F473160
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 328 | 650 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300006178|Ga0075367_10025103|Ga0075367_100251033 |
| Length | 355 |
| Sequence | MTPLGADISDLTADMRSAAAKGLSIVVPCYNEGAGLPNLHERIAALAAKLKQAYGLATEVIYVDDGSRDDTLVVAQGLPATTLDVNVISLSRNFGKEAALMAGLDHARRGGAVLFMDGDGQHPPAMAETLVRHWVEDGYDVVYTAKAHRNNESPVLRLAVRGFYSLMNFRARHKIPPDAGDFRLLSPRAAAALRQLPERNRFFKGLSSWIGFKQLRVDYNPEPRAHGRTSFNPAALIALSIDGLTSFSVAPLRAAVMLGAAIAFGAFIVGLMILWETFIDGKTVPGYASVIVGVMVLGGMQLVMIGVVGEYIGKIIYELKARPVYFVAEKSLRRAGSDEMQTDLQLAEEPRTAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 3 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 4 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 5 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 6 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 7 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 8 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 176 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 301 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 318 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 319 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 320 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 321 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 322 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 325 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 0 |
| Isolates | 1.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.86 |
| Nodule | 0.61 |
| Rhizoplane | 7.9 |
| Rhizosphere | 84.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004166 | 3300001979 | Bacteria | 6243 |
| 2 | JGI24742J22300_10004103 | 3300002244 | Bacteria | 2372 |
| 3 | JGI24751J29686_10002127 | 3300002459 | Bacteria | 4021 |
| 4 | JGI25406J46586_10005158 | 3300003203 | Bacteria | 6062 |
| 5 | Ga0070670_100064976 | 3300005331 | Bacteria | 3130 |
| 6 | Ga0070666_10344062 | 3300005335 | Bacteria | 1066 |
| 7 | Ga0070680_100022449 | 3300005336 | Bacteria | 5027 |
| 8 | Ga0070682_100000780 | 3300005337 | Bacteria | 18750 |
| 9 | Ga0070682_100043052 | 3300005337 | Bacteria | 2790 |
| 10 | Ga0070682_100070570 | 3300005337 | Bacteria | 2234 |
| 11 | Ga0068868_100002032 | 3300005338 | Bacteria | 13916 |
| 12 | Ga0070660_100089111 | 3300005339 | Bacteria | 2431 |
| 13 | Ga0070689_100060535 | 3300005340 | Bacteria | 2944 |
| 14 | Ga0070689_100423272 | 3300005340 | Bacteria | 1129 |
| 15 | Ga0070687_100015318 | 3300005343 | Bacteria | 3464 |
| 16 | Ga0070692_10076067 | 3300005345 | Bacteria | 1799 |
| 17 | Ga0070675_100000032 | 3300005354 | Bacteria | 97014 |
| 18 | Ga0070675_100125656 | 3300005354 | Bacteria | 2181 |
| 19 | Ga0070671_100005241 | 3300005355 | Bacteria | 10331 |
| 20 | Ga0070671_100090643 | 3300005355 | Bacteria | 2560 |
| 21 | Ga0070674_100221671 | 3300005356 | Bacteria | 1471 |
| 22 | Ga0070673_100024738 | 3300005364 | Bacteria | 4407 |
| 23 | Ga0070659_100193674 | 3300005366 | Bacteria | 1671 |
| 24 | Ga0070667_100263461 | 3300005367 | Bacteria | 1544 |
| 25 | Ga0070709_10031650 | 3300005434 | Bacteria | 3183 |
| 26 | Ga0070714_100005190 | 3300005435 | Bacteria | 9912 |
| 27 | Ga0070714_100153421 | 3300005435 | Bacteria | 2077 |
| 28 | Ga0070713_100021309 | 3300005436 | Bacteria | 4982 |
| 29 | Ga0070713_100139129 | 3300005436 | Bacteria | 2148 |
| 30 | Ga0070710_10000253 | 3300005437 | Bacteria | 25297 |
| 31 | Ga0070701_10126742 | 3300005438 | Bacteria | 1446 |
| 32 | Ga0070711_100005561 | 3300005439 | Bacteria | 7546 |
| 33 | Ga0070711_100017594 | 3300005439 | Bacteria | 4553 |
| 34 | Ga0070711_100337251 | 3300005439 | Bacteria | 1209 |
| 35 | Ga0070694_100070698 | 3300005444 | Bacteria | 2404 |
| 36 | Ga0070663_100082213 | 3300005455 | Bacteria | 2369 |
| 37 | Ga0070678_100064322 | 3300005456 | Bacteria | 2718 |
| 38 | Ga0070662_100171653 | 3300005457 | Bacteria | 1703 |
| 39 | Ga0070681_10022386 | 3300005458 | Bacteria | 6346 |
| 40 | Ga0070679_100166948 | 3300005530 | Bacteria | 2174 |
| 41 | Ga0070684_100028668 | 3300005535 | Bacteria | 4711 |
| 42 | Ga0068853_100013479 | 3300005539 | Bacteria | 6675 |
| 43 | Ga0068853_100015323 | 3300005539 | Bacteria | 6298 |
| 44 | Ga0068853_100369418 | 3300005539 | Bacteria | 1338 |
| 45 | Ga0070672_100341504 | 3300005543 | Bacteria | 1275 |
| 46 | Ga0070695_100140304 | 3300005545 | Bacteria | 1675 |
| 47 | Ga0070696_100046991 | 3300005546 | Bacteria | 2994 |
| 48 | Ga0070693_100003454 | 3300005547 | Bacteria | 7369 |
| 49 | Ga0068855_100052673 | 3300005563 | Bacteria | 4790 |
| 50 | Ga0068855_100359476 | 3300005563 | Bacteria | 1602 |
| 51 | Ga0070664_100197236 | 3300005564 | Bacteria | 1795 |
| 52 | Ga0068857_100085133 | 3300005577 | Bacteria | 2825 |
| 53 | Ga0068857_100093003 | 3300005577 | Bacteria | 2700 |
| 54 | Ga0068857_100130977 | 3300005577 | Bacteria | 2262 |
| 55 | Ga0068854_100023314 | 3300005578 | Bacteria | 4226 |
| 56 | Ga0068854_100032935 | 3300005578 | Bacteria | 3610 |
| 57 | Ga0068856_100026997 | 3300005614 | Bacteria | 5601 |
| 58 | Ga0068856_100039697 | 3300005614 | Bacteria | 4622 |
| 59 | Ga0068856_100124187 | 3300005614 | Bacteria | 2584 |
| 60 | Ga0070702_100075651 | 3300005615 | Bacteria | 2002 |
| 61 | Ga0068852_100155903 | 3300005616 | Bacteria | 2127 |
| 62 | Ga0068859_100072561 | 3300005617 | Bacteria | 3479 |
| 63 | Ga0068864_100013256 | 3300005618 | Bacteria | 6828 |
| 64 | Ga0068866_10112680 | 3300005718 | Bacteria | 1521 |
| 65 | Ga0068851_10009002 | 3300005834 | Bacteria | 4633 |
| 66 | Ga0068863_100018899 | 3300005841 | Bacteria | 6594 |
| 67 | Ga0068863_100208583 | 3300005841 | Bacteria | 1881 |
| 68 | Ga0068858_100008307 | 3300005842 | Bacteria | 9983 |
| 69 | Ga0068858_100123684 | 3300005842 | Bacteria | 2421 |
| 70 | Ga0068858_100158478 | 3300005842 | Bacteria | 2131 |
| 71 | Ga0068860_100046274 | 3300005843 | Bacteria | 4148 |
| 72 | Ga0068860_100199233 | 3300005843 | Bacteria | 1940 |
| 73 | Ga0068860_100203541 | 3300005843 | Bacteria | 1919 |
| 74 | Ga0068862_100264520 | 3300005844 | Bacteria | 1571 |
| 75 | Ga0081455_10018438 | 3300005937 | Bacteria | 6650 |
| 76 | Ga0081455_10027309 | 3300005937 | Bacteria | 5232 |
| 77 | Ga0081538_10009715 | 3300005981 | Bacteria | 7980 |
| 78 | Ga0081538_10013135 | 3300005981 | Bacteria | 6577 |
| 79 | Ga0081538_10034008 | 3300005981 | Bacteria | 3380 |
| 80 | Ga0081538_10041734 | 3300005981 | Bacteria | 2906 |
| 81 | Ga0081540_1000128 | 3300005983 | Bacteria | 80512 |
| 82 | Ga0081539_10004097 | 3300005985 | Bacteria | 16636 |
