F473288

General Info

Members Datasets Scaffolds Average Seq Length
659 268 1318 175

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_766583_c1|nmdc:mga0rr50_766583_c1_76_741
Length 203
Sequence LYPILRPAILICQLPLIAAADAGPHIILAMSILKIARMGHPVLRAKARALHPSEIRTPKIQQLIDDLFETMKEYQGVGLAAPQVHEGLRIFVAGFPDEIPLMTLINPEIEMTSRDVVEDWEGCLSIPDIRGRVPRARHIVVRAFDRNGRKIEMPASGFTARVIQHETDHLDGILFFDRMKSFQSLTFLDEFGRYWSGHNVRAE

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
238 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
244 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 3.03
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 9.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_766583_c1 3300050513 Bacteria 823
2 JGI24751J29686_10003566 3300002459 Bacteria 3136
3 Ga0065714_10181147 3300005288 Bacteria 962
4 Ga0065704_10132262 3300005289 Bacteria 1614
5 Ga0065712_10088343 3300005290 Bacteria 2526
6 Ga0065712_10125347 3300005290 Bacteria 1615
7 Ga0065712_10193579 3300005290 Bacteria 1137
8 Ga0065712_10412446 3300005290 Bacteria 719
9 Ga0065715_10009987 3300005293 Bacteria 3486
10 Ga0065715_10013966 3300005293 Bacteria 2434
11 Ga0065715_10039109 3300005293 Unclassified 1252
12 Ga0065715_10089959 3300005293 Bacteria 8014
13 Ga0065715_10094271 3300005293 Bacteria 4389
14 Ga0065707_10014580 3300005295 Bacteria 2643
15 Ga0065707_10070975 3300005295 Bacteria 750
16 Ga0065707_10187748 3300005295 Bacteria 1379
17 Ga0065707_10252139 3300005295 Bacteria 1122
18 Ga0070658_10184829 3300005327 Bacteria 1755
19 Ga0070676_10030837 3300005328 Bacteria 3060
20 Ga0070676_10040833 3300005328 Bacteria 2688
21 Ga0070683_100025701 3300005329 Bacteria 5293
22 Ga0070683_100375206 3300005329 Bacteria 1355
23 Ga0070683_101132134 3300005329 Bacteria 752
24 Ga0070690_100090500 3300005330 Bacteria 2015
25 Ga0070690_100521510 3300005330 Bacteria 892
26 Ga0070670_100003306 3300005331 Bacteria 13341
27 Ga0070670_100024771 3300005331 Bacteria 5161
28 Ga0070670_100070097 3300005331 Bacteria 3010
29 Ga0070670_100085970 3300005331 Bacteria 2702
30 Ga0070670_100424454 3300005331 Bacteria 1176
31 Ga0070677_10054334 3300005333 Bacteria 1631
32 Ga0068869_100003855 3300005334 Bacteria 9254
33 Ga0068869_100058299 3300005334 Bacteria 2823
34 Ga0068869_100074845 3300005334 Bacteria 2514
35 Ga0070666_10090105 3300005335 Bacteria 2106
36 Ga0070666_10099554 3300005335 Unclassified 2002
37 Ga0070666_10101538 3300005335 Unclassified 1983
38 Ga0070666_10738800 3300005335 Bacteria 723
39 Ga0070680_100068599 3300005336 Bacteria 2911
40 Ga0070680_100825325 3300005336 Bacteria 799
41 Ga0070682_100109865 3300005337 Bacteria 1836
42 Ga0068868_100076821 3300005338 Bacteria 2670
43 Ga0068868_100326788 3300005338 Bacteria 1308
44 Ga0068868_101199519 3300005338 Bacteria 702
45 Ga0070660_101409364 3300005339 Bacteria 592
46 Ga0070689_100041912 3300005340 Bacteria 3514
47 Ga0070687_100129601 3300005343 Bacteria 1455
48 Ga0070661_100066917 3300005344 Bacteria 2640
49 Ga0070661_100656222 3300005344 Bacteria 852
50 Ga0070692_10825117 3300005345 Bacteria 635
51 Ga0070668_100156650 3300005347 Bacteria 1845
52 Ga0070668_100422948 3300005347 Bacteria 1141
53 Ga0070669_100001561 3300005353 Bacteria 16592
54 Ga0070669_100036111 3300005353 Bacteria 3580
55 Ga0070669_100082570 3300005353 Bacteria 2395
56 Ga0070669_100116192 3300005353 Bacteria 2036
57 Ga0070669_100229633 3300005353 Bacteria 1470
58 Ga0070675_100045363 3300005354 Bacteria 3597
59 Ga0070675_100078114 3300005354 Bacteria 2756
60 Ga0070675_100079935 3300005354 Bacteria 2725
61 Ga0070675_100101632 3300005354 Bacteria 2422
62 Ga0070675_100175294 3300005354 Bacteria 1851
63 Ga0070675_100340828 3300005354 Bacteria 1328
64 Ga0070675_100641533 3300005354 Bacteria 965
65 Ga0070671_100265811 3300005355 Bacteria 1458
66 Ga0070671_100284418 3300005355 Bacteria 1407
67 Ga0070671_100600383 3300005355 Bacteria 951
68 Ga0070674_100005769 3300005356 Bacteria 7185
69 Ga0070674_100059522 3300005356 Bacteria 2659
70 Ga0070674_100072270 3300005356 Bacteria 2442
71 Ga0070674_100075194 3300005356 Bacteria 2398
72 Ga0070674_100253991 3300005356 Bacteria 1382
73 Ga0070674_101781670 3300005356 Unclassified 558
74 Ga0070673_100092839 3300005364 Unclassified 2470
75 Ga0070673_100133039 3300005364 Bacteria 2090
76 Ga0070673_100347528 3300005364 Bacteria 1316
77 Ga0070673_100590747 3300005364 Bacteria 1012
78 Ga0070673_100756684 3300005364 Bacteria 895
79 Ga0070688_100003927 3300005365 Bacteria 7712
80 Ga0070659_100242817 3300005366 Unclassified 1491
81 Ga0070667_100073101 3300005367 Unclassified 2923
82 Ga0070703_10206498 3300005406 Bacteria 774
83 Ga0070701_10041600 3300005438 Bacteria 2343
84 Ga0070701_10148330 3300005438 Bacteria 1348
85 Ga0070700_100012421 3300005441 Bacteria 4753
86 Ga0070700_100060261 3300005441 Bacteria 2392
87 Ga0070700_100086478 3300005441 Bacteria 2036
88 Ga0070700_100130988 3300005441 Bacteria 1692
89 Ga0070694_100103780 3300005444 Bacteria 2015
90 Ga0070678_100017430 3300005456 Bacteria 4625
91 Ga0070678_100040642 3300005456 Bacteria 3291
92 Ga0070678_100049849 3300005456 Bacteria 3024
93 Ga0070678_100105719 3300005456 Bacteria 2192
94 Ga0070678_100204192 3300005456 Bacteria 1633
95 Ga0070678_100209405 3300005456 Bacteria 1614
96 Ga0070678_100403132 3300005456 Bacteria 1189
97 Ga0070678_100867578 3300005456 Bacteria 823
98 Ga0070681_10193812 3300005458 Bacteria 1951
99 Ga0070681_10428445 3300005458 Bacteria 1235
100 Ga0068867_100081987 3300005459 Bacteria 2433
101 Ga0068867_100203944 3300005459 Bacteria 1584
102 Ga0068867_100791145 3300005459 Bacteria 845
103 Ga0070685_10086441 3300005466 Bacteria 1891
104 Ga0070706_101286170 3300005467 Bacteria 671
105 Ga0070707_100058637 3300005468 Bacteria 3692
106 Ga0070699_100195649 3300005518 Bacteria 1797
107 Ga0070699_100281271 3300005518 Bacteria 1490
108 Ga0070679_100052583 3300005530 Bacteria 4056
109 Ga0070679_100066537 3300005530 Bacteria 3592
110 Ga0070684_100452149 3300005535 Bacteria 1187
111 Ga0070684_100569446 3300005535 Bacteria 1052
112 Ga0070684_100859717 3300005535 Bacteria 849
113 Ga0070697_100114530 3300005536 Unclassified 2250
114 Ga0068853_100332071 3300005539 Bacteria 1411
115 Ga0068853_100772762 3300005539 Unclassified 919
116 Ga0070672_100035037 3300005543 Bacteria 3812
