F473164

General Info

Members Datasets Scaffolds Average Seq Length
658 236 1316 143

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100042602|Ga0075436_1000426025
Length 145
Sequence MSISYLPTINAVLNAISGILIVIGFVLIRRGRVAAHHTCMIGAVISSSLFLICYLLYHVVFKAGVTRFAGTGWVRSLYLVILTSHTILAIIIVPFVIVTLMRALRGQFLRHRAIARWTFPMWLYVSITGVIVYLMLYHIFPSRTQ

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
199 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
200 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
201 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
202 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
203 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
204 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
205 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
206 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
213 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
214 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
218 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
221 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
222 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
223 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.52
Rhizosphere 97.87
Stem 0
Stem Tuber 0
Unclassified 35.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100042602 3300006914 Unclassified 3131
2 SwRhRL2b_contig_253769 2162886007 Bacteria 952
3 JGI24751J29686_10000072 3300002459 Bacteria 57601
4 JGI25406J46586_10009749 3300003203 Bacteria 4292
5 Ga0065704_10013010 3300005289 Unclassified 2263
6 Ga0065704_10444225 3300005289 Bacteria 711
7 Ga0065712_10003437 3300005290 Bacteria 3730
8 Ga0065712_10284616 3300005290 Bacteria 889
9 Ga0065712_10330244 3300005290 Unclassified 815
10 Ga0065715_10009108 3300005293 Bacteria 3663
11 Ga0065715_10120299 3300005293 Bacteria 2246
12 Ga0065715_10186292 3300005293 Bacteria 1443
13 Ga0065715_10306279 3300005293 Bacteria 1030
14 Ga0065715_10744005 3300005293 Unclassified 633
15 Ga0065707_10003402 3300005295 Bacteria 4069
16 Ga0065707_10105616 3300005295 Bacteria 2636
17 Ga0065707_10110421 3300005295 Bacteria 2409
18 Ga0065707_10124146 3300005295 Bacteria 2050
19 Ga0065707_10173269 3300005295 Bacteria 1469
20 Ga0065707_10726892 3300005295 Bacteria 628
21 Ga0070683_101338585 3300005329 Unclassified 688
22 Ga0070690_100260462 3300005330 Bacteria 1230
23 Ga0070670_100000378 3300005331 Bacteria 37152
24 Ga0070670_100006919 3300005331 Bacteria 9614
25 Ga0070670_100050468 3300005331 Bacteria 3575
26 Ga0070670_100205383 3300005331 Bacteria 1712
27 Ga0070670_100277954 3300005331 Bacteria 1462
28 Ga0068869_100006487 3300005334 Bacteria 7425
29 Ga0068869_100008499 3300005334 Bacteria 6623
30 Ga0068869_100009250 3300005334 Bacteria 6386
31 Ga0068869_100022455 3300005334 Unclassified 4348
32 Ga0068869_100106041 3300005334 Bacteria 2132
33 Ga0068869_100121807 3300005334 Unclassified 1996
34 Ga0068869_100368044 3300005334 Bacteria 1175
35 Ga0068869_100404139 3300005334 Bacteria 1124
36 Ga0068869_100846408 3300005334 Bacteria 789
37 Ga0070666_10029860 3300005335 Unclassified 3587
38 Ga0070680_100005191 3300005336 Bacteria 9858
39 Ga0070680_100104416 3300005336 Bacteria 2355
40 Ga0070682_100000229 3300005337 Bacteria 40502
41 Ga0070682_100043603 3300005337 Bacteria 2775
42 Ga0068868_101121237 3300005338 Unclassified 724
43 Ga0068868_101258588 3300005338 Unclassified 686
44 Ga0070689_100054724 3300005340 Unclassified 3090
45 Ga0070689_100086392 3300005340 Bacteria 2467
46 Ga0070689_100286184 3300005340 Bacteria 1368
47 Ga0070689_101585640 3300005340 Bacteria 594
48 Ga0070689_101771574 3300005340 Unclassified 563
49 Ga0070687_100096711 3300005343 Bacteria 1644
50 Ga0070687_100733564 3300005343 Unclassified 693
51 Ga0070661_100582031 3300005344 Unclassified 903
52 Ga0070661_100621823 3300005344 Unclassified 875
53 Ga0070692_10247844 3300005345 Bacteria 1065
54 Ga0070692_10498436 3300005345 Bacteria 789
55 Ga0070692_10559664 3300005345 Unclassified 750
56 Ga0070669_100001852 3300005353 Bacteria 15226
57 Ga0070669_100448860 3300005353 Bacteria 1063
58 Ga0070669_100794548 3300005353 Unclassified 804
59 Ga0070675_100177619 3300005354 Unclassified 1839
60 Ga0070675_100531109 3300005354 Bacteria 1062
61 Ga0070675_100648442 3300005354 Unclassified 959
62 Ga0070671_100003545 3300005355 Bacteria 12193
63 Ga0070671_100020914 3300005355 Bacteria 5338
64 Ga0070671_100336969 3300005355 Unclassified 1286
65 Ga0070674_100263912 3300005356 Bacteria 1358
66 Ga0070673_100039622 3300005364 Bacteria 3608
67 Ga0070673_100094180 3300005364 Bacteria 2454
68 Ga0070673_100156222 3300005364 Unclassified 1936
69 Ga0070673_100191576 3300005364 Bacteria 1757
70 Ga0070673_100232980 3300005364 Bacteria 1598
71 Ga0070673_101945902 3300005364 Unclassified 558
72 Ga0070673_101973364 3300005364 Bacteria 554
73 Ga0070688_100301793 3300005365 Bacteria 1158
74 Ga0070688_100407220 3300005365 Bacteria 1008
75 Ga0070667_100041990 3300005367 Bacteria 3836
76 Ga0070667_100317753 3300005367 Bacteria 1405
77 Ga0070701_10092833 3300005438 Bacteria 1657
78 Ga0070701_10113293 3300005438 Bacteria 1518
79 Ga0070711_100000018 3300005439 Bacteria 151538
80 Ga0070705_100109534 3300005440 Bacteria 1761
81 Ga0070705_100220929 3300005440 Bacteria 1312
82 Ga0070705_100528856 3300005440 Bacteria 900
83 Ga0070705_100875015 3300005440 Unclassified 721
84 Ga0070705_100927059 3300005440 Unclassified 702
85 Ga0070700_100000223 3300005441 Bacteria 31575
86 Ga0070700_100011498 3300005441 Bacteria 4905
87 Ga0070700_100279078 3300005441 Bacteria 1211
88 Ga0070700_100282158 3300005441 Bacteria 1205
89 Ga0070700_100309102 3300005441 Unclassified 1157
90 Ga0070700_100927029 3300005441 Unclassified 711
91 Ga0070694_100062364 3300005444 Bacteria 2547
92 Ga0070694_100063533 3300005444 Archaea 2525
93 Ga0070694_100063903 3300005444 Bacteria 2518
94 Ga0070694_100700918 3300005444 Unclassified 823
95 Ga0070708_100012767 3300005445 Bacteria 6862
96 Ga0070708_100590027 3300005445 Bacteria 1047
97 Ga0070708_100673576 3300005445 Bacteria 974
98 Ga0070708_100805586 3300005445 Bacteria 883
99 Ga0070708_100880497 3300005445 Unclassified 841
100 Ga0070663_100738828 3300005455 Unclassified 839
101 Ga0070678_100261361 3300005456 Bacteria 1456
102 Ga0070678_100397651 3300005456 Unclassified 1196
103 Ga0070678_100687899 3300005456 Bacteria 920
104 Ga0070662_100087972 3300005457 Archaea 2327