| 83 | Ga0075365_10001566 | 3300006038 | Bacteria | 10488 |
| 84 | Ga0075365_10002820 | 3300006038 | Bacteria | 8708 |
| 85 | Ga0075365_10004187 | 3300006038 | Bacteria | 7596 |
| 86 | Ga0075368_10004438 | 3300006042 | Bacteria | 4758 |
| 87 | Ga0075364_10015753 | 3300006051 | Bacteria | 4693 |
| 88 | Ga0075364_10027704 | 3300006051 | Bacteria | 3622 |
| 89 | Ga0075364_10119463 | 3300006051 | Bacteria | 1764 |
| 90 | Ga0070715_10004079 | 3300006163 | Bacteria | 4745 |
| 91 | Ga0070715_10051649 | 3300006163 | Bacteria | 1770 |
| 92 | Ga0070716_100019984 | 3300006173 | Bacteria | 3510 |
| 93 | Ga0070716_100024936 | 3300006173 | Bacteria | 3185 |
| 94 | Ga0075367_10019891 | 3300006178 | Bacteria | 3730 |
| 95 | Ga0075367_10025103 | 3300006178 | Bacteria | 3367 |
| 96 | Ga0075367_10201713 | 3300006178 | Bacteria | 1243 |
| 97 | Ga0075369_10012776 | 3300006186 | Bacteria | 3319 |
| 98 | Ga0068871_100040303 | 3300006358 | Bacteria | 3741 |
| 99 | Ga0068871_100091383 | 3300006358 | Bacteria | 2537 |
| 100 | Ga0075428_100016903 | 3300006844 | Bacteria | 8057 |
| 101 | Ga0075430_100000192 | 3300006846 | Bacteria | 41250 |
| 102 | Ga0075430_100093152 | 3300006846 | Bacteria | 2519 |
| 103 | Ga0075431_100007794 | 3300006847 | Bacteria | 10664 |
| 104 | Ga0075431_100071704 | 3300006847 | Bacteria | 3574 |
| 105 | Ga0075434_100067569 | 3300006871 | Bacteria | 3560 |
| 106 | Ga0075434_100217255 | 3300006871 | Bacteria | 1932 |
| 107 | Ga0075429_100022886 | 3300006880 | Bacteria | 5418 |
| 108 | Ga0068865_100029037 | 3300006881 | Bacteria | 3665 |
| 109 | Ga0075436_100030184 | 3300006914 | Bacteria | 3731 |
| 110 | Ga0097620_100072561 | 3300006931 | Bacteria | 3479 |
| 111 | Ga0099795_10001649 | 3300007788 | Bacteria | 4940 |
| 112 | Ga0105250_10016562 | 3300009092 | Bacteria | 3000 |
| 113 | Ga0105240_10110605 | 3300009093 | Bacteria | 3325 |
| 114 | Ga0105240_10215302 | 3300009093 | Bacteria | 2242 |
| 115 | Ga0111539_10000271 | 3300009094 | Bacteria | 61942 |
| 116 | Ga0105245_10001842 | 3300009098 | Bacteria | 19297 |
| 117 | Ga0105245_10070958 | 3300009098 | Bacteria | 3162 |
| 118 | Ga0105245_10330640 | 3300009098 | Bacteria | 1504 |
| 119 | Ga0105247_10011595 | 3300009101 | Bacteria | 5309 |
| 120 | Ga0114129_10001108 | 3300009147 | Bacteria | 35473 |
| 121 | Ga0114129_10030745 | 3300009147 | Bacteria | 7594 |
| 122 | Ga0114129_10119612 | 3300009147 | Bacteria | 3628 |
| 123 | Ga0114129_10161711 | 3300009147 | Bacteria | 3058 |
| 124 | Ga0114129_10267181 | 3300009147 | Bacteria | 2290 |
| 125 | Ga0105243_10030920 | 3300009148 | Bacteria | 4126 |
| 126 | Ga0105243_10119551 | 3300009148 | Bacteria | 2219 |
| 127 | Ga0105241_10000279 | 3300009174 | Bacteria | 38098 |
| 128 | Ga0105241_10047766 | 3300009174 | Bacteria | 3256 |
| 129 | Ga0105241_10127920 | 3300009174 | Bacteria | 2053 |
| 130 | Ga0105241_10317682 | 3300009174 | Bacteria | 1342 |
| 131 | Ga0105241_10320476 | 3300009174 | Bacteria | 1336 |
| 132 | Ga0105242_10023413 | 3300009176 | Bacteria | 4866 |
| 133 | Ga0105248_10026707 | 3300009177 | Bacteria | 6420 |
| 134 | Ga0105248_10028866 | 3300009177 | Bacteria | 6184 |
| 135 | Ga0105248_10091898 | 3300009177 | Bacteria | 3418 |
| 136 | Ga0105237_10101566 | 3300009545 | Bacteria | 2868 |
| 137 | Ga0105237_10319045 | 3300009545 | Bacteria | 1557 |
| 138 | Ga0105238_10022315 | 3300009551 | Bacteria | 6453 |
| 139 | Ga0105238_10037111 | 3300009551 | Bacteria | 4955 |
| 140 | Ga0105238_10077992 | 3300009551 | Bacteria | 3304 |
| 141 | Ga0105238_10156614 | 3300009551 | Bacteria | 2253 |
| 142 | Ga0105238_10308413 | 3300009551 | Bacteria | 1567 |
| 143 | Ga0105249_10270150 | 3300009553 | Bacteria | 1694 |
| 144 | Ga0099796_10025823 | 3300010159 | Bacteria | 1860 |
| 145 | Ga0105239_10020680 | 3300010375 | Bacteria | 7261 |
| 146 | Ga0105239_10029386 | 3300010375 | Bacteria | 6043 |
| 147 | Ga0105239_10158383 | 3300010375 | Bacteria | 2529 |
| 148 | Ga0157370_10026511 | 3300013104 | Bacteria | 5721 |
| 149 | Ga0157370_10286894 | 3300013104 | Bacteria | 1520 |
| 150 | Ga0157369_10001790 | 3300013105 | Bacteria | 26002 |
| 151 | Ga0157369_10506012 | 3300013105 | Bacteria | 1250 |
| 152 | Ga0157374_10022803 | 3300013296 | Bacteria | 5591 |
| 153 | Ga0157378_10069174 | 3300013297 | Bacteria | 3167 |
| 154 | Ga0157378_10172631 | 3300013297 | Bacteria | 2029 |
| 155 | Ga0157372_10006678 | 3300013307 | Bacteria | 12273 |
| 156 | Ga0157375_10016004 | 3300013308 | Bacteria | 6728 |
| 157 | Ga0163163_10027040 | 3300014325 | Bacteria | 5490 |
| 158 | Ga0157380_10086311 | 3300014326 | Bacteria | 2578 |
| 159 | Ga0157379_10033973 | 3300014968 | Bacteria | 4546 |
| 160 | Ga0157379_10047725 | 3300014968 | Bacteria | 3821 |
| 161 | Ga0157376_10034976 | 3300014969 | Bacteria | 4060 |
| 162 | Ga0163161_10061716 | 3300017792 | Bacteria | 2729 |
| 163 | Ga0213874_10012496 | 3300021377 | Bacteria | 2179 |
| 164 | Ga0213876_10115931 | 3300021384 | Bacteria | 1421 |
| 165 | Ga0213875_10000040 | 3300021388 | Bacteria | 156362 |
| 166 | Ga0207656_10015290 | 3300025321 | Bacteria | 2968 |
| 167 | Ga0207656_10052762 | 3300025321 | Bacteria | 1762 |
| 168 | Ga0207692_10000440 | 3300025898 | Bacteria | 14667 |
| 169 | Ga0207692_10025522 | 3300025898 | Bacteria | 2761 |
| 170 | Ga0207642_10071808 | 3300025899 | Bacteria | 1650 |
| 171 | Ga0207688_10000850 | 3300025901 | Bacteria | 15383 |
| 172 | Ga0207699_10000179 | 3300025906 | Bacteria | 38433 |
| 173 | Ga0207699_10104006 | 3300025906 | Bacteria | 1807 |
| 174 | Ga0207645_10048253 | 3300025907 | Bacteria | 2719 |
| 175 | Ga0207654_10009490 | 3300025911 | Bacteria | 4944 |
| 176 | Ga0207654_10185046 | 3300025911 | Bacteria | 1361 |
| 177 | Ga0207707_10037008 | 3300025912 | Bacteria | 4264 |
| 178 | Ga0207695_10014600 | 3300025913 | Bacteria | 9289 |
| 179 | Ga0207671_10175484 | 3300025914 | Bacteria | 1666 |
| 180 | Ga0207693_10014507 | 3300025915 | Bacteria | 6333 |
| 181 | Ga0207663_10000348 | 3300025916 | Bacteria | 20103 |
| 182 | Ga0207663_10002457 | 3300025916 | Bacteria | 8919 |
| 183 | Ga0207663_10009766 | 3300025916 | Bacteria | 5078 |
| 184 | Ga0207663_10178224 | 3300025916 | Bacteria | 1515 |
| 185 | Ga0207660_10246219 | 3300025917 | Bacteria | 1410 |
| 186 | Ga0207662_10000473 | 3300025918 | Bacteria | 17944 |
| 187 | Ga0207657_10096509 | 3300025919 | Bacteria | 2459 |
| 188 | Ga0207657_10135423 | 3300025919 | Bacteria | 2016 |
| 189 | Ga0207649_10061819 | 3300025920 | Bacteria | 2359 |
| 190 | Ga0207652_10063312 | 3300025921 | Bacteria | 3198 |
| 191 | Ga0207681_10054428 | 3300025923 | Bacteria | 2721 |