117 Ga0070672_100222606 3300005543 Bacteria 1583
118 Ga0070672_100588367 3300005543 Bacteria 968
119 Ga0070672_101102095 3300005543 Bacteria 705
120 Ga0070686_100128563 3300005544 Bacteria 1749
121 Ga0070686_100435446 3300005544 Bacteria 1005
122 Ga0070695_100014083 3300005545 Bacteria 4815
123 Ga0070695_100139806 3300005545 Bacteria 1678
124 Ga0070693_100268950 3300005547 Bacteria 1137
125 Ga0070665_100010405 3300005548 Bacteria 9414
126 Ga0070665_101348126 3300005548 Bacteria 723
127 Ga0070704_100179687 3300005549 Bacteria 1691
128 Ga0070704_100461344 3300005549 Bacteria 1096
129 Ga0068855_100166402 3300005563 Bacteria 2499
130 Ga0070664_100010469 3300005564 Bacteria 7516
131 Ga0070664_100081483 3300005564 Bacteria 2789
132 Ga0070664_100408676 3300005564 Bacteria 1242
133 Ga0068857_100123946 3300005577 Bacteria 2328
134 Ga0068857_100151735 3300005577 Bacteria 2100
135 Ga0068857_100171186 3300005577 Bacteria 1974
136 Ga0068857_101492289 3300005577 Bacteria 659
137 Ga0070702_100209617 3300005615 Bacteria 1296
138 Ga0068859_100012212 3300005617 Bacteria 8634
139 Ga0068859_100017910 3300005617 Bacteria 7120
140 Ga0068859_100127615 3300005617 Bacteria 2614
141 Ga0068859_100424618 3300005617 Bacteria 1426
142 Ga0068859_100701544 3300005617 Bacteria 1103
143 Ga0068859_100949939 3300005617 Bacteria 943
144 Ga0068864_100006553 3300005618 Bacteria 9539
145 Ga0068864_100099430 3300005618 Bacteria 2577
146 Ga0068864_100105483 3300005618 Bacteria 2505
147 Ga0068864_100138356 3300005618 Bacteria 2194
148 Ga0068864_100744351 3300005618 Bacteria 960
149 Ga0068861_100019635 3300005719 Bacteria 4827
150 Ga0068861_100097269 3300005719 Bacteria 2335
151 Ga0068861_100477464 3300005719 Bacteria 1122
152 Ga0068861_101558505 3300005719 Bacteria 650
153 Ga0068851_10243954 3300005834 Unclassified 1017
154 Ga0068870_10040977 3300005840 Bacteria 2404
155 Ga0068870_10239620 3300005840 Bacteria 1119
156 Ga0068863_100037310 3300005841 Bacteria 4627
157 Ga0068863_100044064 3300005841 Bacteria 4235
158 Ga0068863_100900135 3300005841 Bacteria 885
159 Ga0068858_100008122 3300005842 Bacteria 10095
160 Ga0068858_100034125 3300005842 Bacteria 4720
161 Ga0068858_100745980 3300005842 Bacteria 954
162 Ga0068858_101136232 3300005842 Unclassified 767
163 Ga0068858_101180850 3300005842 Bacteria 752
164 Ga0068860_100194313 3300005843 Bacteria 1965
165 Ga0068860_100473910 3300005843 Bacteria 1247
166 Ga0068860_100572493 3300005843 Bacteria 1133
167 Ga0068860_100813344 3300005843 Unclassified 948
168 Ga0068862_100026065 3300005844 Bacteria 4913
169 Ga0068862_100156683 3300005844 Bacteria 2030
170 Ga0068862_101510507 3300005844 Bacteria 677
171 Ga0075368_10372565 3300006042 Bacteria 624
172 Ga0075363_100231047 3300006048 Bacteria 1062
173 Ga0075364_10226845 3300006051 Bacteria 1268
174 Ga0075364_10655384 3300006051 Bacteria 717
175 Ga0075362_10396977 3300006177 Bacteria 695
176 Ga0075367_10017155 3300006178 Bacteria 3969
177 Ga0075367_10194159 3300006178 Bacteria 1267
178 Ga0075366_10066745 3300006195 Bacteria 2140
179 Ga0097621_100000477 3300006237 Bacteria 28162
180 Ga0097621_100022317 3300006237 Bacteria 4912
181 Ga0097621_100099527 3300006237 Bacteria 2444
182 Ga0097621_100201592 3300006237 Bacteria 1728
183 Ga0097621_100214225 3300006237 Bacteria 1676
184 Ga0097621_100586504 3300006237 Bacteria 1018
185 Ga0068871_100012430 3300006358 Bacteria 6275
186 Ga0068871_100015114 3300006358 Bacteria 5771
187 Ga0068871_100032822 3300006358 Bacteria 4105
188 Ga0068871_100057850 3300006358 Unclassified 3156
189 Ga0068871_100706398 3300006358 Bacteria 924
190 Ga0068871_100778959 3300006358 Bacteria 880
191 Ga0068871_101488041 3300006358 Bacteria 639
192 Ga0075428_100000786 3300006844 Bacteria 33072
193 Ga0075428_100008874 3300006844 Bacteria 11153
194 Ga0075428_100020230 3300006844 Bacteria 7371
195 Ga0075428_100020594 3300006844 Bacteria 7304
196 Ga0075428_100257874 3300006844 Bacteria 1878
197 Ga0075428_100514675 3300006844 Bacteria 1280
198 Ga0075430_100003498 3300006846 Bacteria 13148
199 Ga0075430_100008831 3300006846 Bacteria 8504
200 Ga0075430_100116964 3300006846 Unclassified 2222
201 Ga0075431_100001181 3300006847 Bacteria 23559
202 Ga0075433_10087067 3300006852 Bacteria 2759
203 Ga0075433_10098819 3300006852 Bacteria 2584
204 Ga0075434_100010893 3300006871 Bacteria 8550
205 Ga0075434_100103147 3300006871 Bacteria 2860
206 Ga0075434_100121122 3300006871 Bacteria 2632
207 Ga0075429_100000181 3300006880 Bacteria 41066
208 Ga0075429_100037563 3300006880 Archaea 4216
209 Ga0075429_100253241 3300006880 Bacteria 1542
210 Ga0075429_100565789 3300006880 Bacteria 996
211 Ga0068865_100112244 3300006881 Bacteria 2013
212 Ga0068865_100197898 3300006881 Bacteria 1558
213 Ga0068865_100751488 3300006881 Bacteria 838
214 Ga0068865_100753274 3300006881 Unclassified 837
215 Ga0075436_100052564 3300006914 Bacteria 2812
216 Ga0097620_100012212 3300006931 Bacteria 8634
217 Ga0097620_100017910 3300006931 Bacteria 7120
218 Ga0097620_100127618 3300006931 Bacteria 2614
219 Ga0097620_100424601 3300006931 Bacteria 1426
220 Ga0097620_100701584 3300006931 Bacteria 1103
221 Ga0097620_100950018 3300006931 Bacteria 943
222 Ga0075435_100340518 3300007076 Bacteria 1285
223 Ga0075435_100594694 3300007076 Bacteria 959
224 Ga0099794_10533215 3300007265 Bacteria 619
225 Ga0105240_10166986 3300009093 Bacteria 2610
226 Ga0111539_10000574 3300009094 Bacteria 47151
227 Ga0111539_10002429 3300009094 Bacteria 24773
228 Ga0111539_10003739 3300009094 Bacteria 20026
229 Ga0111539_10045640 3300009094 Bacteria 5245
230 Ga0111539_10063646 3300009094 Archaea 4364
231 Ga0111539_10124091 3300009094 Bacteria 3026
232 Ga0111539_10225140 3300009094 Bacteria 2185
233 Ga0111539_10362259 3300009094 Unclassified 1688
234 Ga0111539_10494644 3300009094 Bacteria 1424
235 Ga0111539_10772331 3300009094 Unclassified 1118
236 Ga0111539_10865136 3300009094 Bacteria 1052
237 Ga0111539_10884220 3300009094 Bacteria 1039
238 Ga0111539_11051748 3300009094 Bacteria 946
239 Ga0111539_11391781 3300009094 Bacteria 814
240 Ga0105245_10005530 3300009098 Bacteria 11098
241 Ga0105245_10237800 3300009098 Bacteria 1764
242 Ga0105245_10845233 3300009098 Bacteria 955
243 Ga0105245_11625062 3300009098 Bacteria 698