105 Ga0070681_10013450 3300005458 Bacteria 8131
106 Ga0068867_100050567 3300005459 Bacteria 3064
107 Ga0068867_100149888 3300005459 Unclassified 1831
108 Ga0068867_100333820 3300005459 Bacteria 1260
109 Ga0068867_100406822 3300005459 Unclassified 1149
110 Ga0070706_100000002 3300005467 Bacteria 326510
111 Ga0070706_100029638 3300005467 Bacteria 5041
112 Ga0070706_100108965 3300005467 Bacteria 2577
113 Ga0070706_100703247 3300005467 Bacteria 937
114 Ga0070707_100061158 3300005468 Unclassified 3611
115 Ga0070707_100209917 3300005468 Bacteria 1898
116 Ga0070707_100395591 3300005468 Bacteria 1342
117 Ga0070707_100957991 3300005468 Bacteria 821
118 Ga0070698_100001939 3300005471 Bacteria 22993
119 Ga0070698_100002484 3300005471 Bacteria 20319
120 Ga0070698_100009846 3300005471 Bacteria 10217
121 Ga0070698_100011302 3300005471 Bacteria 9478
122 Ga0070699_100016122 3300005518 Bacteria 6414
123 Ga0070699_100038628 3300005518 Bacteria 4133
124 Ga0070699_100137961 3300005518 Unclassified 2152
125 Ga0070699_100746156 3300005518 Bacteria 895
126 Ga0070699_101015325 3300005518 Unclassified 761
127 Ga0070699_101520676 3300005518 Bacteria 613
128 Ga0070679_100000029 3300005530 Bacteria 108401
129 Ga0070679_100479663 3300005530 Bacteria 1188
130 Ga0070679_100611706 3300005530 Bacteria 1033
131 Ga0070684_101557755 3300005535 Bacteria 623
132 Ga0070697_100033569 3300005536 Bacteria 4134
133 Ga0070697_100045822 3300005536 Bacteria 3544
134 Ga0070697_100228980 3300005536 Bacteria 1585
135 Ga0070697_100669356 3300005536 Bacteria 915
136 Ga0070697_100701021 3300005536 Bacteria 893
137 Ga0070697_100774184 3300005536 Bacteria 848
138 Ga0068853_100018281 3300005539 Bacteria 5800
139 Ga0070672_100202676 3300005543 Bacteria 1660
140 Ga0070672_100659830 3300005543 Bacteria 914
141 Ga0070686_100092784 3300005544 Bacteria 2023
142 Ga0070695_100069264 3300005545 Bacteria 2305
143 Ga0070695_100078703 3300005545 Bacteria 2174
144 Ga0070695_101640091 3300005545 Unclassified 537
145 Ga0070696_100059152 3300005546 Bacteria 2677
146 Ga0070696_100121128 3300005546 Bacteria 1894
147 Ga0070696_100195512 3300005546 Archaea 1507
148 Ga0070696_100561958 3300005546 Unclassified 915
149 Ga0070696_100764634 3300005546 Unclassified 793
150 Ga0070696_100907558 3300005546 Bacteria 731
151 Ga0070693_100021492 3300005547 Bacteria 3419
152 Ga0070693_100214061 3300005547 Bacteria 1259
153 Ga0070665_100318737 3300005548 Bacteria 1559
154 Ga0070704_100113394 3300005549 Unclassified 2067
155 Ga0070704_100120292 3300005549 Bacteria 2016
156 Ga0070704_100403034 3300005549 Bacteria 1168
157 Ga0070704_100742905 3300005549 Bacteria 873
158 Ga0070704_101021074 3300005549 Unclassified 749
159 Ga0070664_101004609 3300005564 Unclassified 784
160 Ga0070664_101057142 3300005564 Bacteria 764
161 Ga0070664_101239369 3300005564 Unclassified 704
162 Ga0068857_100063417 3300005577 Bacteria 3285
163 Ga0068857_101342841 3300005577 Unclassified 695
164 Ga0068854_100095643 3300005578 Unclassified 2218
165 Ga0068854_100199337 3300005578 Unclassified 1573
166 Ga0068854_100390476 3300005578 Bacteria 1149
167 Ga0068854_100696034 3300005578 Bacteria 877
168 Ga0068854_100720885 3300005578 Bacteria 863
169 Ga0070702_100114048 3300005615 Unclassified 1681
170 Ga0070702_100157036 3300005615 Unclassified 1466
171 Ga0070702_100286700 3300005615 Bacteria 1133
172 Ga0070702_100456048 3300005615 Unclassified 929
173 Ga0070702_100490753 3300005615 Unclassified 900
174 Ga0070702_100907944 3300005615 Unclassified 690
175 Ga0068852_101916410 3300005616 Unclassified 615
176 Ga0068859_100005853 3300005617 Bacteria 12478
177 Ga0068859_100025443 3300005617 Bacteria 5937
178 Ga0068859_100073538 3300005617 Bacteria 3456
179 Ga0068859_100224523 3300005617 Bacteria 1966
180 Ga0068859_100264648 3300005617 Unclassified 1811
181 Ga0068859_100343259 3300005617 Bacteria 1587
182 Ga0068859_100733452 3300005617 Bacteria 1078
183 Ga0068859_100820816 3300005617 Bacteria 1017
184 Ga0068859_101440861 3300005617 Unclassified 760
185 Ga0068859_102436815 3300005617 Unclassified 576
186 Ga0068864_100048594 3300005618 Unclassified 3648
187 Ga0068864_100050959 3300005618 Unclassified 3564
188 Ga0068864_100402717 3300005618 Unclassified 1301
189 Ga0068864_101149841 3300005618 Unclassified 774
190 Ga0068864_101429341 3300005618 Unclassified 694
191 Ga0068866_10067063 3300005718 Bacteria 1882
192 Ga0068861_100018260 3300005719 Bacteria 4994
193 Ga0068861_100078600 3300005719 Bacteria 2577
194 Ga0068861_100164558 3300005719 Bacteria 1833
195 Ga0068861_100642464 3300005719 Bacteria 979
196 Ga0068861_101539528 3300005719 Bacteria 653
197 Ga0068870_10011960 3300005840 Bacteria 4041
198 Ga0068870_10027268 3300005840 Unclassified 2855
199 Ga0068870_10080177 3300005840 Bacteria 1803
200 Ga0068870_11294692 3300005840 Bacteria 531
201 Ga0068863_100114378 3300005841 Bacteria 2571
202 Ga0068863_100132062 3300005841 Bacteria 2384
203 Ga0068863_100277079 3300005841 Bacteria 1624
204 Ga0068863_100277650 3300005841 Unclassified 1623
205 Ga0068863_100352803 3300005841 Bacteria 1433
206 Ga0068863_100505577 3300005841 Unclassified 1190
207 Ga0068863_100665634 3300005841 Bacteria 1033
208 Ga0068863_100827137 3300005841 Bacteria 924
209 Ga0068863_101132561 3300005841 Unclassified 787
210 Ga0068858_100158510 3300005842 Bacteria 2130
211 Ga0068858_100163453 3300005842 Bacteria 2097
212 Ga0068858_100548067 3300005842 Bacteria 1119
213 Ga0068860_100007073 3300005843 Bacteria 11232
214 Ga0068860_100012402 3300005843 Bacteria 8398
215 Ga0068860_100041100 3300005843 Bacteria 4417
216 Ga0068860_100050950 3300005843 Bacteria 3940
217 Ga0068860_100054771 3300005843 Bacteria 3791
218 Ga0068860_100121275 3300005843 Bacteria 2503
219 Ga0068860_100282855 3300005843 Bacteria 1621
220 Ga0068860_100745854 3300005843 Unclassified 990
221 Ga0068860_101612573 3300005843 Unclassified 671
222 Ga0068860_102793849 3300005843 Unclassified 506
223 Ga0068862_100071803 3300005844 Bacteria 2989
224 Ga0068862_100148120 3300005844 Bacteria 2088
225 Ga0068862_100226424 3300005844 Bacteria 1695
226 Ga0068862_100824199 3300005844 Unclassified 907
227 Ga0068862_101044967 3300005844 Unclassified 810
228 Ga0068862_101325064 3300005844 Unclassified 722
229 Ga0081539_10000912 3300005985 Bacteria 55918
230 Ga0081539_10143113 3300005985 Unclassified 1159
231 Ga0068871_100038931 3300006358 Bacteria 3801