| 192 | Ga0207694_10003514 | 3300025924 | Bacteria | 12437 |
| 193 | Ga0207650_10194166 | 3300025925 | Bacteria | 1623 |
| 194 | Ga0207687_10040957 | 3300025927 | Bacteria | 3178 |
| 195 | Ga0207687_10150804 | 3300025927 | Bacteria | 1774 |
| 196 | Ga0207700_10035924 | 3300025928 | Bacteria | 3574 |
| 197 | Ga0207664_10084467 | 3300025929 | Bacteria | 2590 |
| 198 | Ga0207690_10053678 | 3300025932 | Bacteria | 2706 |
| 199 | Ga0207706_10008224 | 3300025933 | Bacteria | 9624 |
| 200 | Ga0207706_10028751 | 3300025933 | Bacteria | 4962 |
| 201 | Ga0207686_10250803 | 3300025934 | Bacteria | 1293 |
| 202 | Ga0207709_10233867 | 3300025935 | Bacteria | 1333 |
| 203 | Ga0207670_10084208 | 3300025936 | Bacteria | 2232 |
| 204 | Ga0207670_10290340 | 3300025936 | Bacteria | 1277 |
| 205 | Ga0207669_10093736 | 3300025937 | Bacteria | 1963 |
| 206 | Ga0207704_10023798 | 3300025938 | Bacteria | 3308 |
| 207 | Ga0207665_10000646 | 3300025939 | Bacteria | 23470 |
| 208 | Ga0207665_10002443 | 3300025939 | Bacteria | 12562 |
| 209 | Ga0207665_10176987 | 3300025939 | Bacteria | 1543 |
| 210 | Ga0207691_10003704 | 3300025940 | Bacteria | 14824 |
| 211 | Ga0207691_10167377 | 3300025940 | Bacteria | 1926 |
| 212 | Ga0207691_10432576 | 3300025940 | Bacteria | 1121 |
| 213 | Ga0207711_10136758 | 3300025941 | Bacteria | 2201 |
| 214 | Ga0207689_10002348 | 3300025942 | Bacteria | 17690 |
| 215 | Ga0207679_10335081 | 3300025945 | Bacteria | 1314 |
| 216 | Ga0207667_10012471 | 3300025949 | Bacteria | 9788 |
| 217 | Ga0207667_10020545 | 3300025949 | Bacteria | 7339 |
| 218 | Ga0207667_10301103 | 3300025949 | Bacteria | 1638 |
| 219 | Ga0207651_10056255 | 3300025960 | Bacteria | 2706 |
| 220 | Ga0207640_10135985 | 3300025981 | Bacteria | 1784 |
| 221 | Ga0207640_10312937 | 3300025981 | Bacteria | 1247 |
| 222 | Ga0207658_10168872 | 3300025986 | Bacteria | 1800 |
| 223 | Ga0207703_10033233 | 3300026035 | Bacteria | 4087 |
| 224 | Ga0207703_10134658 | 3300026035 | Bacteria | 2138 |
| 225 | Ga0207703_10166358 | 3300026035 | Bacteria | 1936 |
| 226 | Ga0207639_10033263 | 3300026041 | Bacteria | 3802 |
| 227 | Ga0207639_10069696 | 3300026041 | Bacteria | 2744 |
| 228 | Ga0207639_10359733 | 3300026041 | Bacteria | 1302 |
| 229 | Ga0207678_10080349 | 3300026067 | Bacteria | 2792 |
| 230 | Ga0207708_10001478 | 3300026075 | Bacteria | 17560 |
| 231 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 232 | Ga0207702_10202082 | 3300026078 | Bacteria | 1843 |
| 233 | Ga0207641_10029835 | 3300026088 | Bacteria | 4511 |
| 234 | Ga0207648_10004845 | 3300026089 | Bacteria | 13728 |
| 235 | Ga0207676_10012844 | 3300026095 | Bacteria | 6013 |
| 236 | Ga0207674_10009375 | 3300026116 | Bacteria | 11195 |
| 237 | Ga0207674_10012016 | 3300026116 | Bacteria | 9700 |
| 238 | Ga0207674_10043490 | 3300026116 | Bacteria | 4631 |
| 239 | Ga0207674_10327793 | 3300026116 | Bacteria | 1481 |
| 240 | Ga0207675_100007144 | 3300026118 | Bacteria | 10554 |
| 241 | Ga0207683_10023336 | 3300026121 | Bacteria | 5321 |
| 242 | Ga0207683_10065125 | 3300026121 | Bacteria | 3213 |
| 243 | Ga0207683_10079133 | 3300026121 | Bacteria | 2914 |
| 244 | Ga0207698_10041773 | 3300026142 | Bacteria | 3420 |
| 245 | Ga0207698_10304017 | 3300026142 | Bacteria | 1486 |
| 246 | Ga0209179_1018034 | 3300027512 | Bacteria | 1345 |
| 247 | Ga0209179_1021684 | 3300027512 | Bacteria | 1255 |
| 248 | Ga0268265_10100007 | 3300028380 | Bacteria | 2339 |
| 249 | Ga0268265_10326615 | 3300028380 | Bacteria | 1392 |
| 250 | Ga0268264_10167840 | 3300028381 | Bacteria | 1983 |
| 251 | Ga0265332_10000741 | 3300031238 | Bacteria | 20288 |
| 252 | Ga0265325_10000062 | 3300031241 | Bacteria | 74697 |
| 253 | Ga0265325_10009387 | 3300031241 | Bacteria | 5712 |
| 254 | Ga0265325_10046591 | 3300031241 | Bacteria | 2248 |
| 255 | Ga0265325_10054504 | 3300031241 | Bacteria | 2046 |
| 256 | Ga0265329_10032932 | 3300031242 | Bacteria | 1678 |
| 257 | Ga0265340_10001287 | 3300031247 | Bacteria | 14395 |
| 258 | Ga0265340_10017749 | 3300031247 | Bacteria | 3681 |
| 259 | Ga0265340_10047375 | 3300031247 | Bacteria | 2094 |
| 260 | Ga0265339_10000016 | 3300031249 | Bacteria | 185313 |
| 261 | Ga0265339_10021091 | 3300031249 | Bacteria | 3797 |
| 262 | Ga0265331_10005011 | 3300031250 | Bacteria | 8120 |
| 263 | Ga0265331_10033558 | 3300031250 | Bacteria | 2537 |
| 264 | Ga0265316_10139631 | 3300031344 | Bacteria | 1821 |
| 265 | Ga0307513_10188793 | 3300031456 | Bacteria | 1915 |
| 266 | Ga0265313_10000060 | 3300031595 | Bacteria | 107224 |
| 267 | Ga0265313_10010950 | 3300031595 | Bacteria | 5680 |
| 268 | Ga0265342_10000109 | 3300031712 | Bacteria | 91321 |
| 269 | Ga0316578_10003852 | 3300031728 | Bacteria | 6961 |
| 270 | Ga0307516_10043914 | 3300031730 | Bacteria | 4426 |
| 271 | Ga0307516_10055519 | 3300031730 | Bacteria | 3865 |
| 272 | Ga0307410_10053160 | 3300031852 | Bacteria | 2740 |
| 273 | Ga0307409_100288030 | 3300031995 | Unclassified | 1522 |
| 274 | Ga0373926_0001552 | 3300035083 | Bacteria | 7052 |
| 275 | Ga0373926_0004666 | 3300035083 | Bacteria | 4500 |
| 276 | Ga0373934_0006859 | 3300035086 | Bacteria | 4228 |
| 277 | Ga0373923_0005076 | 3300035111 | Bacteria | 4438 |
| 278 | Ga0373923_0020162 | 3300035111 | Bacteria | 2587 |
| 279 | Ga0373923_0068700 | 3300035111 | Bacteria | 1518 |
| 280 | Ga0373936_0002874 | 3300035113 | Bacteria | 6431 |
| 281 | Ga0373939_0044366 | 3300035114 | Bacteria | 1353 |
| 282 | Ga0373945_0002940 | 3300035116 | Bacteria | 5352 |
| 283 | Ga0373945_0004858 | 3300035116 | Bacteria | 4281 |
| 284 | Ga0373953_0006521 | 3300035117 | Bacteria | 3851 |
| 285 | Ga0373953_0078435 | 3300035117 | Bacteria | 1370 |
| 286 | Ga0373954_0004278 | 3300035118 | Bacteria | 6134 |
| 287 | Ga0373954_0007087 | 3300035118 | Bacteria | 4893 |
| 288 | Ga0373956_0004206 | 3300035119 | Bacteria | 5773 |
| 289 | Ga0373956_0010260 | 3300035119 | Bacteria | 3834 |
| 290 | Ga0373956_0013792 | 3300035119 | Bacteria | 3366 |
| 291 | Ga0373956_0047208 | 3300035119 | Bacteria | 1926 |
| 292 | Ga0373957_0003413 | 3300035120 | Bacteria | 4692 |
| 293 | Ga0373957_0007950 | 3300035120 | Bacteria | 3415 |
| 294 | Ga0373960_0012702 | 3300035121 | Bacteria | 2097 |
| 295 | Ga0373943_0007946 | 3300035170 | Bacteria | 4762 |
| 296 | Ga0373943_0033867 | 3300035170 | Bacteria | 2436 |
| 297 | Ga0373943_0128159 | 3300035170 | Bacteria | 1356 |
| 298 | Ga0373946_0005172 | 3300035171 | Bacteria | 4703 |
| 299 | Ga0373946_0006482 | 3300035171 | Bacteria | 4243 |
| 300 | Ga0373946_0080432 | 3300035171 | Bacteria | 1426 |
