	Ga0157369_11203082	3300013105	Unclassified	773
291	Ga0157374_10226023	3300013296	Bacteria	1838
292	Ga0157374_10381406	3300013296	Unclassified	1404
293	Ga0157374_11520686	3300013296	Unclassified	693
294	Ga0157374_12205791	3300013296	Bacteria	578
295	Ga0157378_10003811	3300013297	Bacteria	13345
296	Ga0157378_10052648	3300013297	Unclassified	3622
297	Ga0163162_10001137	3300013306	Bacteria	24772
298	Ga0163162_10041957	3300013306	Bacteria	4578
299	Ga0163162_10490960	3300013306	Bacteria	1359
300	Ga0157372_10000058	3300013307	Bacteria	125647
301	Ga0157372_10002578	3300013307	Bacteria	19630
302	Ga0157372_10050827	3300013307	Bacteria	4611
303	Ga0157372_10262239	3300013307	Bacteria	2007
304	Ga0157372_10716896	3300013307	Bacteria	1164
305	Ga0157372_11272699	3300013307	Bacteria	849
306	Ga0157372_11930839	3300013307	Unclassified	678
307	Ga0157375_10001776	3300013308	Bacteria	18485
308	Ga0163163_10001878	3300014325	Bacteria	17761
309	Ga0163163_11983659	3300014325	Bacteria	642
310	Ga0157377_10535260	3300014745	Bacteria	825
311	Ga0157379_10000362	3300014968	Bacteria	36426
312	Ga0157379_10261921	3300014968	Bacteria	1571
313	Ga0157379_11503293	3300014968	Bacteria	655
314	Ga0157379_12665370	3300014968	Unclassified	501
315	Ga0157376_10000277	3300014969	Bacteria	34809
316	Ga0157376_10075046	3300014969	Bacteria	2884
317	Ga0157376_10158538	3300014969	Bacteria	2049
318	Ga0213872_10012397	3300021361	Bacteria	4011
319	Ga0213875_10291878	3300021388	Unclassified	771
320	Ga0224572_1000614	3300024225	Unclassified	4430
321	Ga0209233_1008409	3300025261	Bacteria	3197
322	Ga0209233_1081766	3300025261	Bacteria	573
323	Ga0207697_10260860	3300025315	Bacteria	767
324	Ga0207697_10327706	3300025315	Bacteria	680
325	Ga0207653_10150562	3300025885	Bacteria	856
326	Ga0207653_10252180	3300025885	Unclassified	677
327	Ga0207692_10420552	3300025898	Unclassified	837
328	Ga0207710_10000747	3300025900	Bacteria	17957
329	Ga0207710_10386432	3300025900	Bacteria	717
330	Ga0207688_10667601	3300025901	Bacteria	657
331	Ga0207647_10357764	3300025904	Bacteria	826
332	Ga0207699_10000003	3300025906	Bacteria	577076
333	Ga0207699_10073448	3300025906	Bacteria	2098
334	Ga0207699_10960852	3300025906	Bacteria	631
335	Ga0207705_10000012	3300025909	Bacteria	472336
336	Ga0207705_10181866	3300025909	Bacteria	1587
337	Ga0207684_11179246	3300025910	Bacteria	635
338	Ga0207654_10000024	3300025911	Bacteria	147501
339	Ga0207654_10000109	3300025911	Bacteria	54718
340	Ga0207654_10745642	3300025911	Bacteria	705
341	Ga0207707_10017566	3300025912	Bacteria	6239
342	Ga0207707_10335072	3300025912	Bacteria	1305
343	Ga0207707_10681756	3300025912	Bacteria	864
344	Ga0207695_10000075	3300025913	Bacteria	308496
345	Ga0207695_10000115	3300025913	Bacteria	240394
346	Ga0207695_10009641	3300025913	Bacteria	11908
347	Ga0207695_10075192	3300025913	Bacteria	3437
348	Ga0207695_10123333	3300025913	Unclassified	2557
349	Ga0207695_10685431	3300025913	Bacteria	905
350	Ga0207695_11384616	3300025913	Bacteria	584
351	Ga0207671_10000032	3300025914	Bacteria	245878
352	Ga0207671_10165736	3300025914	Bacteria	1713
353	Ga0207693_10016111	3300025915	Bacteria	5982
354	Ga0207693_10269956	3300025915	Bacteria	1333
355	Ga0207693_11074290	3300025915	Bacteria	612
356	Ga0207663_10407907	3300025916	Bacteria	1040
357	Ga0207663_10990107	3300025916	Bacteria	674
358	Ga0207663_11259519	3300025916	Unclassified	596
359	Ga0207660_10194731	3300025917	Unclassified	1580
360	Ga0207660_11656489	3300025917	Bacteria	515
361	Ga0207657_11060519	3300025919	Unclassified	620
362	Ga0207649_10083913	3300025920	Bacteria	2069
363	Ga0207652_10386548	3300025921	Unclassified	1263
364	Ga0207646_10024753	3300025922	Bacteria	5495
365	Ga0207646_10102342	3300025922	Bacteria	2568
366	Ga0207646_11749790	3300025922	Unclassified	533
367	Ga0207694_10000024	3300025924	Bacteria	259443
368	Ga0207694_10099270	3300025924	Bacteria	2306
369	Ga0207650_10241789	3300025925	Bacteria	1459
370	Ga0207659_10445795	3300025926	Bacteria	1089
371	Ga0207687_10000172	3300025927	Bacteria	42739
372	Ga0207700_10004926	3300025928	Bacteria	7933
373	Ga0207700_10012181	3300025928	Bacteria	5532
374	Ga0207700_10022743	3300025928	Bacteria	4306
375	Ga0207700_10041973	3300025928	Bacteria	3351
376	Ga0207700_10210325	3300025928	Bacteria	1644
377	Ga0207700_11058535	3300025928	Bacteria	726
378	Ga0207700_11166392	3300025928	Unclassified	688
379	Ga0207664_10063537	3300025929	Unclassified	2951
380	Ga0207664_10152212	3300025929	Bacteria	1966
381	Ga0207664_10190080	3300025929	Unclassified	1767
382	Ga0207664_11498213	3300025929	Bacteria	596
383	Ga0207644_10000798	3300025931	Bacteria	19950
384	Ga0207706_10453734	3300025933	Bacteria	1109
385	Ga0207670_11649518	3300025936	Bacteria	545
386	Ga0207669_10547976	3300025937	Bacteria	933
387	Ga0207704_11800778	3300025938	Bacteria	527
388	Ga0207665_10008597	3300025939	Bacteria	6720
389	Ga0207665_10028402	3300025939	Bacteria	3694
390	Ga0207665_10253751	3300025939	Unclassified	1301
391	Ga0207665_10510845	3300025939	Unclassified	929
392	Ga0207711_10000013	3300025941	Bacteria	514850
393	Ga0207711_10023041	3300025941	Bacteria	5213
394	Ga0207711_10307801	3300025941	Bacteria	1462
395	Ga0207689_10007365	3300025942	Bacteria	9648
396	Ga0207689_11500282	3300025942	Bacteria	563
397	Ga0207661_10000058	3300025944	Bacteria	83169
398	Ga0207661_10415873	3300025944	Unclassified	1221
399	Ga0207661_10659064	3300025944	Bacteria	962
400	Ga0207661_10946190	3300025944	Bacteria	793
401	Ga0207661_12184360	3300025944	Unclassified	500
402	Ga0207679_10506746	3300025945	Unclassified	1078
403	Ga0207679_10899388	3300025945	Bacteria	810
404	Ga0207679_11557498	3300025945	Unclassified	606
405	Ga0207667_10004094	3300025949	Bacteria	17913
406	Ga0207667_10007368	3300025949	Bacteria	13239
407	Ga0207667_10008903	3300025949	Bacteria	11876
408	Ga0207667_10317225	3300025949	Bacteria	1592
409	Ga0207712_10523818	3300025961	Bacteria	1016
410	Ga0207658_10000041	3300025986	Bacteria	138200
411	Ga0207677_10000063	3300026023	Bacteria	89531
412	Ga0207703_10001322	3300026035	Bacteria	22771
413	Ga0207703_11922429	3300026035	Bacteria	568
414	Ga0207703_12242808	3300026035	Bacteria	522
415	Ga0207639_10032912	3300026041	Bacteria	3821
416	Ga0207678_10923055	3300026067	Unclassified	772
417	Ga0207678_11300871	3300026067	Unclassified	643
418	Ga0207708_10232580	3300026075	Bacteria	1480
419	Ga0207702_10000457	3300026078	Bacteria	46125
420	Ga0207702_10118075	3300026078	Bacteria	2370
421	Ga0207702_10162762	3300026078	Bacteria	2039
422	Ga0207702_10342124	3300026078	Bacteria	1429
423	Ga0207702_10941331	3300026078	Bacteria	856
424	Ga0207641_10002855	3300026088	Bacteria	15698
425	Ga0207641_11362862	3300026088	Unclassified	710
426	Ga0207676_10001899	3300026095	Bacteria	15252
427	Ga0207676_10579846	3300026095	Unclassified	1075
428	Ga0207676_10739844	3300026095	Bacteria	956
429	Ga0207674_10001513	3300026116	Bacteria	29993
430	Ga0207674_10093369	3300026116	Bacteria	2997
431	Ga0207674_10763188	3300026116	Bacteria	933
432	Ga0207674_12153119	3300026116	Bacteria	521
433	Ga0207675_101905635	3300026118	Bacteria	613
434	Ga0207683_10024939	3300026121	Bacteria	5155
435	Ga0207698_10000011	3300026142	Bacteria	260352
436	Ga0207698_10143602	3300026142	Bacteria	2060
437	Ga0207698_10272820	3300026142	Unclassified	1560
438	Ga0207698_10706829	3300026142	Bacteria	1003
439	Ga0207698_11014282	3300026142	Bacteria	841
440	Ga0207698_11976058	3300026142	Bacteria	598
441	Ga0209967_1046201	3300027364	Unclassified	666
442	Ga0207428_10077291	3300027907	Bacteria	2606
443	Ga0207428_10505099	3300027907	Unclassified	878
444	Ga0207428_10943302	3300027907	Unclassified	608
445	Ga0207428_11180174	3300027907	Unclassified	533
446	Ga0265357_1025454	3300028023	Bacteria	662
447	Ga0268266_10866034	3300028379	Bacteria	873
448	Ga0268266_11460692	3300028379	Unclassified	659
449	Ga0268265_10100345	3300028380	Bacteria	2336
450	Ga0268265_10570672	3300028380	Bacteria	1077
451	Ga0268265_10604255	3300028380	Unclassified	1049
452	Ga0268265_12077685	3300028380	Bacteria	575
453	Ga0268264_10000362	3300028381	Bacteria	67431
454	Ga0265319_1064908	3300028563	Bacteria	1178
455	Ga0265338_10044654	3300028800	Unclassified	4087
456	Ga0265338_10073287	3300028800	Unclassified	2919
457	Ga0265338_10345051	3300028800	Bacteria	1072
458	Ga0265338_10801587	3300028800	Unclassified	645
459	Ga0265324_10033364	3300029957	Unclassified	1796
460	Ga0265760_10043391	3300031090	Bacteria	1344