232 Ga0068871_100097864 3300006358 Bacteria 2453
233 Ga0068871_100188740 3300006358 Bacteria 1774
234 Ga0075431_100115212 3300006847 Bacteria 2774
235 Ga0075431_100416015 3300006847 Bacteria 1344
236 Ga0075433_10016560 3300006852 Bacteria 6081
237 Ga0075433_10197931 3300006852 Bacteria 1787
238 Ga0075433_10288505 3300006852 Bacteria 1453
239 Ga0075433_10338622 3300006852 Bacteria 1330
240 Ga0075433_11364720 3300006852 Unclassified 613
241 Ga0075433_11457995 3300006852 Unclassified 591
242 Ga0075434_100115925 3300006871 Bacteria 2692
243 Ga0075434_100510606 3300006871 Unclassified 1222
244 Ga0075434_100640791 3300006871 Bacteria 1081
245 Ga0068865_100178539 3300006881 Bacteria 1633
246 Ga0068865_100357583 3300006881 Bacteria 1185
247 Ga0068865_101149013 3300006881 Unclassified 686
248 Ga0075436_100005547 3300006914 Bacteria 8670
249 Ga0075436_100671113 3300006914 Unclassified 767
250 Ga0097620_100005853 3300006931 Bacteria 12478
251 Ga0097620_100025440 3300006931 Bacteria 5937
252 Ga0097620_100073551 3300006931 Bacteria 3456
253 Ga0097620_100224510 3300006931 Bacteria 1966
254 Ga0097620_100264655 3300006931 Unclassified 1811
255 Ga0097620_100343263 3300006931 Bacteria 1587
256 Ga0097620_100733417 3300006931 Bacteria 1078
257 Ga0097620_100820843 3300006931 Bacteria 1017
258 Ga0097620_101440858 3300006931 Unclassified 760
259 Ga0097620_102436784 3300006931 Unclassified 576
260 Ga0075435_100063830 3300007076 Bacteria 2991
261 Ga0075435_100556704 3300007076 Unclassified 993
262 Ga0105251_10024716 3300009011 Bacteria 3082
263 Ga0105250_10417425 3300009092 Unclassified 597
264 Ga0105240_10189102 3300009093 Unclassified 2422
265 Ga0105240_10434932 3300009093 Unclassified 1471
266 Ga0105240_11061072 3300009093 Unclassified 864
267 Ga0105240_11310083 3300009093 Unclassified 764
268 Ga0111539_10067473 3300009094 Bacteria 4224
269 Ga0111539_10109309 3300009094 Bacteria 3245
270 Ga0111539_10112489 3300009094 Unclassified 3194
271 Ga0111539_10667665 3300009094 Bacteria 1210
272 Ga0105245_10328429 3300009098 Bacteria 1509
273 Ga0105245_10366279 3300009098 Bacteria 1432
274 Ga0105245_11295134 3300009098 Bacteria 778
275 Ga0105245_11808799 3300009098 Unclassified 664
276 Ga0105247_10027299 3300009101 Bacteria 3453
277 Ga0105247_10039747 3300009101 Unclassified 2874
278 Ga0105247_11021656 3300009101 Bacteria 647
279 Ga0114129_10011179 3300009147 Bacteria 12798
280 Ga0114129_10115281 3300009147 Bacteria 3704
281 Ga0114129_10150962 3300009147 Bacteria 3180
282 Ga0114129_10219417 3300009147 Bacteria 2566
283 Ga0114129_10795383 3300009147 Bacteria 1207
284 Ga0114129_11457611 3300009147 Bacteria 843
285 Ga0114129_11644160 3300009147 Bacteria 785
286 Ga0114129_11793804 3300009147 Bacteria 746
287 Ga0114129_12471433 3300009147 Unclassified 621
288 Ga0105243_10022433 3300009148 Bacteria 4798
289 Ga0105243_10031998 3300009148 Bacteria 4059
290 Ga0105243_10247920 3300009148 Unclassified 1588
291 Ga0105243_10409987 3300009148 Unclassified 1261
292 Ga0105243_10951521 3300009148 Bacteria 858
293 Ga0105243_11633323 3300009148 Bacteria 672
294 Ga0105243_11850411 3300009148 Unclassified 636
295 Ga0105241_10385353 3300009174 Bacteria 1226
296 Ga0105241_10413477 3300009174 Bacteria 1186
297 Ga0105241_10583859 3300009174 Unclassified 1007
298 Ga0105241_10937323 3300009174 Bacteria 806
299 Ga0105241_11441801 3300009174 Bacteria 661
300 Ga0105241_11743087 3300009174 Unclassified 606
301 Ga0105242_11173844 3300009176 Unclassified 786
302 Ga0105242_12026724 3300009176 Unclassified 618
303 Ga0105242_12876862 3300009176 Unclassified 532
304 Ga0105248_10010902 3300009177 Bacteria 10029
305 Ga0105248_10013305 3300009177 Bacteria 9056
306 Ga0105248_10113118 3300009177 Bacteria 3061
307 Ga0105248_10131978 3300009177 Unclassified 2818
308 Ga0105248_10221242 3300009177 Bacteria 2131
309 Ga0105248_10223245 3300009177 Bacteria 2121
310 Ga0105248_10461037 3300009177 Unclassified 1433
311 Ga0105248_10543946 3300009177 Bacteria 1310
312 Ga0105248_11266857 3300009177 Bacteria 834
313 Ga0105248_12211346 3300009177 Unclassified 626
314 Ga0105248_13009289 3300009177 Unclassified 537
315 Ga0105237_10027024 3300009545 Bacteria 5861
316 Ga0105237_10070127 3300009545 Bacteria 3500
317 Ga0105238_10012356 3300009551 Bacteria 8612
318 Ga0105238_10324300 3300009551 Bacteria 1526
319 Ga0105249_10039835 3300009553 Bacteria 4266
320 Ga0105249_10075053 3300009553 Unclassified 3131
321 Ga0105249_10137681 3300009553 Bacteria 2338
322 Ga0105249_10237079 3300009553 Bacteria 1802
323 Ga0105249_10612017 3300009553 Bacteria 1145
324 Ga0105239_10316915 3300010375 Bacteria 1758
325 Ga0105239_10643446 3300010375 Unclassified 1211
326 Ga0105239_11436751 3300010375 Unclassified 797
327 Ga0105239_11972903 3300010375 Bacteria 677
328 Ga0105246_10010133 3300011119 Bacteria 5820
329 Ga0105246_10244116 3300011119 Bacteria 1421
330 Ga0105246_10391409 3300011119 Unclassified 1151
331 Ga0105246_10559148 3300011119 Unclassified 982
332 Ga0105246_10583440 3300011119 Unclassified 963
333 Ga0105246_10615936 3300011119 Bacteria 940
334 Ga0105246_10844704 3300011119 Unclassified 816
335 Ga0105246_11924287 3300011119 Unclassified 568
336 Ga0157373_10188025 3300013100 Unclassified 1455
337 Ga0157373_10216775 3300013100 Bacteria 1350
338 Ga0157371_11008976 3300013102 Unclassified 635
339 Ga0157374_10012167 3300013296 Bacteria 7476
340 Ga0157374_10082527 3300013296 Unclassified 3052
341 Ga0157374_11946591 3300013296 Unclassified 614
342 Ga0157378_10003821 3300013297 Bacteria 13320
343 Ga0157378_10037314 3300013297 Unclassified 4303
344 Ga0157378_10592514 3300013297 Unclassified 1119
345 Ga0157378_11046487 3300013297 Bacteria 852
346 Ga0157378_11280189 3300013297 Unclassified 774
347 Ga0157378_11460661 3300013297 Unclassified 728
348 Ga0163162_10001550 3300013306 Bacteria 21473
349 Ga0163162_10072636 3300013306 Unclassified 3495
350 Ga0163162_10329250 3300013306 Unclassified 1660
351 Ga0163162_10380487 3300013306 Bacteria 1545
352 Ga0163162_10409994 3300013306 Unclassified 1488
353 Ga0163162_11129095 3300013306 Bacteria 888
354 Ga0163162_12173706 3300013306 Bacteria 637
355 Ga0163162_12528422 3300013306 Unclassified 591
356 Ga0157372_11289716 3300013307 Bacteria 843
357 Ga0157375_10048503 3300013308 Bacteria 4155
358 Ga0157375_10193960 3300013308 Bacteria 2186
359 Ga0157375_11596752 3300013308 Unclassified 771
360 Ga0157375_12285226 3300013308 Unclassified 645