| 301 | Ga0373955_0000069 | 3300035172 | Bacteria | 41106 |
| 302 | Ga0373955_0010220 | 3300035172 | Bacteria | 4425 |
| 303 | Ga0373955_0021712 | 3300035172 | Bacteria | 3245 |
| 304 | Ga0373955_0026669 | 3300035172 | Bacteria | 2979 |
| 305 | Ga0373955_0128712 | 3300035172 | Bacteria | 1477 |
| 306 | Ga0373961_0015155 | 3300035241 | Bacteria | 1967 |
| 307 | Ga0373962_0011082 | 3300035242 | Bacteria | 2255 |
| 308 | Ga0373924_0004716 | 3300035410 | Bacteria | 4782 |
| 309 | Ga0373924_0009743 | 3300035410 | Bacteria | 3527 |
| 310 | Ga0373924_0075827 | 3300035410 | Bacteria | 1424 |
| 311 | Ga0373931_0009176 | 3300035691 | Bacteria | 4723 |
| 312 | Ga0373931_0059797 | 3300035691 | Bacteria | 2050 |
| 313 | Ga0373931_0142214 | 3300035691 | Bacteria | 1391 |
| 314 | Ga0373935_0000207 | 3300035692 | Bacteria | 28322 |
| 315 | Ga0373935_0015387 | 3300035692 | Bacteria | 4624 |
| 316 | Ga0373927_0007692 | 3300035695 | Bacteria | 7291 |
| 317 | Ga0373927_0015778 | 3300035695 | Bacteria | 4984 |
| 318 | Ga0373927_0034470 | 3300035695 | Bacteria | 3292 |
| 319 | Ga0373927_0043667 | 3300035695 | Bacteria | 2901 |
| 320 | Ga0373927_0077712 | 3300035695 | Bacteria | 2150 |
| 321 | Ga0373927_0082343 | 3300035695 | Bacteria | 2086 |
| 322 | Ga0373947_0000313 | 3300035725 | Bacteria | 27468 |
| 323 | Ga0373947_0018325 | 3300035725 | Bacteria | 4030 |
| 324 | Ga0373947_0061244 | 3300035725 | Bacteria | 2287 |
| 325 | Ga0373937_0000385 | 3300036401 | Bacteria | 41073 |
| 326 | Ga0373937_0000851 | 3300036401 | Bacteria | 26158 |
| 327 | Ga0373937_0000862 | 3300036401 | Bacteria | 26051 |
| 328 | Ga0373937_0009142 | 3300036401 | Bacteria | 8597 |
| 329 | Ga0316584_0003028 | 3300036712 | Bacteria | 10823 |
| 330 | Ga0373925_0000038 | 3300037068 | Bacteria | 142088 |
| 331 | Ga0373925_0006412 | 3300037068 | Bacteria | 8660 |
| 332 | Ga0373925_0013965 | 3300037068 | Bacteria | 5813 |
| 333 | Ga0373925_0028965 | 3300037068 | Bacteria | 4060 |
| 334 | Ga0373925_0058405 | 3300037068 | Bacteria | 2892 |
| 335 | Ga0436364_0393613 | 3300037853 | Bacteria | 56153 |
| 336 | Ga0436365_0097136 | 3300039437 | Bacteria | 1899 |
| 337 | Ga0436365_0279576 | 3300039437 | Bacteria | 4000 |
| 338 | Ga0436365_0846031 | 3300039437 | Bacteria | 3570 |
| 339 | Ga0436363_0823495 | 3300039450 | Bacteria | 3304 |
| 340 | Ga0466963_0035482 | 3300044694 | Bacteria | 3249 |
| 341 | Ga0466957_0015174 | 3300044842 | Bacteria | 4498 |
| 342 | Ga0466959_0057389 | 3300045049 | Bacteria | 2838 |
| 343 | Ga0466958_0022745 | 3300045836 | Bacteria | 3675 |
| 344 | Ga0495592_0000090 | 3300046454 | Bacteria | 80171 |
| 345 | Ga0495592_0010297 | 3300046454 | Bacteria | 7049 |
| 346 | Ga0495592_0011377 | 3300046454 | Bacteria | 6731 |
| 347 | Ga0495592_0032282 | 3300046454 | Bacteria | 3952 |
| 348 | Ga0495603_0010225 | 3300046455 | Bacteria | 5679 |
| 349 | Ga0495603_0029788 | 3300046455 | Bacteria | 3290 |
| 350 | Ga0495629_0007111 | 3300046459 | Bacteria | 8245 |
| 351 | Ga0495629_0053094 | 3300046459 | Bacteria | 2836 |
| 352 | Ga0495638_0003991 | 3300046460 | Bacteria | 11345 |
| 353 | Ga0495641_0019159 | 3300046461 | Bacteria | 3510 |
| 354 | Ga0495641_0037006 | 3300046461 | Bacteria | 2289 |
| 355 | Ga0495641_0059029 | 3300046461 | Bacteria | 1734 |
| 356 | Ga0495641_0126803 | 3300046461 | Bacteria | 1139 |
| 357 | Ga0495651_0000396 | 3300046462 | Bacteria | 33745 |
| 358 | Ga0495651_0007457 | 3300046462 | Bacteria | 8365 |
| 359 | Ga0495651_0021404 | 3300046462 | Bacteria | 5026 |
| 360 | Ga0495651_0038247 | 3300046462 | Bacteria | 3736 |
| 361 | Ga0495651_0156090 | 3300046462 | Bacteria | 1640 |
| 362 | Ga0495653_0000107 | 3300046463 | Bacteria | 69282 |
| 363 | Ga0495653_0002676 | 3300046463 | Bacteria | 14187 |
| 364 | Ga0495653_0023498 | 3300046463 | Bacteria | 4978 |
| 365 | Ga0495653_0110838 | 3300046463 | Bacteria | 1972 |
| 366 | Ga0495653_0215520 | 3300046463 | Bacteria | 1294 |
| 367 | Ga0495650_0022305 | 3300046471 | Bacteria | 3040 |
| 368 | Ga0495580_0025839 | 3300046472 | Bacteria | 4288 |
| 369 | Ga0495580_0085837 | 3300046472 | Bacteria | 2192 |
| 370 | Ga0495582_0021818 | 3300046473 | Bacteria | 3503 |
| 371 | Ga0495582_0048377 | 3300046473 | Bacteria | 2341 |
| 372 | Ga0495639_0011034 | 3300046475 | Bacteria | 3893 |
| 373 | Ga0495639_0019367 | 3300046475 | Bacteria | 2970 |
| 374 | Ga0495662_0003350 | 3300046476 | Bacteria | 8125 |
| 375 | Ga0495662_0007266 | 3300046476 | Bacteria | 5482 |
| 376 | Ga0495664_0000009 | 3300046477 | Bacteria | 289534 |
| 377 | Ga0495664_0001582 | 3300046477 | Bacteria | 12075 |
| 378 | Ga0495664_0011628 | 3300046477 | Bacteria | 4966 |
| 379 | Ga0495664_0114367 | 3300046477 | Bacteria | 1630 |
| 380 | Ga0495664_0155988 | 3300046477 | Bacteria | 1385 |
| 381 | Ga0495584_0047127 | 3300046491 | Bacteria | 2174 |
| 382 | Ga0495585_0041799 | 3300046492 | Bacteria | 2570 |
| 383 | Ga0495594_0075716 | 3300046499 | Bacteria | 1876 |
| 384 | Ga0495594_0088158 | 3300046499 | Bacteria | 1737 |
| 385 | Ga0495608_0000022 | 3300046511 | Bacteria | 165111 |
| 386 | Ga0495608_0006901 | 3300046511 | Bacteria | 8043 |
| 387 | Ga0495608_0029573 | 3300046511 | Bacteria | 3714 |
| 388 | Ga0495618_0000016 | 3300046514 | Bacteria | 151770 |
| 389 | Ga0495618_0004894 | 3300046514 | Bacteria | 8186 |
| 390 | Ga0495618_0054698 | 3300046514 | Bacteria | 2526 |
| 391 | Ga0495628_0000035 | 3300046516 | Bacteria | 111560 |
| 392 | Ga0495628_0001730 | 3300046516 | Bacteria | 19868 |
| 393 | Ga0495628_0198212 | 3300046516 | Bacteria | 1513 |
| 394 | Ga0495630_0000246 | 3300046517 | Bacteria | 43555 |
| 395 | Ga0495630_0084142 | 3300046517 | Bacteria | 2402 |
| 396 | Ga0495630_0105842 | 3300046517 | Bacteria | 2130 |
| 397 | Ga0495630_0147969 | 3300046517 | Bacteria | 1786 |
| 398 | Ga0495666_0004260 | 3300046526 | Bacteria | 7212 |
| 399 | Ga0495666_0077976 | 3300046526 | Bacteria | 1569 |
| 400 | Ga0495666_0085765 | 3300046526 | Bacteria | 1487 |
| 401 | Ga0495652_0000062 | 3300046529 | Bacteria | 111572 |
| 402 | Ga0495652_0000531 | 3300046529 | Bacteria | 44460 |
| 403 | Ga0495652_0021556 | 3300046529 | Bacteria | 5726 |
| 404 | Ga0495652_0155482 | 3300046529 | Bacteria | 1781 |
| 405 | Ga0495665_0009811 | 3300046531 | Bacteria | 5183 |
| 406 | Ga0495665_0095731 | 3300046531 | Bacteria | 1559 |
| 407 | Ga0495640_0000021 | 3300046533 | Bacteria | 110511 |
| 408 | Ga0495640_0013247 | 3300046533 | Bacteria | 6270 |
| 409 | Ga0495640_0014011 | 3300046533 | Bacteria | 6084 |
| 410 | Ga0495640_0018589 | 3300046533 | Bacteria | 5148 |