244 Ga0114129_10058121 3300009147 Bacteria 5410
245 Ga0114129_10125831 3300009147 Bacteria 3524
246 Ga0114129_10246480 3300009147 Archaea 2400
247 Ga0114129_10808648 3300009147 Bacteria 1195
248 Ga0105243_10190007 3300009148 Bacteria 1793
249 Ga0105243_11541001 3300009148 Bacteria 689
250 Ga0105243_11575096 3300009148 Bacteria 683
251 Ga0105243_12327706 3300009148 Bacteria 573
252 Ga0105242_10170821 3300009176 Bacteria 1911
253 Ga0105242_10412977 3300009176 Bacteria 1263
254 Ga0105242_10834698 3300009176 Bacteria 915
255 Ga0105248_10004014 3300009177 Bacteria 16266
256 Ga0105248_10014472 3300009177 Bacteria 8684
257 Ga0105248_10098569 3300009177 Bacteria 3293
258 Ga0105248_10106266 3300009177 Bacteria 3165
259 Ga0105248_10112628 3300009177 Bacteria 3068
260 Ga0105248_10496480 3300009177 Bacteria 1376
261 Ga0105248_10647602 3300009177 Bacteria 1192
262 Ga0105248_10952669 3300009177 Bacteria 969
263 Ga0105237_10987674 3300009545 Unclassified 849
264 Ga0105238_10068642 3300009551 Bacteria 3545
265 Ga0105238_10379551 3300009551 Bacteria 1405
266 Ga0105249_10001092 3300009553 Bacteria 24120
267 Ga0105249_10579346 3300009553 Bacteria 1175
268 Ga0105249_10729145 3300009553 Bacteria 1052
269 Ga0105249_10743906 3300009553 Bacteria 1042
270 Ga0105249_10764165 3300009553 Bacteria 1029
271 Ga0105249_10817671 3300009553 Bacteria 996
272 Ga0157370_10964703 3300013104 Bacteria 773
273 Ga0157374_10043032 3300013296 Bacteria 4170
274 Ga0157374_10480291 3300013296 Bacteria 1246
275 Ga0157374_10510271 3300013296 Bacteria 1207
276 Ga0157374_10820694 3300013296 Bacteria 946
277 Ga0157374_10966616 3300013296 Bacteria 870
278 Ga0157378_10347039 3300013297 Unclassified 1449
279 Ga0163162_10156584 3300013306 Bacteria 2398
280 Ga0163162_10340092 3300013306 Bacteria 1633
281 Ga0163162_10887652 3300013306 Bacteria 1005
282 Ga0157372_11156356 3300013307 Bacteria 895
283 Ga0157375_10298626 3300013308 Bacteria 1774
284 Ga0157375_10407077 3300013308 Bacteria 1527
285 Ga0157375_11057485 3300013308 Bacteria 949
286 Ga0157375_11981797 3300013308 Unclassified 692
287 Ga0163163_10015579 3300014325 Bacteria 7031
288 Ga0163163_10024760 3300014325 Bacteria 5715
289 Ga0163163_10082760 3300014325 Bacteria 3214
290 Ga0157380_10013882 3300014326 Bacteria 5883
291 Ga0157380_10025698 3300014326 Bacteria 4468
292 Ga0157380_10161254 3300014326 Bacteria 1949
293 Ga0157380_10227784 3300014326 Bacteria 1672
294 Ga0157380_10358231 3300014326 Bacteria 1368
295 Ga0157380_10494981 3300014326 Bacteria 1186
296 Ga0157380_10798837 3300014326 Bacteria 960
297 Ga0157380_11065078 3300014326 Bacteria 846
298 Ga0157380_11212936 3300014326 Bacteria 798
299 Ga0157377_10133407 3300014745 Bacteria 1519
300 Ga0157377_10797963 3300014745 Bacteria 696
301 Ga0157379_10299420 3300014968 Bacteria 1466
302 Ga0157379_10592994 3300014968 Bacteria 1034
303 Ga0157376_10007267 3300014969 Bacteria 7889
304 Ga0157376_10022083 3300014969 Bacteria 4953
305 Ga0157376_10087276 3300014969 Bacteria 2692
306 Ga0157376_10120297 3300014969 Bacteria 2326
307 Ga0157376_10173042 3300014969 Bacteria 1968
308 Ga0157376_10562687 3300014969 Bacteria 1130
309 Ga0157376_10695310 3300014969 Bacteria 1021
310 Ga0157376_11389000 3300014969 Bacteria 734
311 Ga0163161_10742676 3300017792 Bacteria 820
312 Ga0207697_10125165 3300025315 Bacteria 1108
313 Ga0207697_10203753 3300025315 Bacteria 871
314 Ga0207653_10159825 3300025885 Bacteria 833
315 Ga0207682_10045539 3300025893 Bacteria 1801
316 Ga0207642_10028573 3300025899 Bacteria 2299
317 Ga0207710_10026968 3300025900 Bacteria 2485
318 Ga0207688_10038418 3300025901 Unclassified 2657
319 Ga0207688_10132789 3300025901 Bacteria 1460
320 Ga0207680_10160933 3300025903 Bacteria 1505
321 Ga0207680_10246440 3300025903 Unclassified 1233
322 Ga0207680_10731472 3300025903 Bacteria 709
323 Ga0207645_10085671 3300025907 Bacteria 2023
324 Ga0207645_10112553 3300025907 Bacteria 1763
325 Ga0207645_10644383 3300025907 Bacteria 720
326 Ga0207643_10003483 3300025908 Bacteria 8472
327 Ga0207643_10063784 3300025908 Bacteria 2108
328 Ga0207643_10065906 3300025908 Bacteria 2076
329 Ga0207643_10401884 3300025908 Bacteria 866
330 Ga0207705_10126122 3300025909 Bacteria 1903
331 Ga0207707_10105754 3300025912 Bacteria 2460
332 Ga0207707_10486064 3300025912 Bacteria 1054
333 Ga0207695_10094516 3300025913 Bacteria 2996
334 Ga0207660_10888900 3300025917 Unclassified 727
335 Ga0207649_10017379 3300025920 Bacteria 4076
336 Ga0207649_10301567 3300025920 Unclassified 1171
337 Ga0207652_10124930 3300025921 Bacteria 2291
338 Ga0207646_10082348 3300025922 Bacteria 2878
339 Ga0207681_10025180 3300025923 Bacteria 3824
340 Ga0207681_10147959 3300025923 Bacteria 1757
341 Ga0207681_10154475 3300025923 Bacteria 1723
342 Ga0207681_10402162 3300025923 Bacteria 1106
343 Ga0207681_10780464 3300025923 Bacteria 797
344 Ga0207694_10120087 3300025924 Bacteria 2098
345 Ga0207694_10126135 3300025924 Bacteria 2048
346 Ga0207650_10016485 3300025925 Bacteria 5166
347 Ga0207650_10053816 3300025925 Bacteria 2984
348 Ga0207650_10055286 3300025925 Unclassified 2946
349 Ga0207650_10358661 3300025925 Bacteria 1201
350 Ga0207650_10594994 3300025925 Bacteria 930
351 Ga0207659_10014718 3300025926 Bacteria 5053
352 Ga0207659_10017562 3300025926 Bacteria 4675
353 Ga0207659_10018635 3300025926 Bacteria 4554
354 Ga0207659_10024489 3300025926 Bacteria 4045
355 Ga0207659_10150945 3300025926 Bacteria 1814
356 Ga0207659_10435510 3300025926 Bacteria 1102
357 Ga0207659_10569095 3300025926 Bacteria 964
358 Ga0207687_10090225 3300025927 Bacteria 2233
359 Ga0207644_10019682 3300025931 Bacteria 4583
360 Ga0207644_10201010 3300025931 Bacteria 1572
361 Ga0207690_10032007 3300025932 Bacteria 3371
362 Ga0207690_10209233 3300025932 Bacteria 1486
363 Ga0207690_10434477 3300025932 Unclassified 1052
364 Ga0207706_10310728 3300025933 Bacteria 1373
365 Ga0207686_10089039 3300025934 Bacteria 2034
366 Ga0207686_10155632 3300025934 Bacteria 1596
367 Ga0207686_10157490 3300025934 Bacteria 1588
368 Ga0207670_10705541 3300025936 Unclassified 835
369 Ga0207670_11070161 3300025936 Bacteria 680
370 Ga0207669_10008318 3300025937 Bacteria 4861
371 Ga0207669_10020928 3300025937 Bacteria 3441
372 Ga0207669_10175505 3300025937 Bacteria 1530
373 Ga0207669_10713719 3300025937 Bacteria 825