461	Ga0265328_10008228	3300031239	Unclassified	4312
462	Ga0265328_10011977	3300031239	Bacteria	3458
463	Ga0265325_10003290	3300031241	Bacteria	10627
464	Ga0265325_10286350	3300031241	Unclassified	738
465	Ga0265329_10044845	3300031242	Unclassified	1414
466	Ga0265340_10099444	3300031247	Unclassified	1353
467	Ga0265339_10000023	3300031249	Bacteria	169980
468	Ga0265339_10000705	3300031249	Bacteria	25899
469	Ga0265339_10137783	3300031249	Bacteria	1244
470	Ga0265327_10101024	3300031251	Unclassified	1392
471	Ga0265316_10007953	3300031344	Bacteria	9917
472	Ga0265316_10011415	3300031344	Bacteria	8015
473	Ga0265313_10022733	3300031595	Bacteria	3394
474	Ga0265314_10003214	3300031711	Bacteria	15986
475	Ga0265314_10228551	3300031711	Unclassified	1081
476	Ga0265314_10365093	3300031711	Bacteria	790
477	Ga0265342_10003460	3300031712	Bacteria	12941
478	Ga0265342_10124578	3300031712	Bacteria	1448
479	Ga0316215_1002253	3300033544	Bacteria	1823
480	Ga0373926_0080877	3300035083	Bacteria	1202
481	Ga0373926_0084437	3300035083	Bacteria	1177
482	Ga0373934_0265332	3300035086	Bacteria	711
483	Ga0373923_0038172	3300035111	Bacteria	1967
484	Ga0373923_0309893	3300035111	Unclassified	748
485	Ga0373945_0014379	3300035116	Bacteria	2651
486	Ga0373954_0701229	3300035118	Unclassified	502
487	Ga0373956_0019049	3300035119	Bacteria	2908
488	Ga0373943_0030962	3300035170	Bacteria	2536
489	Ga0373946_0001649	3300035171	Bacteria	7776
490	Ga0373955_0250077	3300035172	Unclassified	1063
491	Ga0373955_0261171	3300035172	Bacteria	1040
492	Ga0373955_0546410	3300035172	Unclassified	709
493	Ga0373955_0694916	3300035172	Bacteria	624
494	Ga0373924_0004183	3300035410	Bacteria	5026
495	Ga0373931_0154399	3300035691	Unclassified	1341
496	Ga0373935_0159048	3300035692	Bacteria	1538
497	Ga0373933_0086632	3300035724	Bacteria	1928
498	Ga0373933_0937014	3300035724	Bacteria	570
499	Ga0373933_0958729	3300035724	Unclassified	563
500	Ga0373947_0006082	3300035725	Bacteria	7032
501	Ga0373937_0000801	3300036401	Bacteria	26884
502	Ga0373937_0045276	3300036401	Bacteria	4021
503	Ga0373937_0922069	3300036401	Bacteria	822
504	Ga0373937_0930005	3300036401	Unclassified	818
505	Ga0373937_2173656	3300036401	Unclassified	501
506	Ga0373925_0074243	3300037068	Unclassified	2576
507	Ga0373925_1066976	3300037068	Unclassified	665
508	Ga0436364_0415526	3300037853	Unclassified	578
509	Ga0436364_1469377	3300037853	Unclassified	747
510	Ga0436361_1181999	3300039447	Unclassified	4759
511	Ga0436363_0146512	3300039450	Bacteria	1170
512	Ga0436362_0762973	3300039453	Unclassified	539
513	Ga0439441_160458	3300042001	Bacteria	533
514	Ga0439443_084868	3300042003	Unclassified	592
515	Ga0439460_0213616	3300042461	Bacteria	660
516	Ga0466969_0219986	3300044656	Bacteria	864
517	Ga0453683_0257966	3300044673	Unclassified	1112
518	Ga0466961_0054923	3300044693	Bacteria	2540
519	Ga0451576_0009576	3300045051	Bacteria	11217
520	Ga0451576_0212402	3300045051	Unclassified	2021
521	Ga0466967_0202629	3300045976	Bacteria	1880
522	Ga0495603_0004682	3300046455	Bacteria	8171
523	Ga0495629_0076675	3300046459	Bacteria	2334
524	Ga0495638_0006636	3300046460	Bacteria	8402
525	Ga0495651_0042401	3300046462	Bacteria	3533
526	Ga0495651_0203408	3300046462	Bacteria	1384
527	Ga0495580_0052565	3300046472	Bacteria	2877
528	Ga0495580_0201845	3300046472	Bacteria	1370
529	Ga0495580_0202306	3300046472	Bacteria	1368
530	Ga0495605_0068523	3300046474	Bacteria	1681
531	Ga0495639_0691943	3300046475	Unclassified	526
532	Ga0495585_0042268	3300046492	Bacteria	2554
533	Ga0495594_0000999	3300046499	Bacteria	14708
534	Ga0495594_0224963	3300046499	Bacteria	1070
535	Ga0495596_0058798	3300046500	Bacteria	1499
536	Ga0495607_0329589	3300046501	Bacteria	710
537	Ga0495583_0029233	3300046506	Bacteria	2699
538	Ga0495608_0003327	3300046511	Bacteria	11498
539	Ga0495618_0825236	3300046514	Bacteria	539
540	Ga0495628_0015747	3300046516	Bacteria	6311
541	Ga0495630_0033158	3300046517	Bacteria	3851
542	Ga0495631_0028518	3300046518	Bacteria	2546
543	Ga0495644_0000066	3300046523	Bacteria	51723
544	Ga0495652_0081289	3300046529	Bacteria	2673
545	Ga0495665_0282636	3300046531	Bacteria	851
546	Ga0495640_0124633	3300046533	Bacteria	1671
547	Ga0495640_0901961	3300046533	Bacteria	524
548	Ga0495609_0016284	3300046538	Bacteria	3464
549	Ga0495645_0085698	3300046543	Bacteria	2255
550	Ga0495645_0813394	3300046543	Bacteria	560
551	Ga0495633_0015530	3300046558	Bacteria	3948
552	Ga0495667_0013728	3300046559	Bacteria	5473
553	Ga0495668_0424285	3300046616	Bacteria	731
554	Ga0495599_0506317	3300046678	Bacteria	710
555	Ga0495623_0556404	3300046679	Bacteria	600
556	Ga0495647_0136227	3300046681	Bacteria	1044
557	Ga0495658_0023140	3300046683	Bacteria	3296
558	Ga0495658_0216387	3300046683	Bacteria	1198
559	Ga0495613_0000720	3300046689	Bacteria	25918
560	Ga0495600_0322235	3300046809	Unclassified	972
561	Ga0495581_0125113	3300047315	Bacteria	1497
562	Ga0495604_0025106	3300047317	Bacteria	4750
563	Ga0495604_0272313	3300047317	Bacteria	1147
564	Ga0495674_0259354	3300047319	Bacteria	1428
565	Ga0495674_1300259	3300047319	Unclassified	546
566	Ga0495680_0285067	3300047322	Bacteria	1163
567	Ga0495683_0100260	3300047323	Bacteria	1393
568	Ga0495685_060984	3300047447	Bacteria	1271
569	Ga0495684_0000613	3300047471	Bacteria	28669
570	Ga0495602_0948870	3300048088	Unclassified	570
571	Ga0496100_0888385	3300048903	Unclassified	700
572	Ga0496101_0896758	3300048904	Bacteria	698
573	Ga0496102_0008419	3300048905	Bacteria	8839
574	Ga0496102_0995027	3300048905	Bacteria	759
575	Ga0496102_1938945	3300048905	Unclassified	506
576	Ga0496103_0044705	3300048906	Bacteria	2730
577	Ga0496103_0050567	3300048906	Unclassified	2571
578	Ga0496104_0213219	3300048907	Bacteria	1842
579	Ga0496104_0577516	3300048907	Bacteria	1035
580	Ga0496104_0850346	3300048907	Bacteria	818
581	Ga0496104_1425793	3300048907	Bacteria	596
582	Ga0496105_0073745	3300048908	Unclassified	2819
583	Ga0496105_0548387	3300048908	Bacteria	902
584	Ga0496106_0060804	3300048909	Bacteria	2864
585	Ga0496106_0214289	3300048909	Unclassified	1535
586	Ga0496107_1152976	3300048910	Unclassified	558
587	Ga0496107_1315860	3300048910	Bacteria	517
588	Ga0496108_1057189	3300048911	Unclassified	691
589	Ga0496109_0027047	3300048912	Bacteria	5119
590	Ga0496110_0246760	3300048913	Bacteria	1625
591	Ga0496110_0546812	3300048913	Unclassified	1052
592	Ga0496111_0006876	3300048914	Bacteria	7421
593	Ga0496112_0077059	3300048915	Unclassified	3297
594	Ga0496113_0058473	3300048916	Bacteria	2901
595	Ga0496115_0330223	3300048918	Bacteria	1246
596	Ga0496115_0445246	3300048918	Bacteria	1047
597	Ga0496115_1376481	3300048918	Bacteria	522
598	Ga0496126_0324401	3300048929	Bacteria	1265
599	Ga0501038_0916610	3300049574	Unclassified	646
600	Ga0501073_1196665	3300049589	Bacteria	522
601	Ga0501074_0819152	3300049590	Bacteria	656
602	Ga0501081_1161788	3300049743	Bacteria	585
603	nmdc:mga0k408_789297_c1	3300050493	Bacteria	554
604	nmdc:mga05p37_1056071_c1	3300050507	Bacteria	856
605	nmdc:mga05p37_1410083_c1	3300050507	Unclassified	701
606	nmdc:mga05p37_1590067_c1	3300050507	Bacteria	645
607	nmdc:mga05p37_17824_c1	3300050507	Bacteria	8572
608	nmdc:mga05p37_2115932_c1	3300050507	Bacteria	527
609	nmdc:mga05p37_215623_c1	3300050507	Unclassified	2319
610	nmdc:mga05p37_335842_c1	3300050507	Bacteria	1783
611	nmdc:mga05p37_378_c3	3300050507	Bacteria	34503
612	nmdc:mga05p37_466291_c1	3300050507	Bacteria	1458
613	nmdc:mga05p37_478875_c1	3300050507	Bacteria	1434
614	nmdc:mga05p37_6003_c1	3300050507	Bacteria	14296
615	nmdc:mga05p37_667808_c1	3300050507	Bacteria	1161
616	nmdc:mga09592_10319_c1	3300050508	Bacteria	7600
617	nmdc:mga09592_1182939_c1	3300050508	Unclassified	633
618	nmdc:mga09592_48272_c1	3300050508	Bacteria	3589
619	nmdc:mga09592_620866_c1	3300050508	Bacteria	925
620	nmdc:mga09592_705466_c1	3300050508	Bacteria	858
621	nmdc:mga0qj67_28245_c1	3300050509	Bacteria	4353
622	nmdc:mga0qj67_62731_c1	3300050509	Unclassified	2954
623	nmdc:mga06r32_13840_c1	3300050510	Bacteria	7320
624	nmdc:mga06r32_1775722_c1	3300050510	Bacteria	553
625	nmdc:mga06r32_2051255_c1	3300050510	Unclassified	505
626	nmdc:mga06r32_2797_c1	3300050510	Bacteria	15626
627	nmdc:mga06r32_32726_c1	3300050510	Bacteria	4895
628	nmdc:mga08y16_168572_c1	3300050511	Bacteria	2275
629	nmdc:mga08y16_268360_c1	3300050511	Bacteria	1762
630	nmdc:mga08y16_647672_c1	3300050511	Bacteria	1061
631	nmdc:mga08y16_95767_c1	3300050511	Bacteria	3092