361 Ga0157375_13192588 3300013308 Bacteria 547
362 Ga0163163_10001302 3300014325 Bacteria 21073
363 Ga0163163_10017555 3300014325 Bacteria 6678
364 Ga0163163_10077493 3300014325 Bacteria 3319
365 Ga0163163_10179088 3300014325 Bacteria 2167
366 Ga0163163_10233731 3300014325 Bacteria 1888
367 Ga0163163_10672100 3300014325 Bacteria 1099
368 Ga0163163_12446019 3300014325 Bacteria 580
369 Ga0157380_10013222 3300014326 Bacteria 6012
370 Ga0157380_10166747 3300014326 Archaea 1920
371 Ga0157380_10397372 3300014326 Unclassified 1306
372 Ga0157380_10413678 3300014326 Unclassified 1284
373 Ga0157380_11224153 3300014326 Bacteria 795
374 Ga0157380_12067108 3300014326 Unclassified 632
375 Ga0157377_10036680 3300014745 Unclassified 2698
376 Ga0157377_10224049 3300014745 Bacteria 1205
377 Ga0157377_10514961 3300014745 Unclassified 839
378 Ga0157379_10300657 3300014968 Unclassified 1462
379 Ga0157379_10462830 3300014968 Bacteria 1172
380 Ga0157376_10012816 3300014969 Bacteria 6235
381 Ga0157376_10065014 3300014969 Bacteria 3078
382 Ga0157376_10418640 3300014969 Bacteria 1299
383 Ga0157376_10566336 3300014969 Unclassified 1126
384 Ga0163161_10282686 3300017792 Unclassified 1302
385 Ga0213875_10006350 3300021388 Bacteria 6221
386 Ga0213875_10067365 3300021388 Bacteria 1672
387 Ga0207713_1185001 3300025735 Unclassified 648
388 Ga0207642_10011794 3300025899 Bacteria 3131
389 Ga0207710_10006766 3300025900 Bacteria 4885
390 Ga0207688_10541543 3300025901 Unclassified 731
391 Ga0207688_10773398 3300025901 Unclassified 608
392 Ga0207680_10118491 3300025903 Unclassified 1728
393 Ga0207647_10386533 3300025904 Bacteria 790
394 Ga0207645_10622146 3300025907 Unclassified 733
395 Ga0207643_10007637 3300025908 Bacteria 5811
396 Ga0207643_10014691 3300025908 Bacteria 4257
397 Ga0207643_10222325 3300025908 Bacteria 1156
398 Ga0207643_10438256 3300025908 Bacteria 830
399 Ga0207684_10000076 3300025910 Bacteria 183107
400 Ga0207684_10023397 3300025910 Bacteria 5275
401 Ga0207684_10142649 3300025910 Bacteria 2060
402 Ga0207684_10147768 3300025910 Bacteria 2022
403 Ga0207654_10132925 3300025911 Unclassified 1577
404 Ga0207654_11093318 3300025911 Bacteria 581
405 Ga0207707_10000060 3300025912 Bacteria 108561
406 Ga0207707_10191405 3300025912 Bacteria 1785
407 Ga0207671_10202580 3300025914 Unclassified 1550
408 Ga0207671_11094092 3300025914 Unclassified 626
409 Ga0207663_10000001 3300025916 Bacteria 591990
410 Ga0207663_10000019 3300025916 Bacteria 139174
411 Ga0207660_10003245 3300025917 Bacteria 10651
412 Ga0207662_10013704 3300025918 Bacteria 4537
413 Ga0207662_10721698 3300025918 Unclassified 699
414 Ga0207649_10507027 3300025920 Unclassified 918
415 Ga0207652_10000073 3300025921 Bacteria 108588
416 Ga0207652_10169798 3300025921 Bacteria 1957
417 Ga0207646_10075800 3300025922 Unclassified 3005
418 Ga0207646_10325183 3300025922 Unclassified 1389
419 Ga0207646_10635777 3300025922 Bacteria 957
420 Ga0207681_10001454 3300025923 Bacteria 15245
421 Ga0207681_10433746 3300025923 Unclassified 1066
422 Ga0207694_10052688 3300025924 Unclassified 3154
423 Ga0207694_10065044 3300025924 Bacteria 2843
424 Ga0207650_10000588 3300025925 Bacteria 29190
425 Ga0207650_10043394 3300025925 Bacteria 3301
426 Ga0207650_10233300 3300025925 Bacteria 1485
427 Ga0207650_11201387 3300025925 Bacteria 646
428 Ga0207659_10180693 3300025926 Bacteria 1671
429 Ga0207687_10087444 3300025927 Bacteria 2265
430 Ga0207644_10009583 3300025931 Bacteria 6359
431 Ga0207644_10134240 3300025931 Unclassified 1899
432 Ga0207706_10158844 3300025933 Bacteria 1988
433 Ga0207686_10091187 3300025934 Bacteria 2012
434 Ga0207686_10596139 3300025934 Bacteria 869
435 Ga0207686_10620348 3300025934 Unclassified 853
436 Ga0207709_10002017 3300025935 Bacteria 13174
437 Ga0207709_11038153 3300025935 Bacteria 671
438 Ga0207670_10001405 3300025936 Bacteria 12668
439 Ga0207670_10573363 3300025936 Bacteria 924
440 Ga0207670_11699361 3300025936 Unclassified 537
441 Ga0207669_10162232 3300025937 Bacteria 1580
442 Ga0207669_10393270 3300025937 Unclassified 1084
443 Ga0207704_10332641 3300025938 Bacteria 1176
444 Ga0207704_10362783 3300025938 Bacteria 1132
445 Ga0207704_10684779 3300025938 Unclassified 847
446 Ga0207691_10001642 3300025940 Bacteria 22184
447 Ga0207691_10613713 3300025940 Bacteria 920
448 Ga0207691_10981578 3300025940 Unclassified 705
449 Ga0207711_10038489 3300025941 Bacteria 4068
450 Ga0207711_10045603 3300025941 Bacteria 3746
451 Ga0207711_10101416 3300025941 Unclassified 2547
452 Ga0207711_11311208 3300025941 Unclassified 666
453 Ga0207711_11777454 3300025941 Bacteria 560
454 Ga0207689_10001535 3300025942 Bacteria 21980
455 Ga0207689_10051326 3300025942 Bacteria 3400
456 Ga0207689_10078074 3300025942 Bacteria 2721
457 Ga0207689_10130401 3300025942 Unclassified 2069
458 Ga0207689_10379877 3300025942 Unclassified 1176
459 Ga0207689_10406135 3300025942 Unclassified 1136
460 Ga0207679_10095351 3300025945 Bacteria 2313
461 Ga0207679_10109725 3300025945 Unclassified 2175
462 Ga0207679_10499341 3300025945 Unclassified 1085
463 Ga0207679_11291626 3300025945 Unclassified 670
464 Ga0207651_10024481 3300025960 Bacteria 3735
465 Ga0207651_10034804 3300025960 Bacteria 3267
466 Ga0207651_10118325 3300025960 Unclassified 2004
467 Ga0207651_10163655 3300025960 Bacteria 1747
468 Ga0207651_11070776 3300025960 Bacteria 722
469 Ga0207651_11206618 3300025960 Bacteria 679
470 Ga0207651_11298351 3300025960 Unclassified 654
471 Ga0207651_11879210 3300025960 Unclassified 539
472 Ga0207651_12085932 3300025960 Unclassified 509
473 Ga0207712_10016068 3300025961 Unclassified 4839
474 Ga0207712_10021758 3300025961 Bacteria 4214
475 Ga0207712_10119906 3300025961 Bacteria 1988
476 Ga0207712_10402426 3300025961 Bacteria 1151
477 Ga0207640_10138974 3300025981 Archaea 1768
478 Ga0207640_10153500 3300025981 Unclassified 1695
479 Ga0207640_10462908 3300025981 Bacteria 1048
480 Ga0207640_10519957 3300025981 Unclassified 994
481 Ga0207640_10521991 3300025981 Bacteria 993
482 Ga0207640_10790579 3300025981 Bacteria 821
483 Ga0207640_11174048 3300025981 Bacteria 682
484 Ga0207658_10023410 3300025986 Bacteria 4311
485 Ga0207658_10690132 3300025986 Unclassified 922
486 Ga0207677_10681700 3300026023 Bacteria 910
487 Ga0207703_10089954 3300026035 Bacteria 2579
488 Ga0207703_10138151 3300026035 Bacteria 2112
489 Ga0207703_10242587 3300026035 Bacteria 1620