| 411 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 412 | Ga0495587_0048333 | 3300046536 | Bacteria | 2519 |
| 413 | Ga0495587_0048631 | 3300046536 | Bacteria | 2511 |
| 414 | Ga0495587_0124842 | 3300046536 | Bacteria | 1473 |
| 415 | Ga0495598_0001181 | 3300046537 | Bacteria | 5045 |
| 416 | Ga0495645_0000090 | 3300046543 | Bacteria | 63443 |
| 417 | Ga0495645_0001513 | 3300046543 | Bacteria | 15682 |
| 418 | Ga0495645_0003462 | 3300046543 | Bacteria | 10707 |
| 419 | Ga0495667_0000011 | 3300046559 | Bacteria | 222545 |
| 420 | Ga0495667_0086856 | 3300046559 | Bacteria | 2028 |
| 421 | Ga0495668_0030599 | 3300046616 | Bacteria | 3039 |
| 422 | Ga0495668_0072446 | 3300046616 | Bacteria | 1893 |
| 423 | Ga0495634_0000291 | 3300046642 | Bacteria | 48026 |
| 424 | Ga0495634_0011447 | 3300046642 | Bacteria | 6456 |
| 425 | Ga0495634_0021869 | 3300046642 | Bacteria | 4513 |
| 426 | Ga0495635_0000018 | 3300046663 | Bacteria | 193591 |
| 427 | Ga0495635_0003726 | 3300046663 | Bacteria | 10580 |
| 428 | Ga0495635_0029673 | 3300046663 | Bacteria | 3804 |
| 429 | Ga0495588_0002105 | 3300046674 | Bacteria | 8543 |
| 430 | Ga0495588_0006339 | 3300046674 | Bacteria | 5325 |
| 431 | Ga0495657_0002845 | 3300046675 | Bacteria | 14362 |
| 432 | Ga0495657_0004577 | 3300046675 | Bacteria | 11043 |
| 433 | Ga0495657_0010336 | 3300046675 | Bacteria | 7027 |
| 434 | Ga0495657_0010948 | 3300046675 | Bacteria | 6803 |
| 435 | Ga0495599_0000032 | 3300046678 | Bacteria | 108178 |
| 436 | Ga0495599_0001644 | 3300046678 | Bacteria | 12894 |
| 437 | Ga0495599_0002601 | 3300046678 | Bacteria | 10524 |
| 438 | Ga0495623_0000099 | 3300046679 | Bacteria | 52531 |
| 439 | Ga0495623_0000187 | 3300046679 | Bacteria | 39206 |
| 440 | Ga0495623_0035261 | 3300046679 | Bacteria | 3207 |
| 441 | Ga0495646_0000045 | 3300046680 | Bacteria | 63367 |
| 442 | Ga0495646_0004935 | 3300046680 | Bacteria | 8425 |
| 443 | Ga0495647_0003806 | 3300046681 | Bacteria | 4854 |
| 444 | Ga0495658_0023632 | 3300046683 | Bacteria | 3264 |
| 445 | Ga0495658_0068767 | 3300046683 | Bacteria | 2051 |
| 446 | Ga0495669_0045412 | 3300046684 | Bacteria | 1959 |
| 447 | Ga0495613_0023198 | 3300046689 | Bacteria | 4623 |
| 448 | Ga0495613_0034322 | 3300046689 | Bacteria | 3768 |
| 449 | Ga0495613_0092162 | 3300046689 | Bacteria | 2194 |
| 450 | Ga0495624_0064708 | 3300046690 | Bacteria | 2285 |
| 451 | Ga0495624_0066788 | 3300046690 | Bacteria | 2245 |
| 452 | Ga0495624_0093426 | 3300046690 | Bacteria | 1854 |
| 453 | Ga0495670_0027986 | 3300046691 | Bacteria | 2794 |
| 454 | Ga0495600_0000022 | 3300046809 | Bacteria | 94789 |
| 455 | Ga0495600_0008920 | 3300046809 | Bacteria | 6176 |
| 456 | Ga0495581_0040321 | 3300047315 | Bacteria | 2702 |
| 457 | Ga0495581_0077009 | 3300047315 | Bacteria | 1930 |
| 458 | Ga0495581_0200855 | 3300047315 | Bacteria | 1166 |
| 459 | Ga0495581_0216735 | 3300047315 | Bacteria | 1119 |
| 460 | Ga0495604_0000011 | 3300047317 | Bacteria | 292024 |
| 461 | Ga0495604_0002167 | 3300047317 | Bacteria | 15769 |
| 462 | Ga0495604_0004215 | 3300047317 | Bacteria | 11385 |
| 463 | Ga0495604_0024351 | 3300047317 | Bacteria | 4828 |
| 464 | Ga0495604_0061002 | 3300047317 | Bacteria | 2886 |
| 465 | Ga0495674_0000034 | 3300047319 | Bacteria | 110674 |
| 466 | Ga0495674_0016757 | 3300047319 | Bacteria | 6835 |
| 467 | Ga0495674_0032012 | 3300047319 | Bacteria | 4773 |
| 468 | Ga0495674_0051042 | 3300047319 | Bacteria | 3647 |
| 469 | Ga0495674_0247300 | 3300047319 | Bacteria | 1468 |
| 470 | Ga0495676_0048198 | 3300047321 | Bacteria | 3437 |
| 471 | Ga0495680_0000290 | 3300047322 | Bacteria | 56506 |
| 472 | Ga0495680_0001596 | 3300047322 | Bacteria | 24170 |
| 473 | Ga0495680_0007052 | 3300047322 | Bacteria | 10356 |
| 474 | Ga0495680_0025820 | 3300047322 | Bacteria | 4856 |
| 475 | Ga0495675_0000781 | 3300047444 | Bacteria | 19671 |
| 476 | Ga0495675_0004665 | 3300047444 | Bacteria | 8324 |
| 477 | Ga0495684_0000012 | 3300047471 | Bacteria | 187118 |
| 478 | Ga0495684_0039328 | 3300047471 | Bacteria | 3625 |
| 479 | Ga0495593_0008117 | 3300047673 | Bacteria | 6109 |
| 480 | Ga0495593_0026064 | 3300047673 | Bacteria | 3231 |
| 481 | Ga0495593_0027723 | 3300047673 | Bacteria | 3115 |
| 482 | Ga0495602_0000064 | 3300048088 | Bacteria | 104858 |
| 483 | Ga0495602_0004816 | 3300048088 | Bacteria | 14117 |
| 484 | Ga0495602_0013239 | 3300048088 | Bacteria | 8437 |
| 485 | Ga0495614_0074482 | 3300048089 | Bacteria | 1466 |
| 486 | Ga0496100_0000907 | 3300048903 | Bacteria | 14109 |
| 487 | Ga0496100_0013883 | 3300048903 | Bacteria | 4661 |
| 488 | Ga0496101_0034822 | 3300048904 | Bacteria | 3559 |
| 489 | Ga0496101_0038186 | 3300048904 | Bacteria | 3410 |
| 490 | Ga0496101_0099849 | 3300048904 | Bacteria | 2170 |
| 491 | Ga0496102_0053595 | 3300048905 | Bacteria | 3676 |
| 492 | Ga0496102_0056646 | 3300048905 | Bacteria | 3576 |
| 493 | Ga0496102_0248895 | 3300048905 | Bacteria | 1675 |
| 494 | Ga0496104_0000273 | 3300048907 | Bacteria | 45919 |
| 495 | Ga0496104_0006342 | 3300048907 | Bacteria | 10403 |
| 496 | Ga0496104_0023148 | 3300048907 | Bacteria | 5711 |
| 497 | Ga0496104_0024587 | 3300048907 | Bacteria | 5541 |
| 498 | Ga0496104_0046341 | 3300048907 | Bacteria | 4094 |
| 499 | Ga0496105_0004529 | 3300048908 | Bacteria | 10472 |
| 500 | Ga0496105_0006140 | 3300048908 | Bacteria | 9205 |
| 501 | Ga0496105_0013298 | 3300048908 | Bacteria | 6531 |
| 502 | Ga0496105_0026526 | 3300048908 | Bacteria | 4727 |
| 503 | Ga0496105_0115171 | 3300048908 | Bacteria | 2217 |
| 504 | Ga0496105_0133393 | 3300048908 | Bacteria | 2046 |
| 505 | Ga0496106_0098215 | 3300048909 | Bacteria | 2268 |
| 506 | Ga0496106_0337594 | 3300048909 | Bacteria | 1210 |
| 507 | Ga0496107_0004948 | 3300048910 | Bacteria | 9068 |
| 508 | Ga0496107_0010934 | 3300048910 | Bacteria | 6313 |
| 509 | Ga0496107_0059473 | 3300048910 | Bacteria | 2765 |
| 510 | Ga0496108_0001300 | 3300048911 | Bacteria | 19621 |
| 511 | Ga0496108_0016150 | 3300048911 | Bacteria | 6086 |
| 512 | Ga0496108_0126306 | 3300048911 | Bacteria | 2196 |
| 513 | Ga0496108_0155205 | 3300048911 | Bacteria | 1976 |
| 514 | Ga0496109_0005518 | 3300048912 | Bacteria | 10593 |
| 515 | Ga0496109_0268469 | 3300048912 | Bacteria | 1607 |
| 516 | Ga0496110_0012371 | 3300048913 | Bacteria | 7016 |
| 517 | Ga0496111_0007704 | 3300048914 | Bacteria | 7081 |
| 518 | Ga0496111_0014311 | 3300048914 | Bacteria | 5417 |
| 519 | Ga0496111_0023381 | 3300048914 | Bacteria | 4338 |
| 520 | Ga0496112_0006238 | 3300048915 | Bacteria | 10446 |