632	nmdc:mga0n895_110380_c1	3300050512	Bacteria	2766
633	nmdc:mga0n895_1296007_c1	3300050512	Unclassified	699
634	nmdc:mga0n895_147376_c1	3300050512	Unclassified	2383
635	nmdc:mga0n895_2040597_c1	3300050512	Bacteria	531
636	nmdc:mga0n895_2142086_c1	3300050512	Unclassified	515
637	nmdc:mga0n895_219058_c1	3300050512	Bacteria	1933
638	nmdc:mga0n895_30211_c1	3300050512	Bacteria	5175
639	nmdc:mga0rr50_1183261_c1	3300050513	Bacteria	650
640	nmdc:mga0rr50_1781450_c1	3300050513	Unclassified	518
641	nmdc:mga0rr50_469217_c1	3300050513	Bacteria	1068
642	nmdc:mga0rr50_760907_c1	3300050513	Unclassified	827
643	nmdc:mga0rr50_95434_c1	3300050513	Bacteria	2325
644	nmdc:mga0rr50_977399_c1	3300050513	Bacteria	721
645	nmdc:mga08x19_4660_c1	3300050514	Bacteria	8135
646	nmdc:mga08x19_749101_c1	3300050514	Unclassified	694
647	nmdc:mga0a205_227057_c1	3300050515	Bacteria	1752
648	nmdc:mga0a205_74155_c1	3300050515	Bacteria	3288
649	nmdc:mga0a205_895293_c1	3300050515	Unclassified	734
650	Ga0495601_0047983	3300053077	Bacteria	2689
651	Ga0495601_0198159	3300053077	Bacteria	1312
652	Ga0495601_0607650	3300053077	Unclassified	701
653	Ga0495601_0861130	3300053077	Unclassified	574
654	Ga0495619_0001524	3300053085	Bacteria	15266
655	Ga0495619_0075598	3300053085	Bacteria	2260
656	Ga0590071_001455	3300059421	Bacteria	6243
657	Ga0590074_019018	3300059423	Bacteria	1176
658	Ga0590075_000184	3300059424	Bacteria	17420
659	Ga0590077_001492	3300059426	Bacteria	5437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009098	Ga0105245_12576461	Ga0105245_125764612	92
2	3300005356	Ga0070674_100466168	Ga0070674_1004661682	102
3	3300009094	Ga0111539_10043610	Ga0111539_100436104	102
4	3300009147	Ga0114129_10071724	Ga0114129_100717246	102
5	3300009147	Ga0114129_10591545	Ga0114129_105915452	102
6	3300042003	Ga0439443_084868	Ga0439443_084868_250_561	102
7	3300048905	Ga0496102_0995027	Ga0496102_0995027_405_716	102
8	3300050508	nmdc:mga09592_48272_c1	nmdc:mga09592_48272_c1_138_449	102
9	3300050509	nmdc:mga0qj67_28245_c1	nmdc:mga0qj67_28245_c1_2330_2641	102
10	3300050510	nmdc:mga06r32_2797_c1	nmdc:mga06r32_2797_c1_9844_10155	102
11	3300050511	nmdc:mga08y16_168572_c1	nmdc:mga08y16_168572_c1_1066_1377	102
12	3300005356	Ga0070674_101572155	Ga0070674_1015721552	107
13	3300005434	Ga0070709_10087715	Ga0070709_100877152	107
14	3300005434	Ga0070709_11209736	Ga0070709_112097362	107
15	3300005436	Ga0070713_100043854	Ga0070713_1000438542	107
16	3300005456	Ga0070678_100289996	Ga0070678_1002899962	107
17	3300005456	Ga0070678_101356886	Ga0070678_1013568861	107
18	3300005459	Ga0068867_101287504	Ga0068867_1012875041	107
19	3300005468	Ga0070707_100625507	Ga0070707_1006255072	107
20	3300005518	Ga0070699_100112923	Ga0070699_1001129232	107
21	3300005518	Ga0070699_100140051	Ga0070699_1001400511	107
22	3300005536	Ga0070697_101056921	Ga0070697_1010569212	107
23	3300005536	Ga0070697_101434893	Ga0070697_1014348931	107
24	3300005543	Ga0070672_101129617	Ga0070672_1011296171	107
25	3300005543	Ga0070672_101172373	Ga0070672_1011723732	107
26	3300005549	Ga0070704_100587634	Ga0070704_1005876342	107
27	3300005618	Ga0068864_101050300	Ga0068864_1010503001	107
28	3300005844	Ga0068862_101273329	Ga0068862_1012733292	107
29	3300005983	Ga0081540_1031110	Ga0081540_10311102	107
30	3300005985	Ga0081539_10013543	Ga0081539_100135435	107
31	3300006173	Ga0070716_100494039	Ga0070716_1004940391	107
32	3300006237	Ga0097621_100691122	Ga0097621_1006911222	107
33	3300006844	Ga0075428_100012052	Ga0075428_1000120525	107
34	3300006844	Ga0075428_100273212	Ga0075428_1002732124	107
35	3300006846	Ga0075430_100034932	Ga0075430_1000349324	107
36	3300006846	Ga0075430_100054864	Ga0075430_1000548641	107
37	3300006846	Ga0075430_100381177	Ga0075430_1003811772	107
38	3300006847	Ga0075431_100004810	Ga0075431_1000048102	107
39	3300006847	Ga0075431_100063265	Ga0075431_1000632653	107
40	3300006852	Ga0075433_10694670	Ga0075433_106946702	107
41	3300006880	Ga0075429_100008270	Ga0075429_1000082706	107
42	3300006880	Ga0075429_100399435	Ga0075429_1003994351	107
43	3300006914	Ga0075436_100001602	Ga0075436_10000160218	107
44	3300006914	Ga0075436_100008801	Ga0075436_1000088013	107
45	3300007076	Ga0075435_101060796	Ga0075435_1010607962	107
46	3300009147	Ga0114129_10025086	Ga0114129_100250865	107
47	3300009147	Ga0114129_10670466	Ga0114129_106704662	107
48	3300009174	Ga0105241_10507990	Ga0105241_105079902	107
49	3300009177	Ga0105248_10734771	Ga0105248_107347712	107
50	3300011119	Ga0105246_11346202	Ga0105246_113462022	107
51	3300013105	Ga0157369_11203082	Ga0157369_112030821	107
52	3300013296	Ga0157374_12205791	Ga0157374_122057911	107
53	3300014325	Ga0163163_11983659	Ga0163163_119836592	107
54	3300014969	Ga0157376_10158538	Ga0157376_101585382	107
55	3300025906	Ga0207699_10073448	Ga0207699_100734482	107
56	3300025911	Ga0207654_10745642	Ga0207654_107456421	107
57	3300025926	Ga0207659_10445795	Ga0207659_104457951	107
58	3300025928	Ga0207700_10012181	Ga0207700_100121815	107
59	3300025938	Ga0207704_11800778	Ga0207704_118007781	107
60	3300025939	Ga0207665_10028402	Ga0207665_100284023	107
61	3300025939	Ga0207665_10253751	Ga0207665_102537512	107
62	3300025944	Ga0207661_10415873	Ga0207661_104158732	107
63	3300026121	Ga0207683_10024939	Ga0207683_100249393	107
64	3300027907	Ga0207428_10077291	Ga0207428_100772911	107
65	3300035691	Ga0373931_0154399	Ga0373931_0154399_832_1161	107
66	3300039450	Ga0436363_0146512	Ga0436363_0146512_736_1065	107
67	3300042001	Ga0439441_160458	Ga0439441_160458_82_411	107
68	3300050507	nmdc:mga05p37_1056071_c1	nmdc:mga05p37_1056071_c1_21_350	107
69	3300050507	nmdc:mga05p37_17824_c1	nmdc:mga05p37_17824_c1_756_1088	107
70	3300050508	nmdc:mga09592_1182939_c1	nmdc:mga09592_1182939_c1_231_563	107
71	3300050509	nmdc:mga0qj67_62731_c1	nmdc:mga0qj67_62731_c1_13_345	107
72	3300050510	nmdc:mga06r32_32726_c1	nmdc:mga06r32_32726_c1_3280_3612	107
73	3300050512	nmdc:mga0n895_2040597_c1	nmdc:mga0n895_2040597_c1_14_343	107
74	3300050512	nmdc:mga0n895_2142086_c1	nmdc:mga0n895_2142086_c1_165_494	107
75	3300050513	nmdc:mga0rr50_1781450_c1	nmdc:mga0rr50_1781450_c1_112_447	107
76	3300050513	nmdc:mga0rr50_469217_c1	nmdc:mga0rr50_469217_c1_198_533	107
77	3300050513	nmdc:mga0rr50_977399_c1	nmdc:mga0rr50_977399_c1_316_645	107
78	3300050514	nmdc:mga08x19_749101_c1	nmdc:mga08x19_749101_c1_17_346	107
79	3300005841	Ga0068863_101068173	Ga0068863_1010681731	108
80	3300005842	Ga0068858_101304782	Ga0068858_1013047821	108
81	3300006051	Ga0075364_10198059	Ga0075364_101980592	108
82	3300006844	Ga0075428_100207060	Ga0075428_1002070602	108
83	3300006846	Ga0075430_100906681	Ga0075430_1009066812	108
84	3300006847	Ga0075431_100308427	Ga0075431_1003084273	108
85	3300009553	Ga0105249_11345628	Ga0105249_113456281	108
86	3300026035	Ga0207703_11922429	Ga0207703_119224292	108
87	3300026088	Ga0207641_11362862	Ga0207641_113628622	108
88	3300005290	Ga0065712_10137762	Ga0065712_101377622	109
89	3300005331	Ga0070670_101271617	Ga0070670_1012716171	109
90	3300005338	Ga0068868_102282052	Ga0068868_1022820521	109
91	3300005353	Ga0070669_101474860	Ga0070669_1014748601	109
92	3300005365	Ga0070688_100109077	Ga0070688_1001090773	109
93	3300005365	Ga0070688_100580674	Ga0070688_1005806742	109
94	3300005440	Ga0070705_100310609	Ga0070705_1003106091	109
95	3300005445	Ga0070708_100321282	Ga0070708_1003212822	109
96	3300005466	Ga0070685_10866142	Ga0070685_108661422	109
97	3300005617	Ga0068859_101405511	Ga0068859_1014055112	109
98	3300005844	Ga0068862_100977320	Ga0068862_1009773202	109
99	3300005937	Ga0081455_10063446	Ga0081455_100634463	109
100	3300006058	Ga0075432_10518505	Ga0075432_105185051	109
101	3300006844	Ga0075428_100519145	Ga0075428_1005191452	109
102	3300006844	Ga0075428_100717357	Ga0075428_1007173572	109
103	3300006844	Ga0075428_100806123	Ga0075428_1008061231	109
104	3300006844	Ga0075428_101234150	Ga0075428_1012341501	109
105	3300006846	Ga0075430_100538397	Ga0075430_1005383972	109
106	3300006846	Ga0075430_100713186	Ga0075430_1007131861	109
107	3300006847	Ga0075431_100076676	Ga0075431_1000766763	109
108	3300006847	Ga0075431_100672043	Ga0075431_1006720432	109
109	3300006871	Ga0075434_100242862	Ga0075434_1002428622	109
110	3300006880	Ga0075429_100674660	Ga0075429_1006746602	109
111	3300006880	Ga0075429_100745433	Ga0075429_1007454332	109
112	3300006914	Ga0075436_100041703	Ga0075436_1000417032	109
113	3300006914	Ga0075436_100180210	Ga0075436_1001802102	109