490 Ga0207639_10646182 3300026041 Bacteria 978
491 Ga0207708_10000028 3300026075 Bacteria 164263
492 Ga0207708_10013512 3300026075 Bacteria 6105
493 Ga0207708_10034648 3300026075 Unclassified 3841
494 Ga0207708_10466147 3300026075 Unclassified 1054
495 Ga0207708_11026673 3300026075 Bacteria 717
496 Ga0207708_11465787 3300026075 Bacteria 599
497 Ga0207702_10334588 3300026078 Unclassified 1445
498 Ga0207641_10017784 3300026088 Bacteria 5824
499 Ga0207641_10044649 3300026088 Unclassified 3728
500 Ga0207641_10189841 3300026088 Bacteria 1888
501 Ga0207641_10541829 3300026088 Bacteria 1134
502 Ga0207641_11374511 3300026088 Unclassified 707
503 Ga0207648_10039258 3300026089 Bacteria 4163
504 Ga0207648_10065505 3300026089 Bacteria 3167
505 Ga0207648_11088929 3300026089 Unclassified 749
506 Ga0207676_10057348 3300026095 Bacteria 3066
507 Ga0207676_10146987 3300026095 Unclassified 2025
508 Ga0207676_10197262 3300026095 Bacteria 1776
509 Ga0207676_10205340 3300026095 Bacteria 1744
510 Ga0207676_10370585 3300026095 Bacteria 1330
511 Ga0207676_10404396 3300026095 Unclassified 1277
512 Ga0207676_11417761 3300026095 Bacteria 691
513 Ga0207674_10059661 3300026116 Bacteria 3860
514 Ga0207674_10135485 3300026116 Bacteria 2425
515 Ga0207674_10137381 3300026116 Unclassified 2405
516 Ga0207674_10658675 3300026116 Unclassified 1011
517 Ga0207674_10758420 3300026116 Unclassified 937
518 Ga0207674_10775777 3300026116 Bacteria 925
519 Ga0207674_11338270 3300026116 Unclassified 686
520 Ga0207675_100009834 3300026118 Bacteria 8948
521 Ga0207675_100138852 3300026118 Bacteria 2308
522 Ga0207675_100156451 3300026118 Unclassified 2172
523 Ga0207675_100195152 3300026118 Unclassified 1943
524 Ga0207675_100373827 3300026118 Archaea 1400
525 Ga0207683_10012689 3300026121 Bacteria 7187
526 Ga0207683_10227985 3300026121 Archaea 1698
527 Ga0207683_10433478 3300026121 Unclassified 1211
528 Ga0207683_10472263 3300026121 Bacteria 1157
529 Ga0207698_10316495 3300026142 Bacteria 1460
530 Ga0207698_11312343 3300026142 Unclassified 738
531 Ga0207428_10012443 3300027907 Bacteria 7476
532 Ga0207428_10938567 3300027907 Unclassified 610
533 Ga0268266_10276465 3300028379 Bacteria 1560
534 Ga0268265_10090435 3300028380 Archaea 2445
535 Ga0268265_10134143 3300028380 Bacteria 2063
536 Ga0268265_10153883 3300028380 Bacteria 1943
537 Ga0268265_11366294 3300028380 Unclassified 710
538 Ga0268265_11964999 3300028380 Bacteria 592
539 Ga0268264_10025811 3300028381 Unclassified 4798
540 Ga0268264_10034464 3300028381 Bacteria 4164
541 Ga0268264_10075570 3300028381 Bacteria 2865
542 Ga0268264_10116727 3300028381 Bacteria 2346
543 Ga0268264_10199288 3300028381 Bacteria 1830
544 Ga0268264_10374267 3300028381 Bacteria 1362
545 Ga0268264_10963845 3300028381 Unclassified 858
546 Ga0265760_10000040 3300031090 Bacteria 38912
547 Ga0307408_100398067 3300031548 Unclassified 1182
548 Ga0307405_11394948 3300031731 Unclassified 612
549 Ga0307413_10041999 3300031824 Bacteria 2683
550 Ga0307406_10016790 3300031901 Bacteria 4258
551 Ga0307407_10347598 3300031903 Unclassified 1049
552 Ga0307412_10053499 3300031911 Bacteria 2676
553 Ga0307409_100207025 3300031995 Unclassified 1760
554 Ga0307409_100437704 3300031995 Bacteria 1259
555 Ga0307409_101051410 3300031995 Bacteria 834
556 Ga0307409_102871901 3300031995 Unclassified 509
557 Ga0307416_100053034 3300032002 Bacteria 3251
558 Ga0307414_10027654 3300032004 Bacteria 3668
559 Ga0307414_10526381 3300032004 Bacteria 1050
560 Ga0307411_10029236 3300032005 Bacteria 3362
561 Ga0307411_10413119 3300032005 Bacteria 1119
562 Ga0307415_100031343 3300032126 Bacteria 3424
563 Ga0307415_101159862 3300032126 Unclassified 726
564 Ga0373941_0200656 3300035115 Unclassified 758
565 Ga0373954_0625554 3300035118 Unclassified 534
566 Ga0373931_0412685 3300035691 Unclassified 857
567 Ga0395899_0459922 3300037312 Unclassified 832
568 Ga0395900_0066855 3300037418 Bacteria 3694
569 Ga0395900_1038702 3300037418 Unclassified 738
570 Ga0395898_0413485 3300037466 Bacteria 1286
571 Ga0395898_0676435 3300037466 Unclassified 974
572 Ga0395898_1553681 3300037466 Unclassified 587
573 Ga0436364_0272415 3300037853 Bacteria 13475
574 Ga0436364_0689903 3300037853 Bacteria 3667
575 Ga0395901_0032839 3300038443 Bacteria 5355
576 Ga0395901_0338412 3300038443 Bacteria 1555
577 Ga0439431_0058312 3300041997 Bacteria 1012
578 Ga0451577_0241618 3300042876 Bacteria 1634
579 Ga0451577_1726041 3300042876 Unclassified 550
580 Ga0453683_0211827 3300044673 Unclassified 1231
581 Ga0451576_0001932 3300045051 Bacteria 33128
582 Ga0451576_0265419 3300045051 Bacteria 1795
583 Ga0451576_1313753 3300045051 Unclassified 754
584 Ga0495663_0000173 3300046525 Bacteria 26057
585 Ga0495665_0363569 3300046531 Bacteria 736
586 Ga0495598_0000534 3300046537 Bacteria 7077
587 Ga0495621_0148929 3300046539 Bacteria 919
588 Ga0495656_0664751 3300046615 Bacteria 560
589 Ga0495588_0478461 3300046674 Unclassified 653
590 Ga0495647_0351026 3300046681 Unclassified 671
591 Ga0496102_0546717 3300048905 Bacteria 1081
592 Ga0496102_1198822 3300048905 Unclassified 679
593 Ga0496103_0590273 3300048906 Unclassified 708
594 Ga0496104_0316432 3300048907 Unclassified 1474
595 Ga0496106_0364864 3300048909 Bacteria 1160
596 Ga0496110_0043761 3300048913 Unclassified 3910
597 Ga0496112_0087001 3300048915 Bacteria 3092
598 Ga0496112_0236882 3300048915 Bacteria 1779
599 Ga0496112_0823611 3300048915 Unclassified 852
600 Ga0496113_1498466 3300048916 Unclassified 521
601 Ga0501292_024871 3300049515 Unclassified 984
602 Ga0501292_077248 3300049515 Bacteria 628
603 Ga0501292_090740 3300049515 Unclassified 593
604 Ga0501297_005113 3300049520 Bacteria 1362
605 Ga0501298_003016 3300049521 Bacteria 2592
606 Ga0501299_006203 3300049522 Bacteria 1868
607 Ga0501198_008052 3300049649 Bacteria 1523
608 Ga0501207_001861 3300049654 Bacteria 2687
609 Ga0501208_027493 3300049655 Unclassified 982
610 Ga0501209_146047 3300049656 Bacteria 710
611 Ga0501216_013054 3300049660 Unclassified 1372
612 Ga0501217_001842 3300049661 Bacteria 4063
613 Ga0501223_004072 3300049663 Bacteria 3149
614 Ga0501227_002157 3300049665 Bacteria 4356
615 Ga0501227_006836 3300049665 Bacteria 2448
616 Ga0501227_036952 3300049665 Bacteria 1194
617 Ga0501233_001264 3300049668 Bacteria 4312
618 Ga0501235_088628 3300049669 Unclassified 745
619 Ga0501236_045397 3300049670 Unclassified 740