374 Ga0207704_10064263 3300025938 Bacteria 2292
375 Ga0207704_10105651 3300025938 Bacteria 1889
376 Ga0207704_10145537 3300025938 Bacteria 1664
377 Ga0207704_10303054 3300025938 Unclassified 1225
378 Ga0207704_10307377 3300025938 Bacteria 1217
379 Ga0207704_10471367 3300025938 Bacteria 1006
380 Ga0207704_10824519 3300025938 Unclassified 776
381 Ga0207691_10031189 3300025940 Bacteria 4977
382 Ga0207691_10041103 3300025940 Bacteria 4271
383 Ga0207691_10131656 3300025940 Bacteria 2208
384 Ga0207691_10203697 3300025940 Unclassified 1721
385 Ga0207691_10263865 3300025940 Bacteria 1484
386 Ga0207691_10352835 3300025940 Bacteria 1258
387 Ga0207691_10776578 3300025940 Bacteria 806
388 Ga0207711_10030976 3300025941 Bacteria 4512
389 Ga0207711_10127608 3300025941 Bacteria 2277
390 Ga0207711_10260031 3300025941 Bacteria 1595
391 Ga0207711_10363870 3300025941 Bacteria 1340
392 Ga0207711_10564573 3300025941 Bacteria 1062
393 Ga0207689_10008290 3300025942 Bacteria 9056
394 Ga0207689_10056308 3300025942 Bacteria 3235
395 Ga0207689_10202242 3300025942 Bacteria 1640
396 Ga0207661_10061498 3300025944 Bacteria 3034
397 Ga0207661_10366504 3300025944 Bacteria 1302
398 Ga0207661_10442495 3300025944 Bacteria 1183
399 Ga0207679_10001418 3300025945 Bacteria 15080
400 Ga0207679_10261134 3300025945 Bacteria 1477
401 Ga0207679_10544418 3300025945 Bacteria 1041
402 Ga0207679_10579252 3300025945 Bacteria 1009
403 Ga0207667_10293034 3300025949 Bacteria 1662
404 Ga0207651_10105022 3300025960 Bacteria 2106
405 Ga0207651_10691153 3300025960 Bacteria 898
406 Ga0207651_10756288 3300025960 Bacteria 859
407 Ga0207651_10894625 3300025960 Bacteria 790
408 Ga0207712_10078730 3300025961 Bacteria 2393
409 Ga0207712_10288877 3300025961 Bacteria 1341
410 Ga0207712_11275250 3300025961 Bacteria 656
411 Ga0207668_10358097 3300025972 Bacteria 1222
412 Ga0207668_10375754 3300025972 Bacteria 1195
413 Ga0207668_10773900 3300025972 Bacteria 848
414 Ga0207658_11168452 3300025986 Unclassified 703
415 Ga0207677_10021072 3300026023 Bacteria 3975
416 Ga0207677_10074858 3300026023 Bacteria 2404
417 Ga0207677_10509729 3300026023 Bacteria 1042
418 Ga0207677_10568341 3300026023 Bacteria 991
419 Ga0207703_10024618 3300026035 Bacteria 4735
420 Ga0207703_10157980 3300026035 Bacteria 1983
421 Ga0207703_10511262 3300026035 Bacteria 1128
422 Ga0207703_10984783 3300026035 Unclassified 809
423 Ga0207639_11259496 3300026041 Unclassified 694
424 Ga0207708_10010943 3300026075 Bacteria 6747
425 Ga0207708_10027781 3300026075 Bacteria 4285
426 Ga0207708_10064847 3300026075 Bacteria 2791
427 Ga0207708_10073235 3300026075 Bacteria 2625
428 Ga0207708_10174136 3300026075 Bacteria 1706
429 Ga0207641_10001113 3300026088 Bacteria 27018
430 Ga0207641_10123264 3300026088 Bacteria 2316
431 Ga0207641_10166953 3300026088 Bacteria 2005
432 Ga0207641_11476958 3300026088 Bacteria 681
433 Ga0207648_10015050 3300026089 Bacteria 7124
434 Ga0207648_10031665 3300026089 Bacteria 4675
435 Ga0207648_10281607 3300026089 Bacteria 1487
436 Ga0207648_10366937 3300026089 Bacteria 1300
437 Ga0207648_10467275 3300026089 Bacteria 1151
438 Ga0207676_10024160 3300026095 Bacteria 4495
439 Ga0207676_10081630 3300026095 Bacteria 2627
440 Ga0207676_10362593 3300026095 Bacteria 1343
441 Ga0207676_10464978 3300026095 Bacteria 1195
442 Ga0207674_10060225 3300026116 Bacteria 3840
443 Ga0207674_10137767 3300026116 Bacteria 2401
444 Ga0207674_10368773 3300026116 Bacteria 1388
445 Ga0207674_11415926 3300026116 Bacteria 664
446 Ga0207675_100009434 3300026118 Bacteria 9133
447 Ga0207675_100050856 3300026118 Bacteria 3867
448 Ga0207675_100053114 3300026118 Bacteria 3781
449 Ga0207675_100935939 3300026118 Bacteria 884
450 Ga0207683_10005213 3300026121 Bacteria 11161
451 Ga0207683_10028915 3300026121 Bacteria 4796
452 Ga0207683_10066591 3300026121 Bacteria 3176
453 Ga0207683_10070708 3300026121 Bacteria 3084
454 Ga0207683_10107869 3300026121 Bacteria 2491
455 Ga0207683_10121864 3300026121 Bacteria 2342
456 Ga0207683_10235287 3300026121 Bacteria 1670
457 Ga0207683_10239425 3300026121 Bacteria 1655
458 Ga0207683_10384458 3300026121 Bacteria 1290
459 Ga0207683_10709050 3300026121 Bacteria 933
460 Ga0207683_11206143 3300026121 Bacteria 701
461 Ga0207698_11965033 3300026142 Unclassified 599
462 Ga0209813_10298346 3300027866 Bacteria 625
463 Ga0209974_10028472 3300027876 Unclassified 1851
464 Ga0207428_10000135 3300027907 Bacteria 99170
465 Ga0207428_10014844 3300027907 Bacteria 6746
466 Ga0207428_10068004 3300027907 Bacteria 2803
467 Ga0207428_10198991 3300027907 Bacteria 1508
468 Ga0207428_10266560 3300027907 Unclassified 1274
469 Ga0207428_10292309 3300027907 Unclassified 1207
470 Ga0268266_10013799 3300028379 Bacteria 6955
471 Ga0268265_10012921 3300028380 Bacteria 5668
472 Ga0268265_10145447 3300028380 Bacteria 1991
473 Ga0268265_10297742 3300028380 Bacteria 1451
474 Ga0268264_10112433 3300028381 Bacteria 2387
475 Ga0268264_10117206 3300028381 Bacteria 2342
476 Ga0268264_10257603 3300028381 Bacteria 1624
477 Ga0268264_10975200 3300028381 Unclassified 853
478 Ga0268264_11106355 3300028381 Bacteria 801
479 Ga0268264_11296828 3300028381 Bacteria 738
480 Ga0307408_100051734 3300031548 Unclassified 2960
481 Ga0307408_100374715 3300031548 Unclassified 1215
482 Ga0307408_100504427 3300031548 Bacteria 1060
483 Ga0307408_101357910 3300031548 Bacteria 668
484 Ga0307413_10005182 3300031824 Bacteria 5782
485 Ga0307413_10039092 3300031824 Bacteria 2756
486 Ga0307413_10093559 3300031824 Bacteria 1965
487 Ga0307410_10061640 3300031852 Bacteria 2567
488 Ga0307410_10078486 3300031852 Bacteria 2311
489 Ga0307410_10586807 3300031852 Bacteria 928
490 Ga0307410_10712931 3300031852 Bacteria 847
491 Ga0307406_10639233 3300031901 Bacteria 882
492 Ga0307406_10854826 3300031901 Bacteria 771
493 Ga0307407_10005651 3300031903 Bacteria 5455
494 Ga0307407_10229422 3300031903 Bacteria 1260
495 Ga0307407_10331931 3300031903 Bacteria 1071
496 Ga0307412_10020994 3300031911 Unclassified 3983
497 Ga0307412_10427443 3300031911 Bacteria 1085
498 Ga0307409_100001383 3300031995 Bacteria 11838
499 Ga0307409_100084343 3300031995 Bacteria 2579
500 Ga0307409_100227578 3300031995 Bacteria 1688
501 Ga0307409_100871978 3300031995 Bacteria 912
502 Ga0307416_100023543 3300032002 Unclassified 4471