114	3300006931	Ga0097620_101405739	Ga0097620_1014057392	109
115	3300007076	Ga0075435_100141765	Ga0075435_1001417652	109
116	3300007076	Ga0075435_100887779	Ga0075435_1008877792	109
117	3300009094	Ga0111539_10359743	Ga0111539_103597432	109
118	3300009094	Ga0111539_10975408	Ga0111539_109754082	109
119	3300009094	Ga0111539_12508988	Ga0111539_125089881	109
120	3300009147	Ga0114129_10003283	Ga0114129_1000328311	109
121	3300009147	Ga0114129_10080682	Ga0114129_100806822	109
122	3300009147	Ga0114129_10228976	Ga0114129_102289762	109
123	3300009147	Ga0114129_10228976	Ga0114129_102289764	109
124	3300009147	Ga0114129_10278119	Ga0114129_102781192	109
125	3300009147	Ga0114129_10862998	Ga0114129_108629981	109
126	3300009147	Ga0114129_11910124	Ga0114129_119101241	109
127	3300009147	Ga0114129_13286362	Ga0114129_132863621	109
128	3300025315	Ga0207697_10260860	Ga0207697_102608602	109
129	3300025315	Ga0207697_10327706	Ga0207697_103277062	109
130	3300025901	Ga0207688_10667601	Ga0207688_106676011	109
131	3300025917	Ga0207660_11656489	Ga0207660_116564892	109
132	3300025936	Ga0207670_11649518	Ga0207670_116495181	109
133	3300026095	Ga0207676_10579846	Ga0207676_105798461	109
134	3300026116	Ga0207674_12153119	Ga0207674_121531192	109
135	3300026118	Ga0207675_101905635	Ga0207675_1019056351	109
136	3300027907	Ga0207428_10505099	Ga0207428_105050992	109
137	3300027907	Ga0207428_10943302	Ga0207428_109433021	109
138	3300027907	Ga0207428_11180174	Ga0207428_111801742	109
139	3300028380	Ga0268265_10604255	Ga0268265_106042552	109
140	3300035083	Ga0373926_0080877	Ga0373926_0080877_398_733	109
141	3300035111	Ga0373923_0038172	Ga0373923_0038172_289_624	109
142	3300035116	Ga0373945_0014379	Ga0373945_0014379_10_345	109
143	3300035170	Ga0373943_0030962	Ga0373943_0030962_667_1002	109
144	3300035171	Ga0373946_0001649	Ga0373946_0001649_599_934	109
145	3300035410	Ga0373924_0004183	Ga0373924_0004183_1310_1645	109
146	3300035692	Ga0373935_0159048	Ga0373935_0159048_1032_1367	109
147	3300035725	Ga0373947_0006082	Ga0373947_0006082_2816_3151	109
148	3300036401	Ga0373937_0922069	Ga0373937_0922069_58_393	109
149	3300036401	Ga0373937_2173656	Ga0373937_2173656_66_401	109
150	3300037068	Ga0373925_0074243	Ga0373925_0074243_66_401	109
151	3300037068	Ga0373925_1066976	Ga0373925_1066976_44_379	109
152	3300042461	Ga0439460_0213616	Ga0439460_0213616_285_620	109
153	3300045976	Ga0466967_0202629	Ga0466967_0202629_1111_1446	109
154	3300046683	Ga0495658_0023140	Ga0495658_0023140_660_995	109
155	3300046809	Ga0495600_0322235	Ga0495600_0322235_78_413	109
156	3300049590	Ga0501074_0819152	Ga0501074_0819152_163_498	109
157	3300049743	Ga0501081_1161788	Ga0501081_1161788_15_350	109
158	3300050507	nmdc:mga05p37_1410083_c1	nmdc:mga05p37_1410083_c1_206_541	109
159	3300050507	nmdc:mga05p37_2115932_c1	nmdc:mga05p37_2115932_c1_104_439	109
160	3300050507	nmdc:mga05p37_335842_c1	nmdc:mga05p37_335842_c1_729_1064	109
161	3300050507	nmdc:mga05p37_378_c3	nmdc:mga05p37_378_c3_13029_13364	109
162	3300050507	nmdc:mga05p37_466291_c1	nmdc:mga05p37_466291_c1_398_733	109
163	3300050507	nmdc:mga05p37_478875_c1	nmdc:mga05p37_478875_c1_226_561	109
164	3300050507	nmdc:mga05p37_667808_c1	nmdc:mga05p37_667808_c1_661_996	109
165	3300050508	nmdc:mga09592_620866_c1	nmdc:mga09592_620866_c1_416_751	109
166	3300050508	nmdc:mga09592_705466_c1	nmdc:mga09592_705466_c1_58_393	109
167	3300050510	nmdc:mga06r32_13840_c1	nmdc:mga06r32_13840_c1_1155_1490	109
168	3300050510	nmdc:mga06r32_1775722_c1	nmdc:mga06r32_1775722_c1_170_505	109
169	3300050510	nmdc:mga06r32_2051255_c1	nmdc:mga06r32_2051255_c1_114_449	109
170	3300050511	nmdc:mga08y16_268360_c1	nmdc:mga08y16_268360_c1_1243_1578	109
171	3300050511	nmdc:mga08y16_647672_c1	nmdc:mga08y16_647672_c1_567_902	109
172	3300050512	nmdc:mga0n895_110380_c1	nmdc:mga0n895_110380_c1_802_1137	109
173	3300050512	nmdc:mga0n895_30211_c1	nmdc:mga0n895_30211_c1_4280_4648	109
174	3300050513	nmdc:mga0rr50_1183261_c1	nmdc:mga0rr50_1183261_c1_54_389	109
175	3300050513	nmdc:mga0rr50_760907_c1	nmdc:mga0rr50_760907_c1_409_744	109
176	3300050514	nmdc:mga08x19_4660_c1	nmdc:mga08x19_4660_c1_2555_2890	109
177	3300050515	nmdc:mga0a205_74155_c1	nmdc:mga0a205_74155_c1_868_1236	109
178	3300050515	nmdc:mga0a205_895293_c1	nmdc:mga0a205_895293_c1_366_701	109
179	3300053085	Ga0495619_0075598	Ga0495619_0075598_1323_1658	109
180	3300005293	Ga0065715_10182714	Ga0065715_101827142	110
181	3300005344	Ga0070661_100080887	Ga0070661_1000808873	110
182	3300005344	Ga0070661_101182145	Ga0070661_1011821452	110
183	3300005356	Ga0070674_101197158	Ga0070674_1011971582	110
184	3300005365	Ga0070688_101085523	Ga0070688_1010855232	110
185	3300005406	Ga0070703_10222437	Ga0070703_102224372	110
186	3300005444	Ga0070694_100001588	Ga0070694_1000015883	110
187	3300005444	Ga0070694_100353279	Ga0070694_1003532792	110
188	3300005444	Ga0070694_100506720	Ga0070694_1005067202	110
189	3300005444	Ga0070694_101153931	Ga0070694_1011539312	110
190	3300005445	Ga0070708_101068170	Ga0070708_1010681701	110
191	3300005445	Ga0070708_101256750	Ga0070708_1012567502	110
192	3300005455	Ga0070663_100866538	Ga0070663_1008665381	110
193	3300005457	Ga0070662_100326551	Ga0070662_1003265512	110
194	3300005457	Ga0070662_100372311	Ga0070662_1003723112	110
195	3300005467	Ga0070706_101611584	Ga0070706_1016115841	110
196	3300005467	Ga0070706_101615861	Ga0070706_1016158611	110
197	3300005468	Ga0070707_100024002	Ga0070707_1000240022	110
198	3300005536	Ga0070697_101109892	Ga0070697_1011098921	110
199	3300005545	Ga0070695_100000737	Ga0070695_1000007373	110
200	3300005546	Ga0070696_100021909	Ga0070696_1000219092	110
201	3300005549	Ga0070704_100113751	Ga0070704_1001137512	110
202	3300005549	Ga0070704_100982158	Ga0070704_1009821582	110
203	3300005564	Ga0070664_100956394	Ga0070664_1009563942	110
204	3300006163	Ga0070715_10354133	Ga0070715_103541332	110
205	3300006237	Ga0097621_100105612	Ga0097621_1001056122	110
206	3300006844	Ga0075428_100028815	Ga0075428_1000288152	110
207	3300006846	Ga0075430_100022880	Ga0075430_1000228802	110
208	3300006847	Ga0075431_100468313	Ga0075431_1004683131	110
209	3300006852	Ga0075433_10108944	Ga0075433_101089441	110
210	3300006852	Ga0075433_10489228	Ga0075433_104892282	110
211	3300006871	Ga0075434_100186121	Ga0075434_1001861213	110
212	3300006880	Ga0075429_100002884	Ga0075429_1000028843	110
213	3300007076	Ga0075435_100080460	Ga0075435_1000804603	110
214	3300007265	Ga0099794_10248044	Ga0099794_102480441	110
215	3300009093	Ga0105240_10024772	Ga0105240_100247723	110
216	3300009147	Ga0114129_10002900	Ga0114129_1000290020	110
217	3300009147	Ga0114129_10334519	Ga0114129_103345192	110
218	3300009147	Ga0114129_11174495	Ga0114129_111744952	110
219	3300009545	Ga0105237_10095436	Ga0105237_100954362	110
220	3300009545	Ga0105237_10147194	Ga0105237_101471941	110
221	3300010375	Ga0105239_10351804	Ga0105239_103518042	110
222	3300010375	Ga0105239_13591354	Ga0105239_135913541	110
223	3300013104	Ga0157370_10238478	Ga0157370_102384782	110
224	3300013306	Ga0163162_10001137	Ga0163162_100011374	110
225	3300014968	Ga0157379_11503293	Ga0157379_115032932	110
226	3300014969	Ga0157376_10075046	Ga0157376_100750463	110
227	3300025261	Ga0209233_1008409	Ga0209233_10084092	110
228	3300025261	Ga0209233_1081766	Ga0209233_10817661	110
229	3300025885	Ga0207653_10150562	Ga0207653_101505621	110
230	3300025904	Ga0207647_10357764	Ga0207647_103577642	110
231	3300025910	Ga0207684_11179246	Ga0207684_111792462	110
232	3300025919	Ga0207657_11060519	Ga0207657_110605192	110
233	3300025922	Ga0207646_10024753	Ga0207646_100247532	110
234	3300025922	Ga0207646_10102342	Ga0207646_101023422	110
235	3300025928	Ga0207700_11166392	Ga0207700_111663921	110
236	3300025933	Ga0207706_10453734	Ga0207706_104537342	110
237	3300025937	Ga0207669_10547976	Ga0207669_105479762	110
238	3300025941	Ga0207711_10307801	Ga0207711_103078012	110
239	3300025945	Ga0207679_10899388	Ga0207679_108993882	110
240	3300026075	Ga0207708_10232580	Ga0207708_102325802	110
241	3300026095	Ga0207676_10739844	Ga0207676_107398442	110
242	3300026116	Ga0207674_10763188	Ga0207674_107631882	110
243	3300035086	Ga0373934_0265332	Ga0373934_0265332_342_680	110
244	3300035172	Ga0373955_0261171	Ga0373955_0261171_383_721	110
245	3300045051	Ga0451576_0212402	Ga0451576_0212402_77_412	110
246	3300046455	Ga0495603_0004682	Ga0495603_0004682_6198_6539	110
247	3300046459	Ga0495629_0076675	Ga0495629_0076675_447_785	110