620 Ga0501243_061955 3300049675 Bacteria 695
621 Ga0501256_035492 3300049685 Unclassified 576
622 Ga0501221_074438 3300049704 Unclassified 807
623 Ga0501225_0117610 3300049705 Bacteria 788
624 Ga0501225_0180041 3300049705 Unclassified 660
625 Ga0501234_000343 3300049707 Bacteria 6882
626 Ga0501245_004830 3300049708 Bacteria 1857
627 Ga0501245_056159 3300049708 Unclassified 709
628 Ga0501079_1097387 3300049741 Unclassified 627
629 Ga0501262_018157 3300049759 Unclassified 943
630 Ga0501266_016644 3300049763 Unclassified 978
631 Ga0501272_026701 3300049769 Unclassified 717
632 Ga0501273_007095 3300049770 Unclassified 1312
633 Ga0501045_0868045 3300049824 Bacteria 663
634 Ga0501212_010771 3300049851 Unclassified 1309
635 nmdc:mga05p37_356674_c1 3300050507 Unclassified 1720
636 nmdc:mga05p37_647939_c1 3300050507 Bacteria 1183
637 nmdc:mga09592_423756_c1 3300050508 Unclassified 1149
638 nmdc:mga0qj67_150450_c1 3300050509 Bacteria 1888
639 nmdc:mga06r32_292209_c1 3300050510 Bacteria 1616
640 nmdc:mga08y16_197160_c1 3300050511 Bacteria 2087
641 nmdc:mga08y16_30076_c1 3300050511 Bacteria 5718
642 nmdc:mga08y16_4706_c1 3300050511 Bacteria 14226
643 nmdc:mga0n895_1001016_c1 3300050512 Bacteria 817
644 nmdc:mga0n895_576847_c1 3300050512 Bacteria 1129
645 nmdc:mga0n895_994692_c1 3300050512 Bacteria 820
646 nmdc:mga0rr50_293788_c1 3300050513 Bacteria 1358
647 nmdc:mga0rr50_965322_c1 3300050513 Unclassified 726
648 nmdc:mga08x19_32535_c1 3300050514 Bacteria 3288
649 nmdc:mga08x19_32_c1 3300050514 Bacteria 203770
650 nmdc:mga0a205_1103418_c1 3300050515 Unclassified 641
651 nmdc:mga0a205_1381132_c1 3300050515 Bacteria 552
652 nmdc:mga0a205_410229_c2 3300050515 Bacteria 675
653 nmdc:mga0a205_439486_c1 3300050515 Unclassified 1165
654 nmdc:mga0a205_494180_c1 3300050515 Bacteria 1081
655 nmdc:mga0a205_70187_c1 3300050515 Bacteria 3382
656 nmdc:mga0a205_75330_c1 3300050515 Bacteria 3261
657 Ga0495619_0414934 3300053085 Unclassified 929
658 Ga0530510_0042969 3300061734 Bacteria 3265
659 Ga0075436_100042602
660 SwRhRL2b_contig_253769
661 JGI24751J29686_10000072
662 JGI25406J46586_10009749
663 Ga0065704_10013010
664 Ga0065704_10444225
665 Ga0065712_10003437
666 Ga0065712_10284616
667 Ga0065712_10330244
668 Ga0065715_10009108
669 Ga0065715_10120299
670 Ga0065715_10186292
671 Ga0065715_10306279
672 Ga0065715_10744005
673 Ga0065707_10003402
674 Ga0065707_10105616
675 Ga0065707_10110421
676 Ga0065707_10124146
677 Ga0065707_10173269
678 Ga0065707_10726892
679 Ga0070683_101338585
680 Ga0070690_100260462
681 Ga0070670_100000378
682 Ga0070670_100006919
683 Ga0070670_100050468
684 Ga0070670_100205383
685 Ga0070670_100277954
686 Ga0068869_100006487
687 Ga0068869_100008499
688 Ga0068869_100009250
689 Ga0068869_100022455
690 Ga0068869_100106041
691 Ga0068869_100121807
692 Ga0068869_100368044
693 Ga0068869_100404139
694 Ga0068869_100846408
695 Ga0070666_10029860
696 Ga0070680_100005191
697 Ga0070680_100104416
698 Ga0070682_100000229
699 Ga0070682_100043603
700 Ga0068868_101121237
701 Ga0068868_101258588
702 Ga0070689_100054724
703 Ga0070689_100086392
704 Ga0070689_100286184
705 Ga0070689_101585640
706 Ga0070689_101771574
707 Ga0070687_100096711
708 Ga0070687_100733564
709 Ga0070661_100582031
710 Ga0070661_100621823
711 Ga0070692_10247844
712 Ga0070692_10498436
713 Ga0070692_10559664
714 Ga0070669_100001852
715 Ga0070669_100448860
716 Ga0070669_100794548
717 Ga0070675_100177619
718 Ga0070675_100531109
719 Ga0070675_100648442
720 Ga0070671_100003545
721 Ga0070671_100020914
722 Ga0070671_100336969
723 Ga0070674_100263912
724 Ga0070673_100039622
725 Ga0070673_100094180
726 Ga0070673_100156222
727 Ga0070673_100191576
728 Ga0070673_100232980
729 Ga0070673_101945902
730 Ga0070673_101973364
731 Ga0070688_100301793
732 Ga0070688_100407220
733 Ga0070667_100041990
734 Ga0070667_100317753
735 Ga0070701_10092833
736 Ga0070701_10113293
737 Ga0070711_100000018
738 Ga0070705_100109534
739 Ga0070705_100220929
740 Ga0070705_100528856
741 Ga0070705_100875015
742 Ga0070705_100927059
743 Ga0070700_100000223
744 Ga0070700_100011498
745 Ga0070700_100279078
746 Ga0070700_100282158
747 Ga0070700_100309102
748 Ga0070700_100927029
749 Ga0070694_100062364
750 Ga0070694_100063533
751 Ga0070694_100063903
752 Ga0070694_100700918
753 Ga0070708_100012767
754 Ga0070708_100590027
755 Ga0070708_100673576
756 Ga0070708_100805586
757 Ga0070708_100880497
758 Ga0070663_100738828
759 Ga0070678_100261361
760 Ga0070678_100397651
761 Ga0070678_100687899
762 Ga0070662_100087972
763 Ga0070681_10013450
764 Ga0068867_100050567
765 Ga0068867_100149888
766 Ga0068867_100333820
767 Ga0068867_100406822
768 Ga0070706_100000002
769 Ga0070706_100029638
770 Ga0070706_100108965
771 Ga0070706_100703247
772 Ga0070707_100061158
773 Ga0070707_100209917
774 Ga0070707_100395591
775 Ga0070707_100957991
776 Ga0070698_100001939
777 Ga0070698_100002484
778 Ga0070698_100009846
779 Ga0070698_100011302
780 Ga0070699_100016122
781 Ga0070699_100038628
782 Ga0070699_100137961
783 Ga0070699_100746156
784 Ga0070699_101015325
785 Ga0070699_101520676
786 Ga0070679_100000029
787 Ga0070679_100479663
788 Ga0070679_100611706
789 Ga0070684_101557755
790 Ga0070697_100033569
791 Ga0070697_100045822
792 Ga0070697_100228980
793 Ga0070697_100669356
794 Ga0070697_100701021
795 Ga0070697_100774184
796 Ga0068853_100018281
797 Ga0070672_100202676
798 Ga0070672_100659830
799 Ga0070686_100092784
800 Ga0070695_100069264
801 Ga0070695_100078703
802 Ga0070695_101640091
803 Ga0070696_100059152
804 Ga0070696_100121128
805 Ga0070696_100195512
806 Ga0070696_100561958
807 Ga0070696_100764634
808 Ga0070696_100907558
809 Ga0070693_100021492
810 Ga0070693_100214061
811 Ga0070665_100318737
812 Ga0070704_100113394
813 Ga0070704_100120292
814 Ga0070704_100403034
815 Ga0070704_100742905
816 Ga0070704_101021074
817 Ga0070664_101004609
818 Ga0070664_101057142
819 Ga0070664_101239369
820 Ga0068857_100063417
821 Ga0068857_101342841
822 Ga0068854_100095643
823 Ga0068854_100199337
824 Ga0068854_100390476
825 Ga0068854_100696034
826 Ga0068854_100720885
827 Ga0070702_100114048
828 Ga0070702_100157036
829 Ga0070702_100286700
830 Ga0070702_100456048
831 Ga0070702_100490753
832 Ga0070702_100907944
833 Ga0068852_101916410
834 Ga0068859_100005853
835 Ga0068859_100025443
836 Ga0068859_100073538
837 Ga0068859_100224523
838 Ga0068859_100264648
839 Ga0068859_100343259
840 Ga0068859_100733452
841 Ga0068859_100820816