| 521 | Ga0496112_0021763 | 3300048915 | Bacteria | 6101 |
| 522 | Ga0496112_0041429 | 3300048915 | Bacteria | 4506 |
| 523 | Ga0496112_0161641 | 3300048915 | Bacteria | 2206 |
| 524 | Ga0496113_0002743 | 3300048916 | Bacteria | 10355 |
| 525 | Ga0496113_0048125 | 3300048916 | Bacteria | 3171 |
| 526 | Ga0496114_0022869 | 3300048917 | Bacteria | 5095 |
| 527 | Ga0496114_0046379 | 3300048917 | Bacteria | 3611 |
| 528 | Ga0496114_0066816 | 3300048917 | Bacteria | 3015 |
| 529 | Ga0496114_0211646 | 3300048917 | Bacteria | 1700 |
| 530 | Ga0496115_0016067 | 3300048918 | Bacteria | 5693 |
| 531 | Ga0496115_0021246 | 3300048918 | Bacteria | 5012 |
| 532 | Ga0496115_0032159 | 3300048918 | Bacteria | 4138 |
| 533 | Ga0496115_0053892 | 3300048918 | Bacteria | 3229 |
| 534 | Ga0496115_0082429 | 3300048918 | Bacteria | 2620 |
| 535 | Ga0496115_0099490 | 3300048918 | Bacteria | 2383 |
| 536 | Ga0496115_0154383 | 3300048918 | Bacteria | 1896 |
| 537 | Ga0496125_0109666 | 3300048928 | Bacteria | 2003 |
| 538 | Ga0496126_0254935 | 3300048929 | Bacteria | 1461 |
| 539 | Ga0501031_0011996 | 3300049568 | Bacteria | 5651 |
| 540 | Ga0501032_0021229 | 3300049569 | Bacteria | 4516 |
| 541 | Ga0501032_0052919 | 3300049569 | Bacteria | 2735 |
| 542 | Ga0501033_0012533 | 3300049570 | Bacteria | 6469 |
| 543 | Ga0501033_0019871 | 3300049570 | Bacteria | 5076 |
| 544 | Ga0501034_0082621 | 3300049571 | Bacteria | 3214 |
| 545 | Ga0501034_0132098 | 3300049571 | Bacteria | 2479 |
| 546 | Ga0501034_0217274 | 3300049571 | Bacteria | 1865 |
| 547 | Ga0501034_0336839 | 3300049571 | Bacteria | 1439 |
| 548 | Ga0501036_0038418 | 3300049572 | Bacteria | 4051 |
| 549 | Ga0501038_0026844 | 3300049574 | Bacteria | 5127 |
| 550 | Ga0501038_0059471 | 3300049574 | Bacteria | 3273 |
| 551 | Ga0501039_0096064 | 3300049575 | Bacteria | 2310 |
| 552 | Ga0501043_0007153 | 3300049579 | Bacteria | 8877 |
| 553 | Ga0501043_0014715 | 3300049579 | Bacteria | 6125 |
| 554 | Ga0501043_0278250 | 3300049579 | Bacteria | 1283 |
| 555 | Ga0501047_0009919 | 3300049581 | Bacteria | 9005 |
| 556 | Ga0501047_0069970 | 3300049581 | Bacteria | 3378 |
| 557 | Ga0501047_0071339 | 3300049581 | Bacteria | 3343 |
| 558 | Ga0501047_0221671 | 3300049581 | Bacteria | 1747 |
| 559 | Ga0501068_0013679 | 3300049584 | Bacteria | 4621 |
| 560 | Ga0501069_0011527 | 3300049585 | Bacteria | 4684 |
| 561 | Ga0501070_0022631 | 3300049586 | Bacteria | 5262 |
| 562 | Ga0501070_0025890 | 3300049586 | Bacteria | 4921 |
| 563 | Ga0501070_0065981 | 3300049586 | Bacteria | 2997 |
| 564 | Ga0501070_0127233 | 3300049586 | Bacteria | 2105 |
| 565 | Ga0501070_0215132 | 3300049586 | Bacteria | 1577 |
| 566 | Ga0501070_0220028 | 3300049586 | Bacteria | 1557 |
| 567 | Ga0501072_0002738 | 3300049588 | Bacteria | 13230 |
| 568 | Ga0501072_0061584 | 3300049588 | Bacteria | 2960 |
| 569 | Ga0501073_0022087 | 3300049589 | Bacteria | 4585 |
| 570 | Ga0501074_0108894 | 3300049590 | Bacteria | 1982 |
| 571 | Ga0501074_0316468 | 3300049590 | Bacteria | 1108 |
| 572 | Ga0501076_0058257 | 3300049592 | Bacteria | 3070 |
| 573 | Ga0501079_0014774 | 3300049741 | Bacteria | 5953 |
| 574 | Ga0501079_0227287 | 3300049741 | Bacteria | 1458 |
| 575 | Ga0501083_0044749 | 3300049744 | Bacteria | 2996 |
| 576 | Ga0501083_0067192 | 3300049744 | Bacteria | 2387 |
| 577 | Ga0501035_0036759 | 3300049822 | Bacteria | 4437 |
| 578 | Ga0501035_0040772 | 3300049822 | Bacteria | 4194 |
| 579 | Ga0501035_0101156 | 3300049822 | Bacteria | 2529 |
| 580 | Ga0501044_0030230 | 3300049823 | Bacteria | 5709 |
| 581 | Ga0501044_0063764 | 3300049823 | Bacteria | 3763 |
| 582 | Ga0501044_0079770 | 3300049823 | Bacteria | 3316 |
| 583 | Ga0501044_0120059 | 3300049823 | Bacteria | 2630 |
| 584 | Ga0501044_0322136 | 3300049823 | Bacteria | 1470 |
| 585 | nmdc:mga03n38_4275_c1 | 3300050490 | Bacteria | 4704 |
| 586 | nmdc:mga00v17_172621_c1 | 3300050491 | Bacteria | 1394 |
| 587 | nmdc:mga00v17_19033_c1 | 3300050491 | Bacteria | 3913 |
| 588 | nmdc:mga0yw44_1089_c1 | 3300050492 | Bacteria | 10440 |
| 589 | nmdc:mga0yw44_7700_c1 | 3300050492 | Bacteria | 5316 |
| 590 | nmdc:mga0yw44_9690_c1 | 3300050492 | Bacteria | 4889 |
| 591 | nmdc:mga06z11_3146_c1 | 3300050494 | Bacteria | 6370 |
| 592 | nmdc:mga06z11_6520_c1 | 3300050494 | Bacteria | 4756 |
| 593 | nmdc:mga04h51_6638_c1 | 3300050495 | Bacteria | 3012 |
| 594 | nmdc:mga05p37_12095_c1 | 3300050507 | Bacteria | 10302 |
| 595 | nmdc:mga05p37_57_c1 | 3300050507 | Bacteria | 96042 |
| 596 | nmdc:mga05p37_99191_c1 | 3300050507 | Bacteria | 3588 |
| 597 | nmdc:mga09592_6636_c1 | 3300050508 | Bacteria | 9425 |
| 598 | nmdc:mga0qj67_130_c1 | 3300050509 | Bacteria | 49784 |
| 599 | nmdc:mga0qj67_7319_c1 | 3300050509 | Bacteria | 8160 |
| 600 | nmdc:mga06r32_156939_c1 | 3300050510 | Bacteria | 2257 |
| 601 | nmdc:mga06r32_1829_c1 | 3300050510 | Bacteria | 18995 |
| 602 | nmdc:mga06r32_27981_c1 | 3300050510 | Bacteria | 5273 |
| 603 | nmdc:mga06r32_88416_c1 | 3300050510 | Bacteria | 3024 |
| 604 | nmdc:mga08y16_267550_c1 | 3300050511 | Bacteria | 1765 |
| 605 | nmdc:mga08y16_767_c1 | 3300050511 | Bacteria | 30554 |
| 606 | nmdc:mga0rr50_222433_c1 | 3300050513 | Bacteria | 1559 |
| 607 | nmdc:mga08x19_133822_c1 | 3300050514 | Bacteria | 1670 |
| 608 | nmdc:mga08x19_2162_c1 | 3300050514 | Bacteria | 12008 |
| 609 | nmdc:mga08x19_70208_c1 | 3300050514 | Bacteria | 2282 |
| 610 | nmdc:mga0sz30_3923_c1 | 3300050516 | Bacteria | 5362 |
| 611 | Ga0495601_0000015 | 3300053077 | Bacteria | 213851 |
| 612 | Ga0495601_0000081 | 3300053077 | Bacteria | 51417 |
| 613 | Ga0495601_0018837 | 3300053077 | Bacteria | 4205 |
| 614 | Ga0495601_0023296 | 3300053077 | Bacteria | 3804 |
| 615 | Ga0495601_0035847 | 3300053077 | Bacteria | 3098 |
| 616 | Ga0495601_0073460 | 3300053077 | Bacteria | 2186 |
| 617 | Ga0495601_0081365 | 3300053077 | Bacteria | 2078 |
| 618 | Ga0495601_0137015 | 3300053077 | Bacteria | 1596 |
| 619 | Ga0495612_0000016 | 3300053078 | Bacteria | 158947 |
| 620 | Ga0495612_0000687 | 3300053078 | Bacteria | 13648 |
| 621 | Ga0495612_0014554 | 3300053078 | Bacteria | 3162 |
| 622 | Ga0495612_0042786 | 3300053078 | Bacteria | 1850 |
| 623 | Ga0495595_0000035 | 3300053084 | Bacteria | 79822 |
| 624 | Ga0495595_0001073 | 3300053084 | Bacteria | 10579 |
| 625 | Ga0495595_0004961 | 3300053084 | Bacteria | 5368 |
| 626 | Ga0495595_0011345 | 3300053084 | Bacteria | 3723 |
| 627 | Ga0495595_0018770 | 3300053084 | Bacteria | 2992 |
| 628 | Ga0495619_0000044 | 3300053085 | Bacteria | 108581 |