248	3300046462	Ga0495651_0203408	Ga0495651_0203408_653_994	110
249	3300046472	Ga0495580_0052565	Ga0495580_0052565_1989_2330	110
250	3300046472	Ga0495580_0202306	Ga0495580_0202306_462_800	110
251	3300046474	Ga0495605_0068523	Ga0495605_0068523_1327_1668	110
252	3300046492	Ga0495585_0042268	Ga0495585_0042268_186_527	110
253	3300046499	Ga0495594_0000999	Ga0495594_0000999_10957_11298	110
254	3300046500	Ga0495596_0058798	Ga0495596_0058798_211_552	110
255	3300046501	Ga0495607_0329589	Ga0495607_0329589_119_460	110
256	3300046506	Ga0495583_0029233	Ga0495583_0029233_2021_2362	110
257	3300046511	Ga0495608_0003327	Ga0495608_0003327_5776_6114	110
258	3300046514	Ga0495618_0825236	Ga0495618_0825236_12_350	110
259	3300046516	Ga0495628_0015747	Ga0495628_0015747_1649_1987	110
260	3300046517	Ga0495630_0033158	Ga0495630_0033158_760_1098	110
261	3300046518	Ga0495631_0028518	Ga0495631_0028518_1274_1615	110
262	3300046523	Ga0495644_0000066	Ga0495644_0000066_42887_43228	110
263	3300046529	Ga0495652_0081289	Ga0495652_0081289_1010_1351	110
264	3300046533	Ga0495640_0124633	Ga0495640_0124633_1010_1351	110
265	3300046533	Ga0495640_0901961	Ga0495640_0901961_60_398	110
266	3300046538	Ga0495609_0016284	Ga0495609_0016284_2424_2765	110
267	3300046543	Ga0495645_0085698	Ga0495645_0085698_344_682	110
268	3300046558	Ga0495633_0015530	Ga0495633_0015530_437_778	110
269	3300046559	Ga0495667_0013728	Ga0495667_0013728_2777_3115	110
270	3300046616	Ga0495668_0424285	Ga0495668_0424285_256_597	110
271	3300046678	Ga0495599_0506317	Ga0495599_0506317_344_682	110
272	3300046679	Ga0495623_0556404	Ga0495623_0556404_26_367	110
273	3300046681	Ga0495647_0136227	Ga0495647_0136227_686_1024	110
274	3300046683	Ga0495658_0216387	Ga0495658_0216387_583_921	110
275	3300046689	Ga0495613_0000720	Ga0495613_0000720_4985_5323	110
276	3300047317	Ga0495604_0025106	Ga0495604_0025106_3054_3392	110
277	3300047317	Ga0495604_0272313	Ga0495604_0272313_351_692	110
278	3300047319	Ga0495674_0259354	Ga0495674_0259354_916_1257	110
279	3300047323	Ga0495683_0100260	Ga0495683_0100260_59_400	110
280	3300047447	Ga0495685_060984	Ga0495685_060984_226_567	110
281	3300047471	Ga0495684_0000613	Ga0495684_0000613_13346_13684	110
282	3300048905	Ga0496102_0008419	Ga0496102_0008419_3894_4238	110
283	3300048906	Ga0496103_0050567	Ga0496103_0050567_1195_1539	110
284	3300048907	Ga0496104_0213219	Ga0496104_0213219_1136_1477	110
285	3300048907	Ga0496104_0850346	Ga0496104_0850346_335_679	110
286	3300048908	Ga0496105_0548387	Ga0496105_0548387_467_808	110
287	3300048909	Ga0496106_0060804	Ga0496106_0060804_201_545	110
288	3300048910	Ga0496107_1152976	Ga0496107_1152976_20_364	110
289	3300048911	Ga0496108_1057189	Ga0496108_1057189_333_677	110
290	3300048912	Ga0496109_0027047	Ga0496109_0027047_2200_2544	110
291	3300048913	Ga0496110_0246760	Ga0496110_0246760_497_841	110
292	3300048915	Ga0496112_0077059	Ga0496112_0077059_1085_1429	110
293	3300048916	Ga0496113_0058473	Ga0496113_0058473_253_597	110
294	3300048918	Ga0496115_0330223	Ga0496115_0330223_441_782	110
295	3300049589	Ga0501073_1196665	Ga0501073_1196665_156_494	110
296	3300050507	nmdc:mga05p37_1590067_c1	nmdc:mga05p37_1590067_c1_65_511	110
297	3300050507	nmdc:mga05p37_215623_c1	nmdc:mga05p37_215623_c1_329_667	110
298	3300050507	nmdc:mga05p37_6003_c1	nmdc:mga05p37_6003_c1_5392_5727	110
299	3300050508	nmdc:mga09592_10319_c1	nmdc:mga09592_10319_c1_1309_1647	110
300	3300050511	nmdc:mga08y16_95767_c1	nmdc:mga08y16_95767_c1_509_955	110
301	3300050512	nmdc:mga0n895_1296007_c1	nmdc:mga0n895_1296007_c1_232_567	110
302	3300050512	nmdc:mga0n895_147376_c1	nmdc:mga0n895_147376_c1_1907_2242	110
303	3300050512	nmdc:mga0n895_219058_c1	nmdc:mga0n895_219058_c1_75_410	110
304	3300050513	nmdc:mga0rr50_95434_c1	nmdc:mga0rr50_95434_c1_1540_1875	110
305	3300050515	nmdc:mga0a205_227057_c1	nmdc:mga0a205_227057_c1_331_666	110
306	3300053077	Ga0495601_0047983	Ga0495601_0047983_1880_2218	110
307	3300053077	Ga0495601_0607650	Ga0495601_0607650_112_450	110
308	3300053077	Ga0495601_0861130	Ga0495601_0861130_107_451	110
309	3300053085	Ga0495619_0001524	Ga0495619_0001524_6834_7172	110
310	3300059421	Ga0590071_001455	Ga0590071_001455_4091_4429	110
311	3300059423	Ga0590074_019018	Ga0590074_019018_42_380	110
312	3300059424	Ga0590075_000184	Ga0590075_000184_7672_8010	110
313	3300059426	Ga0590077_001492	Ga0590077_001492_1347_1685	110
314	3300005329	Ga0070683_100061390	Ga0070683_1000613904	111
315	3300005336	Ga0070680_100107309	Ga0070680_1001073094	111
316	3300005336	Ga0070680_100623154	Ga0070680_1006231541	111
317	3300005364	Ga0070673_101551954	Ga0070673_1015519542	111
318	3300005366	Ga0070659_101939099	Ga0070659_1019390991	111
319	3300005434	Ga0070709_10000006	Ga0070709_1000000661	111
320	3300005435	Ga0070714_100056805	Ga0070714_1000568052	111
321	3300005435	Ga0070714_100521792	Ga0070714_1005217922	111
322	3300005436	Ga0070713_100115186	Ga0070713_1001151862	111
323	3300005436	Ga0070713_101264080	Ga0070713_1012640801	111
324	3300005437	Ga0070710_10073995	Ga0070710_100739951	111
325	3300005437	Ga0070710_10180016	Ga0070710_101800162	111
326	3300005439	Ga0070711_100165530	Ga0070711_1001655302	111
327	3300005441	Ga0070700_101650481	Ga0070700_1016504811	111
328	3300005445	Ga0070708_100105035	Ga0070708_1001050352	111
329	3300005458	Ga0070681_10134772	Ga0070681_101347722	111
330	3300005458	Ga0070681_11596790	Ga0070681_115967901	111
331	3300005468	Ga0070707_100523368	Ga0070707_1005233681	111
332	3300005471	Ga0070698_100032002	Ga0070698_1000320022	111
333	3300005471	Ga0070698_101653037	Ga0070698_1016530371	111
334	3300005530	Ga0070679_101292211	Ga0070679_1012922111	111
335	3300005535	Ga0070684_100396225	Ga0070684_1003962252	111
336	3300005545	Ga0070695_101050295	Ga0070695_1010502951	111
337	3300005547	Ga0070693_100032242	Ga0070693_1000322422	111
338	3300005547	Ga0070693_100466874	Ga0070693_1004668741	111
339	3300005549	Ga0070704_100290292	Ga0070704_1002902921	111
340	3300005549	Ga0070704_101453804	Ga0070704_1014538041	111
341	3300005563	Ga0068855_100716557	Ga0068855_1007165571	111
342	3300005614	Ga0068856_100081017	Ga0068856_1000810172	111
343	3300005616	Ga0068852_101414988	Ga0068852_1014149881	111
344	3300005617	Ga0068859_100355820	Ga0068859_1003558202	111
345	3300005617	Ga0068859_100387045	Ga0068859_1003870452	111
346	3300005834	Ga0068851_10184539	Ga0068851_101845391	111
347	3300005843	Ga0068860_102508280	Ga0068860_1025082801	111
348	3300005844	Ga0068862_100538493	Ga0068862_1005384932	111
349	3300006028	Ga0070717_10224163	Ga0070717_102241632	111
350	3300006028	Ga0070717_10621259	Ga0070717_106212591	111
351	3300006028	Ga0070717_10776969	Ga0070717_107769691	111
352	3300006051	Ga0075364_10888016	Ga0075364_108880161	111
353	3300006163	Ga0070715_10031835	Ga0070715_100318351	111
354	3300006173	Ga0070716_100036593	Ga0070716_1000365932	111
355	3300006175	Ga0070712_100077713	Ga0070712_1000777132	111
356	3300006175	Ga0070712_100571780	Ga0070712_1005717801	111
357	3300006175	Ga0070712_101911946	Ga0070712_1019119461	111
358	3300006195	Ga0075366_10633390	Ga0075366_106333901	111
359	3300006195	Ga0075366_10891630	Ga0075366_108916301	111
360	3300006852	Ga0075433_10319727	Ga0075433_103197272	111
361	3300006871	Ga0075434_100514676	Ga0075434_1005146761	111
362	3300006880	Ga0075429_100670918	Ga0075429_1006709181	111
363	3300006931	Ga0097620_100355784	Ga0097620_1003557842	111
364	3300006931	Ga0097620_100387051	Ga0097620_1003870512	111
365	3300007076	Ga0075435_100903831	Ga0075435_1009038311	111
366	3300009093	Ga0105240_10359967	Ga0105240_103599671	111
367	3300009093	Ga0105240_10882699	Ga0105240_108826992	111
368	3300009093	Ga0105240_11530169	Ga0105240_115301691	111
369	3300009098	Ga0105245_11141813	Ga0105245_111418131	111
370	3300009098	Ga0105245_12932776	Ga0105245_129327761	111
371	3300009101	Ga0105247_10182966	Ga0105247_101829662	111
372	3300009174	Ga0105241_11239178	Ga0105241_112391781	111
373	3300009174	Ga0105241_11703784	Ga0105241_117037841	111
374	3300009177	Ga0105248_10184280	Ga0105248_101842802	111
375	3300009551	Ga0105238_10410208	Ga0105238_104102082	111
376	3300009551	Ga0105238_11223949	Ga0105238_112239491	111
377	3300010375	Ga0105239_10608531	Ga0105239_106085312	111
378	3300013105	Ga0157369_10079678	Ga0157369_100796784	111
379	3300013296	Ga0157374_10381406	Ga0157374_103814061	111
380	3300013297	Ga0157378_10052648	Ga0157378_100526482	111