842 Ga0068859_101440861
843 Ga0068859_102436815
844 Ga0068864_100048594
845 Ga0068864_100050959
846 Ga0068864_100402717
847 Ga0068864_101149841
848 Ga0068864_101429341
849 Ga0068866_10067063
850 Ga0068861_100018260
851 Ga0068861_100078600
852 Ga0068861_100164558
853 Ga0068861_100642464
854 Ga0068861_101539528
855 Ga0068870_10011960
856 Ga0068870_10027268
857 Ga0068870_10080177
858 Ga0068870_11294692
859 Ga0068863_100114378
860 Ga0068863_100132062
861 Ga0068863_100277079
862 Ga0068863_100277650
863 Ga0068863_100352803
864 Ga0068863_100505577
865 Ga0068863_100665634
866 Ga0068863_100827137
867 Ga0068863_101132561
868 Ga0068858_100158510
869 Ga0068858_100163453
870 Ga0068858_100548067
871 Ga0068860_100007073
872 Ga0068860_100012402
873 Ga0068860_100041100
874 Ga0068860_100050950
875 Ga0068860_100054771
876 Ga0068860_100121275
877 Ga0068860_100282855
878 Ga0068860_100745854
879 Ga0068860_101612573
880 Ga0068860_102793849
881 Ga0068862_100071803
882 Ga0068862_100148120
883 Ga0068862_100226424
884 Ga0068862_100824199
885 Ga0068862_101044967
886 Ga0068862_101325064
887 Ga0081539_10000912
888 Ga0081539_10143113
889 Ga0068871_100038931
890 Ga0068871_100097864
891 Ga0068871_100188740
892 Ga0075431_100115212
893 Ga0075431_100416015
894 Ga0075433_10016560
895 Ga0075433_10197931
896 Ga0075433_10288505
897 Ga0075433_10338622
898 Ga0075433_11364720
899 Ga0075433_11457995
900 Ga0075434_100115925
901 Ga0075434_100510606
902 Ga0075434_100640791
903 Ga0068865_100178539
904 Ga0068865_100357583
905 Ga0068865_101149013
906 Ga0075436_100005547
907 Ga0075436_100671113
908 Ga0097620_100005853
909 Ga0097620_100025440
910 Ga0097620_100073551
911 Ga0097620_100224510
912 Ga0097620_100264655
913 Ga0097620_100343263
914 Ga0097620_100733417
915 Ga0097620_100820843
916 Ga0097620_101440858
917 Ga0097620_102436784
918 Ga0075435_100063830
919 Ga0075435_100556704
920 Ga0105251_10024716
921 Ga0105250_10417425
922 Ga0105240_10189102
923 Ga0105240_10434932
924 Ga0105240_11061072
925 Ga0105240_11310083
926 Ga0111539_10067473
927 Ga0111539_10109309
928 Ga0111539_10112489
929 Ga0111539_10667665
930 Ga0105245_10328429
931 Ga0105245_10366279
932 Ga0105245_11295134
933 Ga0105245_11808799
934 Ga0105247_10027299
935 Ga0105247_10039747
936 Ga0105247_11021656
937 Ga0114129_10011179
938 Ga0114129_10115281
939 Ga0114129_10150962
940 Ga0114129_10219417
941 Ga0114129_10795383
942 Ga0114129_11457611
943 Ga0114129_11644160
944 Ga0114129_11793804
945 Ga0114129_12471433
946 Ga0105243_10022433
947 Ga0105243_10031998
948 Ga0105243_10247920
949 Ga0105243_10409987
950 Ga0105243_10951521
951 Ga0105243_11633323
952 Ga0105243_11850411
953 Ga0105241_10385353
954 Ga0105241_10413477
955 Ga0105241_10583859
956 Ga0105241_10937323
957 Ga0105241_11441801
958 Ga0105241_11743087
959 Ga0105242_11173844
960 Ga0105242_12026724
961 Ga0105242_12876862
962 Ga0105248_10010902
963 Ga0105248_10013305
964 Ga0105248_10113118
965 Ga0105248_10131978
966 Ga0105248_10221242
967 Ga0105248_10223245
968 Ga0105248_10461037
969 Ga0105248_10543946
970 Ga0105248_11266857
971 Ga0105248_12211346
972 Ga0105248_13009289
973 Ga0105237_10027024
974 Ga0105237_10070127
975 Ga0105238_10012356
976 Ga0105238_10324300
977 Ga0105249_10039835
978 Ga0105249_10075053
979 Ga0105249_10137681
980 Ga0105249_10237079
981 Ga0105249_10612017
982 Ga0105239_10316915
983 Ga0105239_10643446
984 Ga0105239_11436751
985 Ga0105239_11972903
986 Ga0105246_10010133
987 Ga0105246_10244116
988 Ga0105246_10391409
989 Ga0105246_10559148
990 Ga0105246_10583440
991 Ga0105246_10615936
992 Ga0105246_10844704
993 Ga0105246_11924287
994 Ga0157373_10188025
995 Ga0157373_10216775
996 Ga0157371_11008976
997 Ga0157374_10012167
998 Ga0157374_10082527
999 Ga0157374_11946591
1000 Ga0157378_10003821
1001 Ga0157378_10037314
1002 Ga0157378_10592514
1003 Ga0157378_11046487
1004 Ga0157378_11280189
1005 Ga0157378_11460661
1006 Ga0163162_10001550
1007 Ga0163162_10072636
1008 Ga0163162_10329250
1009 Ga0163162_10380487
1010 Ga0163162_10409994
1011 Ga0163162_11129095
1012 Ga0163162_12173706
1013 Ga0163162_12528422
1014 Ga0157372_11289716
1015 Ga0157375_10048503
1016 Ga0157375_10193960
1017 Ga0157375_11596752
1018 Ga0157375_12285226
1019 Ga0157375_13192588
1020 Ga0163163_10001302
1021 Ga0163163_10017555
1022 Ga0163163_10077493
1023 Ga0163163_10179088
1024 Ga0163163_10233731
1025 Ga0163163_10672100
1026 Ga0163163_12446019
1027 Ga0157380_10013222
1028 Ga0157380_10166747
1029 Ga0157380_10397372
1030 Ga0157380_10413678
1031 Ga0157380_11224153
1032 Ga0157380_12067108
1033 Ga0157377_10036680
1034 Ga0157377_10224049
1035 Ga0157377_10514961
1036 Ga0157379_10300657
1037 Ga0157379_10462830
1038 Ga0157376_10012816
1039 Ga0157376_10065014
1040 Ga0157376_10418640
1041 Ga0157376_10566336
1042 Ga0163161_10282686
1043 Ga0213875_10006350
1044 Ga0213875_10067365
1045 Ga0207713_1185001
1046 Ga0207642_10011794
1047 Ga0207710_10006766
1048 Ga0207688_10541543
1049 Ga0207688_10773398
1050 Ga0207680_10118491
1051 Ga0207647_10386533
1052 Ga0207645_10622146
1053 Ga0207643_10007637
1054 Ga0207643_10014691
1055 Ga0207643_10222325
1056 Ga0207643_10438256
1057 Ga0207684_10000076
1058 Ga0207684_10023397
1059 Ga0207684_10142649
1060 Ga0207684_10147768
1061 Ga0207654_10132925
1062 Ga0207654_11093318
1063 Ga0207707_10000060
1064 Ga0207707_10191405
1065 Ga0207671_10202580
1066 Ga0207671_11094092
1067 Ga0207663_10000001
1068 Ga0207663_10000019
1069 Ga0207660_10003245
1070 Ga0207662_10013704
1071 Ga0207662_10721698
1072 Ga0207649_10507027
1073 Ga0207652_10000073
1074 Ga0207652_10169798
1075 Ga0207646_10075800
1076 Ga0207646_10325183
1077 Ga0207646_10635777
1078 Ga0207681_10001454
1079 Ga0207681_10433746
1080 Ga0207694_10052688
1081 Ga0207694_10065044
1082 Ga0207650_10000588
1083 Ga0207650_10043394
1084 Ga0207650_10233300
1085 Ga0207650_11201387
1086 Ga0207659_10180693
1087 Ga0207687_10087444
1088 Ga0207644_10009583
1089 Ga0207644_10134240
1090 Ga0207706_10158844
1091 Ga0207686_10091187
1092 Ga0207686_10596139
1093 Ga0207686_10620348
1094 Ga0207709_10002017
1095 Ga0207709_11038153
1096 Ga0207670_10001405
1097 Ga0207670_10573363
1098 Ga0207670_11699361
1099 Ga0207669_10162232
1100 Ga0207669_10393270
1101 Ga0207704_10332641
1102 Ga0207704_10362783
1103 Ga0207704_10684779
1104 Ga0207691_10001642
1105 Ga0207691_10613713
1106 Ga0207691_10981578
1107 Ga0207711_10038489
1108 Ga0207711_10045603
1109 Ga0207711_10101416
1110 Ga0207711_11311208