503 Ga0307416_100197408 3300032002 Bacteria 1905
504 Ga0307414_10027116 3300032004 Bacteria 3698
505 Ga0307414_10046077 3300032004 Unclassified 2990
506 Ga0307411_10039831 3300032005 Bacteria 2976
507 Ga0307415_100153061 3300032126 Bacteria 1777
508 Ga0373940_0268377 3300035088 Bacteria 580
509 Ga0373951_0034987 3300035091 Bacteria 1194
510 Ga0373936_0082227 3300035113 Bacteria 1342
511 Ga0373954_0570326 3300035118 Bacteria 561
512 Ga0373924_0299655 3300035410 Bacteria 714
513 Ga0373931_0355436 3300035691 Bacteria 918
514 Ga0373933_0309285 3300035724 Bacteria 1024
515 Ga0373947_0361680 3300035725 Bacteria 975
516 Ga0373947_0577123 3300035725 Bacteria 766
517 Ga0373937_0073096 3300036401 Bacteria 3163
518 Ga0373937_0198196 3300036401 Bacteria 1887
519 Ga0373937_0258832 3300036401 Bacteria 1641
520 Ga0373937_0368145 3300036401 Bacteria 1363
521 Ga0373925_1047171 3300037068 Bacteria 672
522 Ga0439453_0064930 3300041408 Bacteria 763
523 Ga0451802_2033698 3300041460 Bacteria 1449
524 Ga0451845_0766076 3300041501 Unclassified 700
525 Ga0451853_3156784 3300041512 Bacteria 1852
526 Ga0439433_0022877 3300041999 Bacteria 1404
527 Ga0439446_0012689 3300042156 Bacteria 2303
528 Ga0439440_0072644 3300042993 Unclassified 898
529 Ga0451576_0386390 3300045051 Bacteria 1467
530 Ga0451576_0493834 3300045051 Bacteria 1286
531 Ga0451576_2015259 3300045051 Unclassified 594
532 Ga0495603_0168083 3300046455 Bacteria 1270
533 Ga0495629_0664291 3300046459 Bacteria 694
534 Ga0495653_0180932 3300046463 Bacteria 1447
535 Ga0495580_0051424 3300046472 Bacteria 2913
536 Ga0495582_0154256 3300046473 Bacteria 1305
537 Ga0495664_0293731 3300046477 Bacteria 981
538 Ga0495594_0093970 3300046499 Bacteria 1682
539 Ga0495594_0409158 3300046499 Bacteria 772
540 Ga0495618_0162017 3300046514 Bacteria 1426
541 Ga0495628_0031538 3300046516 Bacteria 4286
542 Ga0495628_0465949 3300046516 Bacteria 916
543 Ga0495630_0204792 3300046517 Bacteria 1506
544 Ga0495640_0212138 3300046533 Bacteria 1224
545 Ga0495598_0260173 3300046537 Unclassified 645
546 Ga0495633_0211587 3300046558 Bacteria 889
547 Ga0495634_0552035 3300046642 Bacteria 672
548 Ga0495634_0687651 3300046642 Bacteria 589
549 Ga0495659_0129697 3300046664 Bacteria 999
550 Ga0495588_0046861 3300046674 Bacteria 2218
551 Ga0495588_0556968 3300046674 Bacteria 601
552 Ga0495647_0086000 3300046681 Bacteria 1282
553 Ga0495647_0117582 3300046681 Bacteria 1115
554 Ga0495647_0124820 3300046681 Bacteria 1086
555 Ga0495658_0208186 3300046683 Bacteria 1221
556 Ga0495600_0340935 3300046809 Bacteria 940
557 Ga0495674_0478055 3300047319 Bacteria 999
558 Ga0496100_0015890 3300048903 Bacteria 4407
559 Ga0496101_0017516 3300048904 Bacteria 4859
560 Ga0496101_0730042 3300048904 Bacteria 782
561 Ga0496104_0030525 3300048907 Bacteria 5009
562 Ga0496104_0111339 3300048907 Bacteria 2625
563 Ga0496105_0354421 3300048908 Bacteria 1171
564 Ga0496105_0667643 3300048908 Unclassified 801
565 Ga0496106_0049120 3300048909 Bacteria 3178
566 Ga0496106_0345262 3300048909 Bacteria 1195
567 Ga0496107_0243619 3300048910 Bacteria 1338
568 Ga0496108_0042918 3300048911 Bacteria 3776
569 Ga0496108_0353137 3300048911 Bacteria 1283
570 Ga0496108_0653054 3300048911 Bacteria 914
571 Ga0496109_0198215 3300048912 Bacteria 1887
572 Ga0496110_1232442 3300048913 Bacteria 657
573 Ga0496112_0010360 3300048915 Bacteria 8453
574 Ga0496113_0163706 3300048916 Bacteria 1759
575 Ga0496113_1451634 3300048916 Bacteria 530
576 Ga0496114_0006858 3300048917 Bacteria 8970
577 Ga0501298_101046 3300049521 Bacteria 658
578 Ga0501031_0873515 3300049568 Bacteria 576
579 Ga0501036_0088378 3300049572 Bacteria 2619
580 Ga0501037_0208237 3300049573 Bacteria 1380
581 Ga0501039_0507744 3300049575 Bacteria 947
582 Ga0501039_0742114 3300049575 Bacteria 767
583 Ga0501040_0042103 3300049576 Bacteria 3111
584 Ga0501040_0740640 3300049576 Bacteria 711
585 Ga0501042_0160842 3300049578 Unclassified 1620
586 Ga0501042_0898850 3300049578 Bacteria 645
587 Ga0501046_0017247 3300049580 Bacteria 6031
588 Ga0501048_0592506 3300049582 Unclassified 796
589 Ga0501071_0015330 3300049587 Bacteria 5260
590 Ga0501074_0562236 3300049590 Bacteria 807
591 Ga0501074_0922815 3300049590 Unclassified 614
592 Ga0501076_0104925 3300049592 Bacteria 2281
593 Ga0501076_0456038 3300049592 Bacteria 1053
594 Ga0501077_0074519 3300049593 Bacteria 2150
595 Ga0501227_131276 3300049665 Bacteria 682
596 Ga0501235_036140 3300049669 Bacteria 1123
597 Ga0501257_042152 3300049686 Bacteria 1123
598 Ga0501257_067784 3300049686 Bacteria 908
599 Ga0501079_0013323 3300049741 Bacteria 6269
600 Ga0501079_0061456 3300049741 Unclassified 2898
601 Ga0501080_0066756 3300049742 Bacteria 3346
602 Ga0501081_0011946 3300049743 Bacteria 5690
603 Ga0501081_0241976 3300049743 Bacteria 1316
604 Ga0501081_0249400 3300049743 Bacteria 1296
605 Ga0501081_0249666 3300049743 Unclassified 1295
606 Ga0501081_0283218 3300049743 Bacteria 1214
607 Ga0501262_049287 3300049759 Bacteria 648
608 Ga0501268_081127 3300049765 Bacteria 670
609 Ga0501283_003561 3300049779 Bacteria 2066
610 Ga0501045_0035816 3300049824 Bacteria 3604
611 nmdc:mga03683_356780_c1 3300050489 Bacteria 693
612 nmdc:mga00v17_287243_c1 3300050491 Bacteria 1068
613 nmdc:mga00v17_294541_c1 3300050491 Bacteria 1054
614 nmdc:mga0k408_40638_c1 3300050493 Bacteria 2677
615 nmdc:mga0k408_634193_c1 3300050493 Bacteria 629
616 nmdc:mga06z11_45515_c1 3300050494 Bacteria 2219
617 nmdc:mga06z11_48058_c1 3300050494 Bacteria 2170
618 nmdc:mga05p37_219988_c1 3300050507 Bacteria 2292
619 nmdc:mga05p37_390596_c1 3300050507 Bacteria 1627
620 nmdc:mga09592_3046_c1 3300050508 Bacteria 13599
621 nmdc:mga09592_38891_c1 3300050508 Archaea 3994
622 nmdc:mga0qj67_13273_c1 3300050509 Bacteria 6216
623 nmdc:mga0qj67_16810_c1 3300050509 Bacteria 5555
624 nmdc:mga0qj67_966822_c1 3300050509 Bacteria 669
625 nmdc:mga06r32_230254_c1 3300050510 Unclassified 1841
626 nmdc:mga06r32_7395_c1 3300050510 Bacteria 9881
627 nmdc:mga08y16_100662_c1 3300050511 Bacteria 3009
628 nmdc:mga08y16_13896_c1 3300050511 Bacteria 8472
629 nmdc:mga08y16_1673_c1 3300050511 Bacteria 22480
630 nmdc:mga08y16_1923_c1 3300050511 Bacteria 21184
631 nmdc:mga08y16_247266_c1 3300050511 Bacteria 1843
632 nmdc:mga08y16_314051_c1 3300050511 Unclassified 1614