381	3300013307	Ga0157372_11930839	Ga0157372_119308391	111
382	3300014968	Ga0157379_12665370	Ga0157379_126653701	111
383	3300025885	Ga0207653_10252180	Ga0207653_102521802	111
384	3300025898	Ga0207692_10420552	Ga0207692_104205522	111
385	3300025900	Ga0207710_10386432	Ga0207710_103864321	111
386	3300025906	Ga0207699_10000003	Ga0207699_10000003191	111
387	3300025906	Ga0207699_10960852	Ga0207699_109608522	111
388	3300025912	Ga0207707_10017566	Ga0207707_100175667	111
389	3300025912	Ga0207707_10335072	Ga0207707_103350721	111
390	3300025912	Ga0207707_10681756	Ga0207707_106817562	111
391	3300025913	Ga0207695_11384616	Ga0207695_113846161	111
392	3300025914	Ga0207671_10165736	Ga0207671_101657362	111
393	3300025915	Ga0207693_10016111	Ga0207693_100161114	111
394	3300025915	Ga0207693_10269956	Ga0207693_102699561	111
395	3300025915	Ga0207693_11074290	Ga0207693_110742901	111
396	3300025916	Ga0207663_10990107	Ga0207663_109901072	111
397	3300025916	Ga0207663_11259519	Ga0207663_112595192	111
398	3300025917	Ga0207660_10194731	Ga0207660_101947311	111
399	3300025922	Ga0207646_11749790	Ga0207646_117497902	111
400	3300025928	Ga0207700_10004926	Ga0207700_100049261	111
401	3300025928	Ga0207700_10022743	Ga0207700_100227434	111
402	3300025929	Ga0207664_10152212	Ga0207664_101522122	111
403	3300025929	Ga0207664_10190080	Ga0207664_101900801	111
404	3300025929	Ga0207664_11498213	Ga0207664_114982131	111
405	3300025939	Ga0207665_10008597	Ga0207665_100085973	111
406	3300025939	Ga0207665_10510845	Ga0207665_105108451	111
407	3300025942	Ga0207689_11500282	Ga0207689_115002822	111
408	3300025944	Ga0207661_10946190	Ga0207661_109461901	111
409	3300025944	Ga0207661_12184360	Ga0207661_121843601	111
410	3300025949	Ga0207667_10007368	Ga0207667_100073685	111
411	3300025961	Ga0207712_10523818	Ga0207712_105238181	111
412	3300026078	Ga0207702_10941331	Ga0207702_109413312	111
413	3300026142	Ga0207698_10272820	Ga0207698_102728203	111
414	3300026142	Ga0207698_11014282	Ga0207698_110142821	111
415	3300026142	Ga0207698_11976058	Ga0207698_119760581	111
416	3300027364	Ga0209967_1046201	Ga0209967_10462012	111
417	3300028380	Ga0268265_10570672	Ga0268265_105706722	111
418	3300028380	Ga0268265_12077685	Ga0268265_120776851	111
419	3300031090	Ga0265760_10043391	Ga0265760_100433912	111
420	3300031241	Ga0265325_10003290	Ga0265325_100032902	111
421	3300031595	Ga0265313_10022733	Ga0265313_100227332	111
422	3300031711	Ga0265314_10228551	Ga0265314_102285512	111
423	3300031712	Ga0265342_10124578	Ga0265342_101245782	111
424	3300035083	Ga0373926_0084437	Ga0373926_0084437_160_501	111
425	3300035111	Ga0373923_0309893	Ga0373923_0309893_156_497	111
426	3300035119	Ga0373956_0019049	Ga0373956_0019049_2043_2384	111
427	3300035172	Ga0373955_0250077	Ga0373955_0250077_195_587	111
428	3300035172	Ga0373955_0546410	Ga0373955_0546410_184_525	111
429	3300035172	Ga0373955_0694916	Ga0373955_0694916_184_555	111
430	3300035724	Ga0373933_0086632	Ga0373933_0086632_741_1082	111
431	3300035724	Ga0373933_0937014	Ga0373933_0937014_63_404	111
432	3300036401	Ga0373937_0000801	Ga0373937_0000801_4555_4896	111
433	3300036401	Ga0373937_0045276	Ga0373937_0045276_2279_2620	111
434	3300036401	Ga0373937_0930005	Ga0373937_0930005_115_507	111
435	3300039453	Ga0436362_0762973	Ga0436362_0762973_24_359	111
436	3300044673	Ga0453683_0257966	Ga0453683_0257966_703_1074	111
437	3300045051	Ga0451576_0009576	Ga0451576_0009576_3602_3949	111
438	3300046460	Ga0495638_0006636	Ga0495638_0006636_3461_3826	111
439	3300046462	Ga0495651_0042401	Ga0495651_0042401_3025_3366	111
440	3300046472	Ga0495580_0201845	Ga0495580_0201845_528_869	111
441	3300046475	Ga0495639_0691943	Ga0495639_0691943_167_508	111
442	3300046499	Ga0495594_0224963	Ga0495594_0224963_416_757	111
443	3300046531	Ga0495665_0282636	Ga0495665_0282636_14_355	111
444	3300046543	Ga0495645_0813394	Ga0495645_0813394_200_541	111
445	3300047315	Ga0495581_0125113	Ga0495581_0125113_300_641	111
446	3300047322	Ga0495680_0285067	Ga0495680_0285067_138_479	111
447	3300048088	Ga0495602_0948870	Ga0495602_0948870_57_392	111
448	3300048905	Ga0496102_1938945	Ga0496102_1938945_32_373	111
449	3300048907	Ga0496104_0577516	Ga0496104_0577516_679_1014	111
450	3300048907	Ga0496104_1425793	Ga0496104_1425793_148_489	111
451	3300048908	Ga0496105_0073745	Ga0496105_0073745_2085_2426	111
452	3300048910	Ga0496107_1315860	Ga0496107_1315860_143_484	111
453	3300048913	Ga0496110_0546812	Ga0496110_0546812_76_468	111
454	3300048914	Ga0496111_0006876	Ga0496111_0006876_6406_6798	111
455	3300048918	Ga0496115_1376481	Ga0496115_1376481_100_441	111
456	3300050493	nmdc:mga0k408_789297_c1	nmdc:mga0k408_789297_c1_63_428	111
457	3300053077	Ga0495601_0198159	Ga0495601_0198159_832_1173	111
458	3300000546	LJNas_1001492	LJNas_10014923	112
459	3300001991	JGI24743J22301_10011702	JGI24743J22301_100117022	112
460	3300003320	rootH2_10227083	rootH2_102270832	112
461	3300005327	Ga0070658_10233116	Ga0070658_102331162	112
462	3300005327	Ga0070658_10777637	Ga0070658_107776372	112
463	3300005327	Ga0070658_11228370	Ga0070658_112283701	112
464	3300005329	Ga0070683_100000055	Ga0070683_10000005554	112
465	3300005329	Ga0070683_100246013	Ga0070683_1002460132	112
466	3300005331	Ga0070670_100288296	Ga0070670_1002882962	112
467	3300005334	Ga0068869_100003494	Ga0068869_1000034945	112
468	3300005335	Ga0070666_10655293	Ga0070666_106552932	112
469	3300005338	Ga0068868_100000946	Ga0068868_1000009469	112
470	3300005344	Ga0070661_100415512	Ga0070661_1004155122	112
471	3300005355	Ga0070671_100000919	Ga0070671_1000009195	112
472	3300005367	Ga0070667_100000566	Ga0070667_1000005663	112
473	3300005436	Ga0070713_100006929	Ga0070713_1000069293	112
474	3300005436	Ga0070713_100482201	Ga0070713_1004822011	112
475	3300005436	Ga0070713_100639900	Ga0070713_1006399002	112
476	3300005439	Ga0070711_100283349	Ga0070711_1002833493	112
477	3300005440	Ga0070705_101407563	Ga0070705_1014075631	112
478	3300005444	Ga0070694_101247842	Ga0070694_1012478421	112
479	3300005455	Ga0070663_100271156	Ga0070663_1002711561	112
480	3300005455	Ga0070663_100473050	Ga0070663_1004730502	112
481	3300005468	Ga0070707_101746453	Ga0070707_1017464531	112
482	3300005530	Ga0070679_100257799	Ga0070679_1002577992	112
483	3300005535	Ga0070684_100000153	Ga0070684_10000015340	112
484	3300005535	Ga0070684_100028387	Ga0070684_1000283875	112
485	3300005535	Ga0070684_100064778	Ga0070684_1000647782	112
486	3300005539	Ga0068853_100098783	Ga0068853_1000987832	112
487	3300005548	Ga0070665_100398819	Ga0070665_1003988191	112
488	3300005548	Ga0070665_100514723	Ga0070665_1005147232	112
489	3300005563	Ga0068855_100000842	Ga0068855_10000084226	112
490	3300005563	Ga0068855_100003222	Ga0068855_10000322220	112
491	3300005564	Ga0070664_100681258	Ga0070664_1006812582	112
492	3300005577	Ga0068857_100000243	Ga0068857_10000024315	112
493	3300005578	Ga0068854_100072374	Ga0068854_1000723741	112
494	3300005614	Ga0068856_100001360	Ga0068856_10000136011	112
495	3300005614	Ga0068856_100001480	Ga0068856_1000014807	112
496	3300005614	Ga0068856_100358376	Ga0068856_1003583762	112
497	3300005614	Ga0068856_101724443	Ga0068856_1017244431	112
498	3300005616	Ga0068852_100000054	Ga0068852_10000005433	112
499	3300005616	Ga0068852_100022712	Ga0068852_1000227122	112
500	3300005617	Ga0068859_100004590	Ga0068859_1000045904	112
501	3300005618	Ga0068864_100000397	Ga0068864_1000003972	112
502	3300005834	Ga0068851_10894393	Ga0068851_108943932	112
503	3300005841	Ga0068863_100000681	Ga0068863_1000006815	112
504	3300005842	Ga0068858_100001479	Ga0068858_1000014795	112
505	3300005843	Ga0068860_100000031	Ga0068860_100000031192	112
506	3300005844	Ga0068862_100103664	Ga0068862_1001036641	112
507	3300005983	Ga0081540_1078498	Ga0081540_10784982	112
508	3300006028	Ga0070717_10043832	Ga0070717_100438323	112
509	3300006028	Ga0070717_10745776	Ga0070717_107457761	112
510	3300006028	Ga0070717_10910458	Ga0070717_109104582	112
511	3300006028	Ga0070717_10935682	Ga0070717_109356821	112
512	3300006175	Ga0070712_101082732	Ga0070712_1010827321	112
513	3300006237	Ga0097621_100000168	Ga0097621_1000001685	112
514	3300006358	Ga0068871_100067233	Ga0068871_1000672333	112
515	3300006931	Ga0097620_100004589	Ga0097620_10000458910	112
516	3300009093	Ga0105240_10000116	Ga0105240_1000011638	112
517	3300009093	Ga0105240_10000171	Ga0105240_1000017176	112
518	3300009093	Ga0105240_10002467	Ga0105240_1000246714	112
519	3300009093	Ga0105240_10006077	Ga0105240_1000607710	112