1111 Ga0207711_11777454
1112 Ga0207689_10001535
1113 Ga0207689_10051326
1114 Ga0207689_10078074
1115 Ga0207689_10130401
1116 Ga0207689_10379877
1117 Ga0207689_10406135
1118 Ga0207679_10095351
1119 Ga0207679_10109725
1120 Ga0207679_10499341
1121 Ga0207679_11291626
1122 Ga0207651_10024481
1123 Ga0207651_10034804
1124 Ga0207651_10118325
1125 Ga0207651_10163655
1126 Ga0207651_11070776
1127 Ga0207651_11206618
1128 Ga0207651_11298351
1129 Ga0207651_11879210
1130 Ga0207651_12085932
1131 Ga0207712_10016068
1132 Ga0207712_10021758
1133 Ga0207712_10119906
1134 Ga0207712_10402426
1135 Ga0207640_10138974
1136 Ga0207640_10153500
1137 Ga0207640_10462908
1138 Ga0207640_10519957
1139 Ga0207640_10521991
1140 Ga0207640_10790579
1141 Ga0207640_11174048
1142 Ga0207658_10023410
1143 Ga0207658_10690132
1144 Ga0207677_10681700
1145 Ga0207703_10089954
1146 Ga0207703_10138151
1147 Ga0207703_10242587
1148 Ga0207639_10646182
1149 Ga0207708_10000028
1150 Ga0207708_10013512
1151 Ga0207708_10034648
1152 Ga0207708_10466147
1153 Ga0207708_11026673
1154 Ga0207708_11465787
1155 Ga0207702_10334588
1156 Ga0207641_10017784
1157 Ga0207641_10044649
1158 Ga0207641_10189841
1159 Ga0207641_10541829
1160 Ga0207641_11374511
1161 Ga0207648_10039258
1162 Ga0207648_10065505
1163 Ga0207648_11088929
1164 Ga0207676_10057348
1165 Ga0207676_10146987
1166 Ga0207676_10197262
1167 Ga0207676_10205340
1168 Ga0207676_10370585
1169 Ga0207676_10404396
1170 Ga0207676_11417761
1171 Ga0207674_10059661
1172 Ga0207674_10135485
1173 Ga0207674_10137381
1174 Ga0207674_10658675
1175 Ga0207674_10758420
1176 Ga0207674_10775777
1177 Ga0207674_11338270
1178 Ga0207675_100009834
1179 Ga0207675_100138852
1180 Ga0207675_100156451
1181 Ga0207675_100195152
1182 Ga0207675_100373827
1183 Ga0207683_10012689
1184 Ga0207683_10227985
1185 Ga0207683_10433478
1186 Ga0207683_10472263
1187 Ga0207698_10316495
1188 Ga0207698_11312343
1189 Ga0207428_10012443
1190 Ga0207428_10938567
1191 Ga0268266_10276465
1192 Ga0268265_10090435
1193 Ga0268265_10134143
1194 Ga0268265_10153883
1195 Ga0268265_11366294
1196 Ga0268265_11964999
1197 Ga0268264_10025811
1198 Ga0268264_10034464
1199 Ga0268264_10075570
1200 Ga0268264_10116727
1201 Ga0268264_10199288
1202 Ga0268264_10374267
1203 Ga0268264_10963845
1204 Ga0265760_10000040
1205 Ga0307408_100398067
1206 Ga0307405_11394948
1207 Ga0307413_10041999
1208 Ga0307406_10016790
1209 Ga0307407_10347598
1210 Ga0307412_10053499
1211 Ga0307409_100207025
1212 Ga0307409_100437704
1213 Ga0307409_101051410
1214 Ga0307409_102871901
1215 Ga0307416_100053034
1216 Ga0307414_10027654
1217 Ga0307414_10526381
1218 Ga0307411_10029236
1219 Ga0307411_10413119
1220 Ga0307415_100031343
1221 Ga0307415_101159862
1222 Ga0373941_0200656
1223 Ga0373954_0625554
1224 Ga0373931_0412685
1225 Ga0395899_0459922
1226 Ga0395900_0066855
1227 Ga0395900_1038702
1228 Ga0395898_0413485
1229 Ga0395898_0676435
1230 Ga0395898_1553681
1231 Ga0436364_0272415
1232 Ga0436364_0689903
1233 Ga0395901_0032839
1234 Ga0395901_0338412
1235 Ga0439431_0058312
1236 Ga0451577_0241618
1237 Ga0451577_1726041
1238 Ga0453683_0211827
1239 Ga0451576_0001932
1240 Ga0451576_0265419
1241 Ga0451576_1313753
1242 Ga0495663_0000173
1243 Ga0495665_0363569
1244 Ga0495598_0000534
1245 Ga0495621_0148929
1246 Ga0495656_0664751
1247 Ga0495588_0478461
1248 Ga0495647_0351026
1249 Ga0496102_0546717
1250 Ga0496102_1198822
1251 Ga0496103_0590273
1252 Ga0496104_0316432
1253 Ga0496106_0364864
1254 Ga0496110_0043761
1255 Ga0496112_0087001
1256 Ga0496112_0236882
1257 Ga0496112_0823611
1258 Ga0496113_1498466
1259 Ga0501292_024871
1260 Ga0501292_077248
1261 Ga0501292_090740
1262 Ga0501297_005113
1263 Ga0501298_003016
1264 Ga0501299_006203
1265 Ga0501198_008052
1266 Ga0501207_001861
1267 Ga0501208_027493
1268 Ga0501209_146047
1269 Ga0501216_013054
1270 Ga0501217_001842
1271 Ga0501223_004072
1272 Ga0501227_002157
1273 Ga0501227_006836
1274 Ga0501227_036952
1275 Ga0501233_001264
1276 Ga0501235_088628
1277 Ga0501236_045397
1278 Ga0501243_061955
1279 Ga0501256_035492
1280 Ga0501221_074438
1281 Ga0501225_0117610
1282 Ga0501225_0180041
1283 Ga0501234_000343
1284 Ga0501245_004830
1285 Ga0501245_056159
1286 Ga0501079_1097387
1287 Ga0501262_018157
1288 Ga0501266_016644
1289 Ga0501272_026701
1290 Ga0501273_007095
1291 Ga0501045_0868045
1292 Ga0501212_010771
1293 nmdc:mga05p37_356674_c1
1294 nmdc:mga05p37_647939_c1
1295 nmdc:mga09592_423756_c1
1296 nmdc:mga0qj67_150450_c1
1297 nmdc:mga06r32_292209_c1
1298 nmdc:mga08y16_197160_c1
1299 nmdc:mga08y16_30076_c1
1300 nmdc:mga08y16_4706_c1
1301 nmdc:mga0n895_1001016_c1
1302 nmdc:mga0n895_576847_c1
1303 nmdc:mga0n895_994692_c1
1304 nmdc:mga0rr50_293788_c1
1305 nmdc:mga0rr50_965322_c1
1306 nmdc:mga08x19_32535_c1
1307 nmdc:mga08x19_32_c1
1308 nmdc:mga0a205_1103418_c1
1309 nmdc:mga0a205_1381132_c1
1310 nmdc:mga0a205_410229_c2
1311 nmdc:mga0a205_439486_c1
1312 nmdc:mga0a205_494180_c1
1313 nmdc:mga0a205_70187_c1
1314 nmdc:mga0a205_75330_c1
1315 Ga0495619_0414934
1316 Ga0530510_0042969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04238

DUF420

Protein of unknown function (DUF420)

6

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.7849 2 133
5tgy-assembly1.cif.gz_A nmr structure of holo-ps1 0.7339 7 129
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.7194 2 133
1ocr-assembly1.cif.gz_C bovine heart cytochrome c oxidase in the fully reduced state 0.7182 8 141
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.7162 9 137
ID Description Score Start End Superfamily
af_I1M668_367_696_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9725 5 59 1.10.510.10
af_Q7G2G3_1_94_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8017 9 70 1.20.58.80
af_A0A5K1K958_64_247_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.725 8 137 1.20.120.80
af_Q7HP05_85_278_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7171 8 138 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7093 7 139 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A2V7BBQ5-F1-model_v4 DUF420 domain-containing protein 0.9964 4 138 GO:0016020
AF-A0A353VAQ1-F1-model_v4 DUF420 domain-containing protein 0.996 4 138 GO:0016020
AF-A0A372IRR1-F1-model_v4 DUF420 domain-containing protein 0.9959 7 135 GO:0016020
AF-A0A432MIJ5-F1-model_v4 DUF420 domain-containing protein 0.9952 5 138 GO:0016020
GO:0046872
AF-A0A5R8KD99-F1-model_v4 DUF420 domain-containing protein 0.9949 5 141 GO:0016020

Map