633 nmdc:mga08y16_549028_c1 3300050511 Bacteria 1169
634 nmdc:mga08y16_625232_c1 3300050511 Bacteria 1083
635 nmdc:mga08y16_78426_c1 3300050511 Bacteria 3443
636 nmdc:mga08y16_87653_c1 3300050511 Archaea 3243
637 nmdc:mga08y16_888767_c1 3300050511 Bacteria 878
638 nmdc:mga0n895_1584810_c1 3300050512 Bacteria 619
639 nmdc:mga0n895_159056_c1 3300050512 Bacteria 2290
640 nmdc:mga0n895_2150_c1 3300050512 Bacteria 15218
641 nmdc:mga0n895_461238_c1 3300050512 Bacteria 1282
642 nmdc:mga0n895_612251_c1 3300050512 Unclassified 1091
643 nmdc:mga0rr50_885792_c1 3300050513 Unclassified 761
644 nmdc:mga08x19_103354_c1 3300050514 Unclassified 1893
645 nmdc:mga0a205_11492_c1 3300050515 Bacteria 2761
646 nmdc:mga0a205_142379_c1 3300050515 Bacteria 2298
647 Ga0495619_0040021 3300053085 Bacteria 3063
648 Ga0500556_0050396 3300053104 Bacteria 1504
649 Ga0500568_0020287 3300053139 Bacteria 2877
650 Ga0501084_1330999 3300054114 Unclassified 602
651 Ga0590071_000318 3300059421 Bacteria 14070
652 Ga0590071_023405 3300059421 Bacteria 1460
653 Ga0590074_000601 3300059423 Bacteria 5422
654 Ga0590075_003454 3300059424 Unclassified 3757
655 Ga0590077_000122 3300059426 Bacteria 21076
656 Ga0590077_020452 3300059426 Bacteria 1405
657 Ga0501082_0055961 3300060353 Bacteria 3398
658 Ga0530510_0067238 3300061734 Bacteria 2600
659 Ga0530510_0397982 3300061734 Bacteria 1038
660 nmdc:mga0rr50_766583_c1
661 JGI24751J29686_10003566
662 Ga0065714_10181147
663 Ga0065704_10132262
664 Ga0065712_10088343
665 Ga0065712_10125347
666 Ga0065712_10193579
667 Ga0065712_10412446
668 Ga0065715_10009987
669 Ga0065715_10013966
670 Ga0065715_10039109
671 Ga0065715_10089959
672 Ga0065715_10094271
673 Ga0065707_10014580
674 Ga0065707_10070975
675 Ga0065707_10187748
676 Ga0065707_10252139
677 Ga0070658_10184829
678 Ga0070676_10030837
679 Ga0070676_10040833
680 Ga0070683_100025701
681 Ga0070683_100375206
682 Ga0070683_101132134
683 Ga0070690_100090500
684 Ga0070690_100521510
685 Ga0070670_100003306
686 Ga0070670_100024771
687 Ga0070670_100070097
688 Ga0070670_100085970
689 Ga0070670_100424454
690 Ga0070677_10054334
691 Ga0068869_100003855
692 Ga0068869_100058299
693 Ga0068869_100074845
694 Ga0070666_10090105
695 Ga0070666_10099554
696 Ga0070666_10101538
697 Ga0070666_10738800
698 Ga0070680_100068599
699 Ga0070680_100825325
700 Ga0070682_100109865
701 Ga0068868_100076821
702 Ga0068868_100326788
703 Ga0068868_101199519
704 Ga0070660_101409364
705 Ga0070689_100041912
706 Ga0070687_100129601
707 Ga0070661_100066917
708 Ga0070661_100656222
709 Ga0070692_10825117
710 Ga0070668_100156650
711 Ga0070668_100422948
712 Ga0070669_100001561
713 Ga0070669_100036111
714 Ga0070669_100082570
715 Ga0070669_100116192
716 Ga0070669_100229633
717 Ga0070675_100045363
718 Ga0070675_100078114
719 Ga0070675_100079935
720 Ga0070675_100101632
721 Ga0070675_100175294
722 Ga0070675_100340828
723 Ga0070675_100641533
724 Ga0070671_100265811
725 Ga0070671_100284418
726 Ga0070671_100600383
727 Ga0070674_100005769
728 Ga0070674_100059522
729 Ga0070674_100072270
730 Ga0070674_100075194
731 Ga0070674_100253991
732 Ga0070674_101781670
733 Ga0070673_100092839
734 Ga0070673_100133039
735 Ga0070673_100347528
736 Ga0070673_100590747
737 Ga0070673_100756684
738 Ga0070688_100003927
739 Ga0070659_100242817
740 Ga0070667_100073101
741 Ga0070703_10206498
742 Ga0070701_10041600
743 Ga0070701_10148330
744 Ga0070700_100012421
745 Ga0070700_100060261
746 Ga0070700_100086478
747 Ga0070700_100130988
748 Ga0070694_100103780
749 Ga0070678_100017430
750 Ga0070678_100040642
751 Ga0070678_100049849
752 Ga0070678_100105719
753 Ga0070678_100204192
754 Ga0070678_100209405
755 Ga0070678_100403132
756 Ga0070678_100867578
757 Ga0070681_10193812
758 Ga0070681_10428445
759 Ga0068867_100081987
760 Ga0068867_100203944
761 Ga0068867_100791145
762 Ga0070685_10086441
763 Ga0070706_101286170
764 Ga0070707_100058637
765 Ga0070699_100195649
766 Ga0070699_100281271
767 Ga0070679_100052583
768 Ga0070679_100066537
769 Ga0070684_100452149
770 Ga0070684_100569446
771 Ga0070684_100859717
772 Ga0070697_100114530
773 Ga0068853_100332071
774 Ga0068853_100772762
775 Ga0070672_100035037
776 Ga0070672_100222606
777 Ga0070672_100588367
778 Ga0070672_101102095
779 Ga0070686_100128563
780 Ga0070686_100435446
781 Ga0070695_100014083
782 Ga0070695_100139806
783 Ga0070693_100268950
784 Ga0070665_100010405
785 Ga0070665_101348126
786 Ga0070704_100179687
787 Ga0070704_100461344
788 Ga0068855_100166402
789 Ga0070664_100010469
790 Ga0070664_100081483
791 Ga0070664_100408676
792 Ga0068857_100123946
793 Ga0068857_100151735
794 Ga0068857_100171186
795 Ga0068857_101492289
796 Ga0070702_100209617
797 Ga0068859_100012212
798 Ga0068859_100017910
799 Ga0068859_100127615
800 Ga0068859_100424618
801 Ga0068859_100701544
802 Ga0068859_100949939
803 Ga0068864_100006553
804 Ga0068864_100099430
805 Ga0068864_100105483
806 Ga0068864_100138356
807 Ga0068864_100744351
808 Ga0068861_100019635
809 Ga0068861_100097269
810 Ga0068861_100477464
811 Ga0068861_101558505
812 Ga0068851_10243954
813 Ga0068870_10040977
814 Ga0068870_10239620
815 Ga0068863_100037310
816 Ga0068863_100044064
817 Ga0068863_100900135
818 Ga0068858_100008122
819 Ga0068858_100034125
820 Ga0068858_100745980
821 Ga0068858_101136232
822 Ga0068858_101180850
823 Ga0068860_100194313
824 Ga0068860_100473910
825 Ga0068860_100572493
826 Ga0068860_100813344
827 Ga0068862_100026065
828 Ga0068862_100156683
829 Ga0068862_101510507
830 Ga0075368_10372565
831 Ga0075363_100231047
832 Ga0075364_10226845
833 Ga0075364_10655384
834 Ga0075362_10396977
835 Ga0075367_10017155
836 Ga0075367_10194159
837 Ga0075366_10066745
838 Ga0097621_100000477
839 Ga0097621_100022317
840 Ga0097621_100099527
841 Ga0097621_100201592
842 Ga0097621_100214225
843 Ga0097621_100586504
844 Ga0068871_100012430
845 Ga0068871_100015114
846 Ga0068871_100032822
847 Ga0068871_100057850
848 Ga0068871_100706398
849 Ga0068871_100778959
850 Ga0068871_101488041
851 Ga0075428_100000786
852 Ga0075428_100008874
853 Ga0075428_100020230
854 Ga0075428_100020594
855 Ga0075428_100257874
856 Ga0075428_100514675
857 Ga0075430_100003498
858 Ga0075430_100008831
859 Ga0075430_100116964
860 Ga0075431_100001181
861 Ga0075433_10087067
862 Ga0075433_10098819