520	3300009093	Ga0105240_10040545	Ga0105240_100405456	112
521	3300009093	Ga0105240_10506516	Ga0105240_105065162	112
522	3300009093	Ga0105240_11458781	Ga0105240_114587811	112
523	3300009098	Ga0105245_10000297	Ga0105245_1000029716	112
524	3300009101	Ga0105247_10001010	Ga0105247_100010105	112
525	3300009174	Ga0105241_10000061	Ga0105241_1000006156	112
526	3300009174	Ga0105241_10000380	Ga0105241_1000038022	112
527	3300009174	Ga0105241_10359721	Ga0105241_103597212	112
528	3300009545	Ga0105237_10001729	Ga0105237_100017293	112
529	3300009545	Ga0105237_11137527	Ga0105237_111375272	112
530	3300009551	Ga0105238_10000024	Ga0105238_10000024118	112
531	3300009551	Ga0105238_10121367	Ga0105238_101213672	112
532	3300010375	Ga0105239_10090517	Ga0105239_100905173	112
533	3300010375	Ga0105239_10369843	Ga0105239_103698432	112
534	3300010375	Ga0105239_12648819	Ga0105239_126488191	112
535	3300011119	Ga0105246_10000176	Ga0105246_100001763	112
536	3300013100	Ga0157373_11000812	Ga0157373_110008122	112
537	3300013100	Ga0157373_11527537	Ga0157373_115275371	112
538	3300013104	Ga0157370_10000019	Ga0157370_1000001969	112
539	3300013104	Ga0157370_10064203	Ga0157370_100642033	112
540	3300013104	Ga0157370_10127310	Ga0157370_101273102	112
541	3300013105	Ga0157369_10000081	Ga0157369_1000008138	112
542	3300013105	Ga0157369_10007598	Ga0157369_1000759812	112
543	3300013105	Ga0157369_10042738	Ga0157369_100427385	112
544	3300013105	Ga0157369_10161864	Ga0157369_101618642	112
545	3300013105	Ga0157369_10431270	Ga0157369_104312702	112
546	3300013105	Ga0157369_10567384	Ga0157369_105673842	112
547	3300013105	Ga0157369_11063978	Ga0157369_110639781	112
548	3300013296	Ga0157374_10226023	Ga0157374_102260232	112
549	3300013296	Ga0157374_11520686	Ga0157374_115206862	112
550	3300013297	Ga0157378_10003811	Ga0157378_100038113	112
551	3300013306	Ga0163162_10041957	Ga0163162_100419573	112
552	3300013306	Ga0163162_10490960	Ga0163162_104909602	112
553	3300013307	Ga0157372_10000058	Ga0157372_1000005870	112
554	3300013307	Ga0157372_10002578	Ga0157372_100025789	112
555	3300013307	Ga0157372_10050827	Ga0157372_100508271	112
556	3300013307	Ga0157372_10262239	Ga0157372_102622392	112
557	3300013307	Ga0157372_10716896	Ga0157372_107168962	112
558	3300013307	Ga0157372_11272699	Ga0157372_112726992	112
559	3300013308	Ga0157375_10001776	Ga0157375_1000177613	112
560	3300014325	Ga0163163_10001878	Ga0163163_100018782	112
561	3300014745	Ga0157377_10535260	Ga0157377_105352602	112
562	3300014968	Ga0157379_10000362	Ga0157379_100003626	112
563	3300014968	Ga0157379_10261921	Ga0157379_102619212	112
564	3300014969	Ga0157376_10000277	Ga0157376_100002772	112
565	3300021361	Ga0213872_10012397	Ga0213872_100123972	112
566	3300021388	Ga0213875_10291878	Ga0213875_102918781	112
567	3300024225	Ga0224572_1000614	Ga0224572_10006143	112
568	3300025900	Ga0207710_10000747	Ga0207710_100007473	112
569	3300025909	Ga0207705_10000012	Ga0207705_10000012296	112
570	3300025909	Ga0207705_10181866	Ga0207705_101818662	112
571	3300025911	Ga0207654_10000024	Ga0207654_100000249	112
572	3300025911	Ga0207654_10000109	Ga0207654_1000010928	112
573	3300025913	Ga0207695_10000075	Ga0207695_1000007566	112
574	3300025913	Ga0207695_10000115	Ga0207695_10000115132	112
575	3300025913	Ga0207695_10009641	Ga0207695_100096412	112
576	3300025913	Ga0207695_10075192	Ga0207695_100751922	112
577	3300025913	Ga0207695_10123333	Ga0207695_101233332	112
578	3300025913	Ga0207695_10685431	Ga0207695_106854312	112
579	3300025914	Ga0207671_10000032	Ga0207671_10000032143	112
580	3300025916	Ga0207663_10407907	Ga0207663_104079072	112
581	3300025920	Ga0207649_10083913	Ga0207649_100839132	112
582	3300025921	Ga0207652_10386548	Ga0207652_103865482	112
583	3300025924	Ga0207694_10000024	Ga0207694_10000024174	112
584	3300025924	Ga0207694_10099270	Ga0207694_100992702	112
585	3300025925	Ga0207650_10241789	Ga0207650_102417892	112
586	3300025927	Ga0207687_10000172	Ga0207687_1000017217	112
587	3300025928	Ga0207700_10041973	Ga0207700_100419732	112
588	3300025928	Ga0207700_10210325	Ga0207700_102103252	112
589	3300025928	Ga0207700_11058535	Ga0207700_110585352	112
590	3300025929	Ga0207664_10063537	Ga0207664_100635371	112
591	3300025931	Ga0207644_10000798	Ga0207644_1000079812	112
592	3300025941	Ga0207711_10000013	Ga0207711_1000001356	112
593	3300025941	Ga0207711_10023041	Ga0207711_100230413	112
594	3300025942	Ga0207689_10007365	Ga0207689_100073655	112
595	3300025944	Ga0207661_10000058	Ga0207661_1000005838	112
596	3300025944	Ga0207661_10659064	Ga0207661_106590642	112
597	3300025945	Ga0207679_10506746	Ga0207679_105067462	112
598	3300025945	Ga0207679_11557498	Ga0207679_115574982	112
599	3300025949	Ga0207667_10004094	Ga0207667_100040942	112
600	3300025949	Ga0207667_10008903	Ga0207667_100089036	112
601	3300025949	Ga0207667_10317225	Ga0207667_103172252	112
602	3300025986	Ga0207658_10000041	Ga0207658_1000004162	112
603	3300026023	Ga0207677_10000063	Ga0207677_1000006350	112
604	3300026035	Ga0207703_10001322	Ga0207703_100013224	112
605	3300026035	Ga0207703_12242808	Ga0207703_122428082	112
606	3300026041	Ga0207639_10032912	Ga0207639_100329123	112
607	3300026067	Ga0207678_10923055	Ga0207678_109230552	112
608	3300026067	Ga0207678_11300871	Ga0207678_113008711	112
609	3300026078	Ga0207702_10000457	Ga0207702_1000045736	112
610	3300026078	Ga0207702_10118075	Ga0207702_101180752	112
611	3300026078	Ga0207702_10162762	Ga0207702_101627622	112
612	3300026078	Ga0207702_10342124	Ga0207702_103421242	112
613	3300026088	Ga0207641_10002855	Ga0207641_1000285510	112
614	3300026095	Ga0207676_10001899	Ga0207676_1000189912	112
615	3300026116	Ga0207674_10001513	Ga0207674_100015136	112
616	3300026116	Ga0207674_10093369	Ga0207674_100933692	112
617	3300026142	Ga0207698_10000011	Ga0207698_10000011142	112
618	3300026142	Ga0207698_10143602	Ga0207698_101436022	112
619	3300026142	Ga0207698_10706829	Ga0207698_107068292	112
620	3300028023	Ga0265357_1025454	Ga0265357_10254542	112
621	3300028379	Ga0268266_10866034	Ga0268266_108660341	112
622	3300028379	Ga0268266_11460692	Ga0268266_114606921	112
623	3300028380	Ga0268265_10100345	Ga0268265_101003453	112
624	3300028381	Ga0268264_10000362	Ga0268264_1000036238	112
625	3300028563	Ga0265319_1064908	Ga0265319_10649082	112
626	3300028800	Ga0265338_10044654	Ga0265338_100446542	112
627	3300028800	Ga0265338_10073287	Ga0265338_100732872	112
628	3300028800	Ga0265338_10345051	Ga0265338_103450512	112
629	3300028800	Ga0265338_10801587	Ga0265338_108015872	112
630	3300029957	Ga0265324_10033364	Ga0265324_100333642	112
631	3300031239	Ga0265328_10008228	Ga0265328_100082282	112
632	3300031239	Ga0265328_10011977	Ga0265328_100119772	112
633	3300031241	Ga0265325_10286350	Ga0265325_102863502	112
634	3300031242	Ga0265329_10044845	Ga0265329_100448452	112
635	3300031247	Ga0265340_10099444	Ga0265340_100994442	112
636	3300031249	Ga0265339_10000023	Ga0265339_1000002387	112
637	3300031249	Ga0265339_10000705	Ga0265339_1000070512	112
638	3300031249	Ga0265339_10137783	Ga0265339_101377831	112
639	3300031251	Ga0265327_10101024	Ga0265327_101010241	112
640	3300031344	Ga0265316_10007953	Ga0265316_100079539	112
641	3300031344	Ga0265316_10011415	Ga0265316_100114151	112
642	3300031711	Ga0265314_10003214	Ga0265314_1000321412	112
643	3300031711	Ga0265314_10365093	Ga0265314_103650932	112
644	3300031712	Ga0265342_10003460	Ga0265342_100034603	112
645	3300033544	Ga0316215_1002253	Ga0316215_10022532	112
646	3300035118	Ga0373954_0701229	Ga0373954_0701229_99_437	112
647	3300035724	Ga0373933_0958729	Ga0373933_0958729_152_490	112
648	3300037853	Ga0436364_0415526	Ga0436364_0415526_179_517	112
649	3300037853	Ga0436364_1469377	Ga0436364_1469377_399_737	112
650	3300039447	Ga0436361_1181999	Ga0436361_1181999_3013_3351	112
651	3300044656	Ga0466969_0219986	Ga0466969_0219986_241_579	112
652	3300044693	Ga0466961_0054923	Ga0466961_0054923_461_799	112
653	3300047319	Ga0495674_1300259	Ga0495674_1300259_106_444	112
654	3300048903	Ga0496100_0888385	Ga0496100_0888385_62_400	112
655	3300048904	Ga0496101_0896758	Ga0496101_0896758_13_351	112
656	3300048906	Ga0496103_0044705	Ga0496103_0044705_1030_1374	112
657	3300048909	Ga0496106_0214289	Ga0496106_0214289_62_400	112
658	3300048918	Ga0496115_0445246	Ga0496115_0445246_363_701	112
659	3300048929	Ga0496126_0324401	Ga0496126_0324401_552_890	112
660	3300049574	Ga0501038_0916610	Ga0501038_0916610_278_616	112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