| 629 | Ga0495619_0000270 | 3300053085 | Bacteria | 37699 |
| 630 | Ga0495619_0001648 | 3300053085 | Bacteria | 14730 |
| 631 | Ga0495619_0001859 | 3300053085 | Bacteria | 14050 |
| 632 | Ga0495619_0006596 | 3300053085 | Bacteria | 7345 |
| 633 | Ga0495619_0008987 | 3300053085 | Bacteria | 6304 |
| 634 | Ga0495619_0076402 | 3300053085 | Bacteria | 2248 |
| 635 | Ga0495619_0113773 | 3300053085 | Bacteria | 1851 |
| 636 | Ga0500651_0009647 | 3300053093 | Bacteria | 5750 |
| 637 | Ga0500566_0138514 | 3300053094 | Bacteria | 1294 |
| 638 | Ga0500554_003915 | 3300053102 | Bacteria | 3098 |
| 639 | Ga0500593_005233 | 3300053117 | Bacteria | 5087 |
| 640 | Ga0500595_000068 | 3300053119 | Bacteria | 73931 |
| 641 | Ga0500595_013575 | 3300053119 | Bacteria | 3118 |
| 642 | Ga0500638_007519 | 3300053162 | Bacteria | 4566 |
| 643 | Ga0500636_0007372 | 3300053177 | Bacteria | 6361 |
| 644 | Ga0500637_0000128 | 3300053178 | Bacteria | 27550 |
| 645 | Ga0500645_000216 | 3300053730 | Bacteria | 43997 |
| 646 | Ga0501084_0101144 | 3300054114 | Bacteria | 2420 |
| 647 | Ga0500661_000237 | 3300055283 | Bacteria | 9856 |
| 648 | Ga0501082_0000230 | 3300060353 | Bacteria | 48963 |
| 649 | Ga0501082_0016001 | 3300060353 | Bacteria | 6453 |
| 650 | Ga0501082_0124993 | 3300060353 | Bacteria | 2231 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025940 | Ga0207691_10167377 | Ga0207691_101673771 | 292 |
| 2 | 3300031247 | Ga0265340_10047375 | Ga0265340_100473753 | 295 |
| 3 | 3300046462 | Ga0495651_0156090 | Ga0495651_0156090_653_1618 | 298 |
| 4 | 3300053085 | Ga0495619_0008987 | Ga0495619_0008987_417_1376 | 303 |
| 5 | 3300049569 | Ga0501032_0021229 | Ga0501032_0021229_899_1909 | 305 |
| 6 | 3300049570 | Ga0501033_0019871 | Ga0501033_0019871_258_1268 | 305 |
| 7 | 3300049579 | Ga0501043_0014715 | Ga0501043_0014715_2483_3493 | 305 |
| 8 | 3300049581 | Ga0501047_0009919 | Ga0501047_0009919_4417_5427 | 305 |
| 9 | 3300049822 | Ga0501035_0036759 | Ga0501035_0036759_1878_2888 | 305 |
| 10 | 3300049823 | Ga0501044_0063764 | Ga0501044_0063764_166_1176 | 305 |
| 11 | 3300031728 | Ga0316578_10003852 | Ga0316578_100038526 | 306 |
| 12 | 3300036712 | Ga0316584_0003028 | Ga0316584_0003028_9516_10598 | 306 |
| 13 | 3300049586 | Ga0501070_0127233 | Ga0501070_0127233_1003_2028 | 306 |
| 14 | 3300021388 | Ga0213875_10000040 | Ga0213875_1000004036 | 308 |
| 15 | 3300035170 | Ga0373943_0128159 | Ga0373943_0128159_24_1091 | 308 |
| 16 | 3300035695 | Ga0373927_0082343 | Ga0373927_0082343_683_1750 | 308 |
| 17 | 3300048903 | Ga0496100_0013883 | Ga0496100_0013883_3034_4101 | 308 |
| 18 | 3300048905 | Ga0496102_0056646 | Ga0496102_0056646_2459_3526 | 308 |
| 19 | 3300048905 | Ga0496102_0248895 | Ga0496102_0248895_681_1661 | 308 |
| 20 | 3300048913 | Ga0496110_0012371 | Ga0496110_0012371_5179_6246 | 308 |
| 21 | 3300053077 | Ga0495601_0073460 | Ga0495601_0073460_150_1217 | 308 |
| 22 | 3300005337 | Ga0070682_100043052 | Ga0070682_1000430523 | 309 |
| 23 | 3300005843 | Ga0068860_100199233 | Ga0068860_1001992333 | 309 |
| 24 | 3300013105 | Ga0157369_10506012 | Ga0157369_105060122 | 309 |
| 25 | 3300025898 | Ga0207692_10025522 | Ga0207692_100255223 | 309 |
| 26 | 3300031247 | Ga0265340_10017749 | Ga0265340_100177493 | 309 |
| 27 | 3300035410 | Ga0373924_0075827 | Ga0373924_0075827_204_1187 | 309 |
| 28 | 3300046459 | Ga0495629_0053094 | Ga0495629_0053094_1482_2465 | 309 |
| 29 | 3300046461 | Ga0495641_0126803 | Ga0495641_0126803_56_1039 | 309 |
| 30 | 3300046463 | Ga0495653_0110838 | Ga0495653_0110838_515_1498 | 309 |
| 31 | 3300046477 | Ga0495664_0155988 | Ga0495664_0155988_134_1117 | 309 |
| 32 | 3300046559 | Ga0495667_0086856 | Ga0495667_0086856_868_1851 | 309 |
| 33 | 3300046663 | Ga0495635_0029673 | Ga0495635_0029673_1105_2088 | 309 |
| 34 | 3300047315 | Ga0495581_0216735 | Ga0495581_0216735_93_1076 | 309 |
| 35 | 3300047317 | Ga0495604_0061002 | Ga0495604_0061002_971_1954 | 309 |
| 36 | 3300047322 | Ga0495680_0025820 | Ga0495680_0025820_2157_3140 | 309 |
| 37 | 3300048089 | Ga0495614_0074482 | Ga0495614_0074482_50_1033 | 309 |
| 38 | 3300053077 | Ga0495601_0018837 | Ga0495601_0018837_930_1907 | 309 |
| 39 | 3300053078 | Ga0495612_0014554 | Ga0495612_0014554_1685_2668 | 309 |
| 40 | 3300053078 | Ga0495612_0042786 | Ga0495612_0042786_281_1258 | 309 |
| 41 | 3300053084 | Ga0495595_0018770 | Ga0495595_0018770_158_1141 | 309 |
| 42 | 3300053085 | Ga0495619_0000270 | Ga0495619_0000270_19723_20706 | 309 |
| 43 | 3300009177 | Ga0105248_10026707 | Ga0105248_100267078 | 310 |
| 44 | 3300025941 | Ga0207711_10136758 | Ga0207711_101367583 | 310 |
| 45 | 3300035241 | Ga0373961_0015155 | Ga0373961_0015155_667_1659 | 310 |
| 46 | 3300035691 | Ga0373931_0009176 | Ga0373931_0009176_885_1877 | 310 |
| 47 | 3300048910 | Ga0496107_0059473 | Ga0496107_0059473_49_1041 | 310 |
| 48 | 3300048917 | Ga0496114_0066816 | Ga0496114_0066816_1722_2714 | 310 |
| 49 | 3300005718 | Ga0068866_10112680 | Ga0068866_101126802 | 311 |
| 50 | 3300006358 | Ga0068871_100091383 | Ga0068871_1000913833 | 311 |
| 51 | 3300025899 | Ga0207642_10071808 | Ga0207642_100718082 | 312 |
| 52 | 3300046460 | Ga0495638_0003991 | Ga0495638_0003991_7153_8142 | 313 |
| 53 | 3300048915 | Ga0496112_0161641 | Ga0496112_0161641_166_1173 | 313 |
| 54 | 3300049588 | Ga0501072_0002738 | Ga0501072_0002738_6899_7888 | 313 |
| 55 | 3300054114 | Ga0501084_0101144 | Ga0501084_0101144_43_1032 | 313 |
| 56 | 3300060353 | Ga0501082_0124993 | Ga0501082_0124993_139_1128 | 313 |
| 57 | 3300009174 | Ga0105241_10047766 | Ga0105241_100477662 | 314 |
| 58 | 3300013104 | Ga0157370_10026511 | Ga0157370_100265113 | 314 |
| 59 | 3300013307 | Ga0157372_10006678 | Ga0157372_100066788 | 314 |
| 60 | 3300006042 | Ga0075368_10004438 | Ga0075368_100044382 | 315 |
| 61 | 3300006051 | Ga0075364_10119463 | Ga0075364_101194632 | 315 |
| 62 | 3300009092 | Ga0105250_10016562 | Ga0105250_100165623 | 315 |
| 63 | 3300009101 | Ga0105247_10011595 | Ga0105247_100115954 | 315 |
| 64 | 3300009174 | Ga0105241_10320476 | Ga0105241_103204761 | 315 |
| 65 | 3300009551 | Ga0105238_10077992 | Ga0105238_100779923 | 315 |
| 66 | 3300010375 | Ga0105239_10020680 | Ga0105239_100206807 | 315 |
| 67 | 3300013105 | Ga0157369_10001790 | Ga0157369_1000179022 | 315 |
| 68 | 3300013296 | Ga0157374_10022803 | Ga0157374_100228035 | 315 |
| 69 | 3300013297 | Ga0157378_10172631 | Ga0157378_101726312 | 315 |
| 70 | 3300014326 | Ga0157380_10086311 | Ga0157380_100863112 | 315 |
| 71 | 3300014968 | Ga0157379_10047725 | Ga0157379_100477253 | 315 |