863 Ga0075434_100010893
864 Ga0075434_100103147
865 Ga0075434_100121122
866 Ga0075429_100000181
867 Ga0075429_100037563
868 Ga0075429_100253241
869 Ga0075429_100565789
870 Ga0068865_100112244
871 Ga0068865_100197898
872 Ga0068865_100751488
873 Ga0068865_100753274
874 Ga0075436_100052564
875 Ga0097620_100012212
876 Ga0097620_100017910
877 Ga0097620_100127618
878 Ga0097620_100424601
879 Ga0097620_100701584
880 Ga0097620_100950018
881 Ga0075435_100340518
882 Ga0075435_100594694
883 Ga0099794_10533215
884 Ga0105240_10166986
885 Ga0111539_10000574
886 Ga0111539_10002429
887 Ga0111539_10003739
888 Ga0111539_10045640
889 Ga0111539_10063646
890 Ga0111539_10124091
891 Ga0111539_10225140
892 Ga0111539_10362259
893 Ga0111539_10494644
894 Ga0111539_10772331
895 Ga0111539_10865136
896 Ga0111539_10884220
897 Ga0111539_11051748
898 Ga0111539_11391781
899 Ga0105245_10005530
900 Ga0105245_10237800
901 Ga0105245_10845233
902 Ga0105245_11625062
903 Ga0114129_10058121
904 Ga0114129_10125831
905 Ga0114129_10246480
906 Ga0114129_10808648
907 Ga0105243_10190007
908 Ga0105243_11541001
909 Ga0105243_11575096
910 Ga0105243_12327706
911 Ga0105242_10170821
912 Ga0105242_10412977
913 Ga0105242_10834698
914 Ga0105248_10004014
915 Ga0105248_10014472
916 Ga0105248_10098569
917 Ga0105248_10106266
918 Ga0105248_10112628
919 Ga0105248_10496480
920 Ga0105248_10647602
921 Ga0105248_10952669
922 Ga0105237_10987674
923 Ga0105238_10068642
924 Ga0105238_10379551
925 Ga0105249_10001092
926 Ga0105249_10579346
927 Ga0105249_10729145
928 Ga0105249_10743906
929 Ga0105249_10764165
930 Ga0105249_10817671
931 Ga0157370_10964703
932 Ga0157374_10043032
933 Ga0157374_10480291
934 Ga0157374_10510271
935 Ga0157374_10820694
936 Ga0157374_10966616
937 Ga0157378_10347039
938 Ga0163162_10156584
939 Ga0163162_10340092
940 Ga0163162_10887652
941 Ga0157372_11156356
942 Ga0157375_10298626
943 Ga0157375_10407077
944 Ga0157375_11057485
945 Ga0157375_11981797
946 Ga0163163_10015579
947 Ga0163163_10024760
948 Ga0163163_10082760
949 Ga0157380_10013882
950 Ga0157380_10025698
951 Ga0157380_10161254
952 Ga0157380_10227784
953 Ga0157380_10358231
954 Ga0157380_10494981
955 Ga0157380_10798837
956 Ga0157380_11065078
957 Ga0157380_11212936
958 Ga0157377_10133407
959 Ga0157377_10797963
960 Ga0157379_10299420
961 Ga0157379_10592994
962 Ga0157376_10007267
963 Ga0157376_10022083
964 Ga0157376_10087276
965 Ga0157376_10120297
966 Ga0157376_10173042
967 Ga0157376_10562687
968 Ga0157376_10695310
969 Ga0157376_11389000
970 Ga0163161_10742676
971 Ga0207697_10125165
972 Ga0207697_10203753
973 Ga0207653_10159825
974 Ga0207682_10045539
975 Ga0207642_10028573
976 Ga0207710_10026968
977 Ga0207688_10038418
978 Ga0207688_10132789
979 Ga0207680_10160933
980 Ga0207680_10246440
981 Ga0207680_10731472
982 Ga0207645_10085671
983 Ga0207645_10112553
984 Ga0207645_10644383
985 Ga0207643_10003483
986 Ga0207643_10063784
987 Ga0207643_10065906
988 Ga0207643_10401884
989 Ga0207705_10126122
990 Ga0207707_10105754
991 Ga0207707_10486064
992 Ga0207695_10094516
993 Ga0207660_10888900
994 Ga0207649_10017379
995 Ga0207649_10301567
996 Ga0207652_10124930
997 Ga0207646_10082348
998 Ga0207681_10025180
999 Ga0207681_10147959
1000 Ga0207681_10154475
1001 Ga0207681_10402162
1002 Ga0207681_10780464
1003 Ga0207694_10120087
1004 Ga0207694_10126135
1005 Ga0207650_10016485
1006 Ga0207650_10053816
1007 Ga0207650_10055286
1008 Ga0207650_10358661
1009 Ga0207650_10594994
1010 Ga0207659_10014718
1011 Ga0207659_10017562
1012 Ga0207659_10018635
1013 Ga0207659_10024489
1014 Ga0207659_10150945
1015 Ga0207659_10435510
1016 Ga0207659_10569095
1017 Ga0207687_10090225
1018 Ga0207644_10019682
1019 Ga0207644_10201010
1020 Ga0207690_10032007
1021 Ga0207690_10209233
1022 Ga0207690_10434477
1023 Ga0207706_10310728
1024 Ga0207686_10089039
1025 Ga0207686_10155632
1026 Ga0207686_10157490
1027 Ga0207670_10705541
1028 Ga0207670_11070161
1029 Ga0207669_10008318
1030 Ga0207669_10020928
1031 Ga0207669_10175505
1032 Ga0207669_10713719
1033 Ga0207704_10064263
1034 Ga0207704_10105651
1035 Ga0207704_10145537
1036 Ga0207704_10303054
1037 Ga0207704_10307377
1038 Ga0207704_10471367
1039 Ga0207704_10824519
1040 Ga0207691_10031189
1041 Ga0207691_10041103
1042 Ga0207691_10131656
1043 Ga0207691_10203697
1044 Ga0207691_10263865
1045 Ga0207691_10352835
1046 Ga0207691_10776578
1047 Ga0207711_10030976
1048 Ga0207711_10127608
1049 Ga0207711_10260031
1050 Ga0207711_10363870
1051 Ga0207711_10564573
1052 Ga0207689_10008290
1053 Ga0207689_10056308
1054 Ga0207689_10202242
1055 Ga0207661_10061498
1056 Ga0207661_10366504
1057 Ga0207661_10442495
1058 Ga0207679_10001418
1059 Ga0207679_10261134
1060 Ga0207679_10544418
1061 Ga0207679_10579252
1062 Ga0207667_10293034
1063 Ga0207651_10105022
1064 Ga0207651_10691153
1065 Ga0207651_10756288
1066 Ga0207651_10894625
1067 Ga0207712_10078730
1068 Ga0207712_10288877
1069 Ga0207712_11275250
1070 Ga0207668_10358097
1071 Ga0207668_10375754
1072 Ga0207668_10773900
1073 Ga0207658_11168452
1074 Ga0207677_10021072
1075 Ga0207677_10074858
1076 Ga0207677_10509729
1077 Ga0207677_10568341
1078 Ga0207703_10024618
1079 Ga0207703_10157980
1080 Ga0207703_10511262
1081 Ga0207703_10984783
1082 Ga0207639_11259496
1083 Ga0207708_10010943
1084 Ga0207708_10027781
1085 Ga0207708_10064847
1086 Ga0207708_10073235
1087 Ga0207708_10174136
1088 Ga0207641_10001113
1089 Ga0207641_10123264
1090 Ga0207641_10166953
1091 Ga0207641_11476958
1092 Ga0207648_10015050
1093 Ga0207648_10031665
1094 Ga0207648_10281607
1095 Ga0207648_10366937
1096 Ga0207648_10467275
1097 Ga0207676_10024160
1098 Ga0207676_10081630
1099 Ga0207676_10362593
1100 Ga0207676_10464978
1101 Ga0207674_10060225
1102 Ga0207674_10137767
1103 Ga0207674_10368773
1104 Ga0207674_11415926
1105 Ga0207675_100009434
1106 Ga0207675_100050856
1107 Ga0207675_100053114
1108 Ga0207675_100935939
1109 Ga0207683_10005213
1110 Ga0207683_10028915
1111 Ga0207683_10066591
1112 Ga0207683_10070708
1113 Ga0207683_10107869
1114 Ga0207683_10121864
1115 Ga0207683_10235287
1116 Ga0207683_10239425
1117 Ga0207683_10384458
1118 Ga0207683_10709050
1119 Ga0207683_11206143
1120 Ga0207698_11965033
1121 Ga0209813_10298346
1122 Ga0209974_10028472
1123 Ga0207428_10000135
1124 Ga0207428_10014844
1125 Ga0207428_10068004
1126 Ga0207428_10198991
1127 Ga0207428_10266560