27

101

0.98 PF13463

HTH_27

Winged helix DNA-binding domain

21

95

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6abq-assembly1.cif.gz_A	crystal structure of transcription factor from listeria monocytogenes	0.9415	9	107
1xma-assembly1.cif.gz_A	structure of a transcriptional regulator from clostridium thermocellum cth-833	0.9369	10	106
1xma-assembly1.cif.gz_B-2	structure of a transcriptional regulator from clostridium thermocellum cth-833	0.9368	10	106
3hhh-assembly1.cif.gz_B	crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583	0.9305	13	107
3hhh-assembly1.cif.gz_A	crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583	0.9044	9	109

ID	Description	Score	Start	End	Superfamily
1xmaA00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9369	10	106	1.10.10.10
af_I6X7F9_1_101_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9242	10	101	1.10.10.10
af_Q2FUS4_1_110_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9157	10	109	1.10.10.10
3l7wA00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.8888	6	109	1.10.10.10
af_P71704_1_89_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.8776	13	92	1.10.10.10

ID	Description	Score	Start	End
AF-A0A2Z5G063-F1-model_v4	Transcriptional regulator, PadR family	0.9974	4	110
AF-A0A2V8EA09-F1-model_v4	PadR family transcriptional regulator	0.9966	10	89
AF-W0RR40-F1-model_v4	Transcriptional regulator, PadR-family	0.9943	10	108
AF-A0A3N5LS61-F1-model_v4	PadR family transcriptional regulator	0.9913	10	111
AF-A0A537T4U9-F1-model_v4	PadR family transcriptional regulator	0.9853	4	110

Feature Viewer

pLDDT	pTM	Quality
90.78	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F473310

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03551

PadR

Transcriptional regulator PadR-like family

27

101

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

21

95

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map