1128 Ga0207428_10292309
1129 Ga0268266_10013799
1130 Ga0268265_10012921
1131 Ga0268265_10145447
1132 Ga0268265_10297742
1133 Ga0268264_10112433
1134 Ga0268264_10117206
1135 Ga0268264_10257603
1136 Ga0268264_10975200
1137 Ga0268264_11106355
1138 Ga0268264_11296828
1139 Ga0307408_100051734
1140 Ga0307408_100374715
1141 Ga0307408_100504427
1142 Ga0307408_101357910
1143 Ga0307413_10005182
1144 Ga0307413_10039092
1145 Ga0307413_10093559
1146 Ga0307410_10061640
1147 Ga0307410_10078486
1148 Ga0307410_10586807
1149 Ga0307410_10712931
1150 Ga0307406_10639233
1151 Ga0307406_10854826
1152 Ga0307407_10005651
1153 Ga0307407_10229422
1154 Ga0307407_10331931
1155 Ga0307412_10020994
1156 Ga0307412_10427443
1157 Ga0307409_100001383
1158 Ga0307409_100084343
1159 Ga0307409_100227578
1160 Ga0307409_100871978
1161 Ga0307416_100023543
1162 Ga0307416_100197408
1163 Ga0307414_10027116
1164 Ga0307414_10046077
1165 Ga0307411_10039831
1166 Ga0307415_100153061
1167 Ga0373940_0268377
1168 Ga0373951_0034987
1169 Ga0373936_0082227
1170 Ga0373954_0570326
1171 Ga0373924_0299655
1172 Ga0373931_0355436
1173 Ga0373933_0309285
1174 Ga0373947_0361680
1175 Ga0373947_0577123
1176 Ga0373937_0073096
1177 Ga0373937_0198196
1178 Ga0373937_0258832
1179 Ga0373937_0368145
1180 Ga0373925_1047171
1181 Ga0439453_0064930
1182 Ga0451802_2033698
1183 Ga0451845_0766076
1184 Ga0451853_3156784
1185 Ga0439433_0022877
1186 Ga0439446_0012689
1187 Ga0439440_0072644
1188 Ga0451576_0386390
1189 Ga0451576_0493834
1190 Ga0451576_2015259
1191 Ga0495603_0168083
1192 Ga0495629_0664291
1193 Ga0495653_0180932
1194 Ga0495580_0051424
1195 Ga0495582_0154256
1196 Ga0495664_0293731
1197 Ga0495594_0093970
1198 Ga0495594_0409158
1199 Ga0495618_0162017
1200 Ga0495628_0031538
1201 Ga0495628_0465949
1202 Ga0495630_0204792
1203 Ga0495640_0212138
1204 Ga0495598_0260173
1205 Ga0495633_0211587
1206 Ga0495634_0552035
1207 Ga0495634_0687651
1208 Ga0495659_0129697
1209 Ga0495588_0046861
1210 Ga0495588_0556968
1211 Ga0495647_0086000
1212 Ga0495647_0117582
1213 Ga0495647_0124820
1214 Ga0495658_0208186
1215 Ga0495600_0340935
1216 Ga0495674_0478055
1217 Ga0496100_0015890
1218 Ga0496101_0017516
1219 Ga0496101_0730042
1220 Ga0496104_0030525
1221 Ga0496104_0111339
1222 Ga0496105_0354421
1223 Ga0496105_0667643
1224 Ga0496106_0049120
1225 Ga0496106_0345262
1226 Ga0496107_0243619
1227 Ga0496108_0042918
1228 Ga0496108_0353137
1229 Ga0496108_0653054
1230 Ga0496109_0198215
1231 Ga0496110_1232442
1232 Ga0496112_0010360
1233 Ga0496113_0163706
1234 Ga0496113_1451634
1235 Ga0496114_0006858
1236 Ga0501298_101046
1237 Ga0501031_0873515
1238 Ga0501036_0088378
1239 Ga0501037_0208237
1240 Ga0501039_0507744
1241 Ga0501039_0742114
1242 Ga0501040_0042103
1243 Ga0501040_0740640
1244 Ga0501042_0160842
1245 Ga0501042_0898850
1246 Ga0501046_0017247
1247 Ga0501048_0592506
1248 Ga0501071_0015330
1249 Ga0501074_0562236
1250 Ga0501074_0922815
1251 Ga0501076_0104925
1252 Ga0501076_0456038
1253 Ga0501077_0074519
1254 Ga0501227_131276
1255 Ga0501235_036140
1256 Ga0501257_042152
1257 Ga0501257_067784
1258 Ga0501079_0013323
1259 Ga0501079_0061456
1260 Ga0501080_0066756
1261 Ga0501081_0011946
1262 Ga0501081_0241976
1263 Ga0501081_0249400
1264 Ga0501081_0249666
1265 Ga0501081_0283218
1266 Ga0501262_049287
1267 Ga0501268_081127
1268 Ga0501283_003561
1269 Ga0501045_0035816
1270 nmdc:mga03683_356780_c1
1271 nmdc:mga00v17_287243_c1
1272 nmdc:mga00v17_294541_c1
1273 nmdc:mga0k408_40638_c1
1274 nmdc:mga0k408_634193_c1
1275 nmdc:mga06z11_45515_c1
1276 nmdc:mga06z11_48058_c1
1277 nmdc:mga05p37_219988_c1
1278 nmdc:mga05p37_390596_c1
1279 nmdc:mga09592_3046_c1
1280 nmdc:mga09592_38891_c1
1281 nmdc:mga0qj67_13273_c1
1282 nmdc:mga0qj67_16810_c1
1283 nmdc:mga0qj67_966822_c1
1284 nmdc:mga06r32_230254_c1
1285 nmdc:mga06r32_7395_c1
1286 nmdc:mga08y16_100662_c1
1287 nmdc:mga08y16_13896_c1
1288 nmdc:mga08y16_1673_c1
1289 nmdc:mga08y16_1923_c1
1290 nmdc:mga08y16_247266_c1
1291 nmdc:mga08y16_314051_c1
1292 nmdc:mga08y16_549028_c1
1293 nmdc:mga08y16_625232_c1
1294 nmdc:mga08y16_78426_c1
1295 nmdc:mga08y16_87653_c1
1296 nmdc:mga08y16_888767_c1
1297 nmdc:mga0n895_1584810_c1
1298 nmdc:mga0n895_159056_c1
1299 nmdc:mga0n895_2150_c1
1300 nmdc:mga0n895_461238_c1
1301 nmdc:mga0n895_612251_c1
1302 nmdc:mga0rr50_885792_c1
1303 nmdc:mga08x19_103354_c1
1304 nmdc:mga0a205_11492_c1
1305 nmdc:mga0a205_142379_c1
1306 Ga0495619_0040021
1307 Ga0500556_0050396
1308 Ga0500568_0020287
1309 Ga0501084_1330999
1310 Ga0590071_000318
1311 Ga0590071_023405
1312 Ga0590074_000601
1313 Ga0590075_003454
1314 Ga0590077_000122
1315 Ga0590077_020452
1316 Ga0501082_0055961
1317 Ga0530510_0067238
1318 Ga0530510_0397982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

32

184

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pn3-assembly1.cif.gz_A crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) in complex with inhibitor 21 0.857 11 158
6jf3-assembly1.cif.gz_A actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.8569 10 157
5cx0-assembly1.cif.gz_A-2 structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 0.8552 8 161
6jf7-assembly1.cif.gz_B k3u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.8512 10 156
6jf5-assembly1.cif.gz_A k2u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.8498 10 155
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8503 10 158 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.849 9 161 3.90.45.10
4dr9B00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8159 8 158 3.90.45.10
4je6A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8129 10 162 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8067 11 173 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A1F6R6H8-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.8714 11 158 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A1J4U1S3-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.8685 9 158 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A3D1CSF0-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.8647 11 161 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2E5WLA7-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.8632 11 158 GO:0006412
GO:0042586
GO:0046872
AF-A0A554J5R7-F1-model_v4 Formylmethionine deformylase 0.8607 8 163 GO:0042586

Map