| 72 | 3300014969 | Ga0157376_10034976 | Ga0157376_100349764 | 315 |
| 73 | 3300035083 | Ga0373926_0004666 | Ga0373926_0004666_1592_2590 | 315 |
| 74 | 3300035116 | Ga0373945_0004858 | Ga0373945_0004858_1050_2048 | 315 |
| 75 | 3300035171 | Ga0373946_0005172 | Ga0373946_0005172_2659_3657 | 315 |
| 76 | 3300035172 | Ga0373955_0128712 | Ga0373955_0128712_259_1257 | 315 |
| 77 | 3300035695 | Ga0373927_0015778 | Ga0373927_0015778_2632_3630 | 315 |
| 78 | 3300037068 | Ga0373925_0006412 | Ga0373925_0006412_3025_4023 | 315 |
| 79 | 3300046455 | Ga0495603_0010225 | Ga0495603_0010225_2843_3841 | 315 |
| 80 | 3300046461 | Ga0495641_0019159 | Ga0495641_0019159_1526_2524 | 315 |
| 81 | 3300046472 | Ga0495580_0085837 | Ga0495580_0085837_1112_2110 | 315 |
| 82 | 3300046491 | Ga0495584_0047127 | Ga0495584_0047127_328_1326 | 315 |
| 83 | 3300046492 | Ga0495585_0041799 | Ga0495585_0041799_854_1852 | 315 |
| 84 | 3300046499 | Ga0495594_0088158 | Ga0495594_0088158_402_1400 | 315 |
| 85 | 3300046517 | Ga0495630_0105842 | Ga0495630_0105842_668_1666 | 315 |
| 86 | 3300046526 | Ga0495666_0085765 | Ga0495666_0085765_146_1144 | 315 |
| 87 | 3300046531 | Ga0495665_0095731 | Ga0495665_0095731_40_1038 | 315 |
| 88 | 3300046537 | Ga0495598_0001181 | Ga0495598_0001181_3169_4167 | 315 |
| 89 | 3300046616 | Ga0495668_0030599 | Ga0495668_0030599_1032_2030 | 315 |
| 90 | 3300046674 | Ga0495588_0002105 | Ga0495588_0002105_6148_7146 | 315 |
| 91 | 3300046683 | Ga0495658_0068767 | Ga0495658_0068767_963_1961 | 315 |
| 92 | 3300046689 | Ga0495613_0034322 | Ga0495613_0034322_550_1548 | 315 |
| 93 | 3300046690 | Ga0495624_0064708 | Ga0495624_0064708_682_1680 | 315 |
| 94 | 3300046691 | Ga0495670_0027986 | Ga0495670_0027986_1425_2423 | 315 |
| 95 | 3300048904 | Ga0496101_0099849 | Ga0496101_0099849_1049_2047 | 315 |
| 96 | 3300048908 | Ga0496105_0006140 | Ga0496105_0006140_4155_5153 | 315 |
| 97 | 3300048911 | Ga0496108_0016150 | Ga0496108_0016150_358_1356 | 315 |
| 98 | 3300048916 | Ga0496113_0048125 | Ga0496113_0048125_358_1356 | 315 |
| 99 | 3300048917 | Ga0496114_0022869 | Ga0496114_0022869_2602_3600 | 315 |
| 100 | 3300048918 | Ga0496115_0082429 | Ga0496115_0082429_1499_2497 | 315 |
| 101 | 3300050491 | nmdc:mga00v17_172621_c1 | nmdc:mga00v17_172621_c1_321_1355 | 315 |
| 102 | 3300050492 | nmdc:mga0yw44_7700_c1 | nmdc:mga0yw44_7700_c1_3902_4900 | 315 |
| 103 | 3300050510 | nmdc:mga06r32_88416_c1 | nmdc:mga06r32_88416_c1_623_1639 | 315 |
| 104 | 3300050511 | nmdc:mga08y16_267550_c1 | nmdc:mga08y16_267550_c1_152_1150 | 315 |
| 105 | 3300053093 | Ga0500651_0009647 | Ga0500651_0009647_1483_2493 | 315 |
| 106 | 3300053117 | Ga0500593_005233 | Ga0500593_005233_505_1530 | 315 |
| 107 | 3300003203 | JGI25406J46586_10005158 | JGI25406J46586_100051582 | 316 |
| 108 | 3300005981 | Ga0081538_10041734 | Ga0081538_100417341 | 316 |
| 109 | 3300005985 | Ga0081539_10004097 | Ga0081539_100040979 | 316 |
| 110 | 3300005435 | Ga0070714_100153421 | Ga0070714_1001534212 | 317 |
| 111 | 3300005937 | Ga0081455_10018438 | Ga0081455_100184386 | 317 |
| 112 | 3300044694 | Ga0466963_0035482 | Ga0466963_0035482_232_1263 | 317 |
| 113 | 3300044842 | Ga0466957_0015174 | Ga0466957_0015174_137_1168 | 317 |
| 114 | 3300045049 | Ga0466959_0057389 | Ga0466959_0057389_533_1564 | 317 |
| 115 | 3300045836 | Ga0466958_0022745 | Ga0466958_0022745_804_1835 | 317 |
| 116 | 3300006038 | Ga0075365_10002820 | Ga0075365_100028201 | 318 |
| 117 | 3300006844 | Ga0075428_100016903 | Ga0075428_1000169033 | 318 |
| 118 | 3300006846 | Ga0075430_100093152 | Ga0075430_1000931522 | 318 |
| 119 | 3300006847 | Ga0075431_100071704 | Ga0075431_1000717043 | 318 |
| 120 | 3300031241 | Ga0265325_10046591 | Ga0265325_100465912 | 318 |
| 121 | 3300031250 | Ga0265331_10005011 | Ga0265331_100050117 | 318 |
| 122 | 3300049823 | Ga0501044_0322136 | Ga0501044_0322136_339_1388 | 318 |
| 123 | 3300050492 | nmdc:mga0yw44_1089_c1 | nmdc:mga0yw44_1089_c1_8291_9313 | 318 |
| 124 | 3300050510 | nmdc:mga06r32_156939_c1 | nmdc:mga06r32_156939_c1_911_1933 | 318 |
| 125 | 3300049571 | Ga0501034_0217274 | Ga0501034_0217274_654_1673 | 319 |
| 126 | 3300006871 | Ga0075434_100217255 | Ga0075434_1002172552 | 320 |
| 127 | 3300031241 | Ga0265325_10054504 | Ga0265325_100545042 | 321 |
| 128 | 3300031249 | Ga0265339_10021091 | Ga0265339_100210912 | 321 |
| 129 | 3300031344 | Ga0265316_10139631 | Ga0265316_101396311 | 321 |
| 130 | 3300031595 | Ga0265313_10010950 | Ga0265313_100109504 | 321 |
| 131 | 3300005340 | Ga0070689_100423272 | Ga0070689_1004232721 | 322 |
| 132 | 3300005367 | Ga0070667_100263461 | Ga0070667_1002634612 | 322 |
| 133 | 3300005539 | Ga0068853_100369418 | Ga0068853_1003694181 | 322 |
| 134 | 3300005843 | Ga0068860_100203541 | Ga0068860_1002035412 | 322 |
| 135 | 3300005937 | Ga0081455_10027309 | Ga0081455_100273092 | 322 |
| 136 | 3300006358 | Ga0068871_100040303 | Ga0068871_1000403033 | 322 |
| 137 | 3300006914 | Ga0075436_100030184 | Ga0075436_1000301842 | 322 |
| 138 | 3300009094 | Ga0111539_10000271 | Ga0111539_100002715 | 322 |
| 139 | 3300009098 | Ga0105245_10001842 | Ga0105245_100018425 | 322 |
| 140 | 3300009147 | Ga0114129_10001108 | Ga0114129_1000110813 | 322 |
| 141 | 3300009177 | Ga0105248_10028866 | Ga0105248_100288667 | 322 |
| 142 | 3300021384 | Ga0213876_10115931 | Ga0213876_101159312 | 322 |
| 143 | 3300025927 | Ga0207687_10040957 | Ga0207687_100409573 | 322 |
| 144 | 3300025981 | Ga0207640_10312937 | Ga0207640_103129372 | 322 |
| 145 | 3300025986 | Ga0207658_10168872 | Ga0207658_101688722 | 322 |
| 146 | 3300026035 | Ga0207703_10166358 | Ga0207703_101663582 | 322 |
| 147 | 3300026041 | Ga0207639_10359733 | Ga0207639_103597332 | 322 |
| 148 | 3300028381 | Ga0268264_10167840 | Ga0268264_101678401 | 322 |
| 149 | 3300031456 | Ga0307513_10188793 | Ga0307513_101887932 | 322 |
| 150 | 3300031730 | Ga0307516_10043914 | Ga0307516_100439144 | 322 |
| 151 | 3300031730 | Ga0307516_10055519 | Ga0307516_100555193 | 322 |
| 152 | 3300035111 | Ga0373923_0068700 | Ga0373923_0068700_174_1253 | 322 |
| 153 | 3300036401 | Ga0373937_0000862 | Ga0373937_0000862_18130_19209 | 322 |
| 154 | 3300037853 | Ga0436364_0393613 | Ga0436364_0393613_47726_48763 | 322 |
| 155 | 3300039437 | Ga0436365_0097136 | Ga0436365_0097136_131_1168 | 322 |
| 156 | 3300039437 | Ga0436365_0279576 | Ga0436365_0279576_568_1605 | 322 |
| 157 | 3300050507 | nmdc:mga05p37_57_c1 | nmdc:mga05p37_57_c1_88006_89034 | 322 |
| 158 | 3300050508 | nmdc:mga09592_6636_c1 | nmdc:mga09592_6636_c1_5978_7006 | 322 |
| 159 | 3300050510 | nmdc:mga06r32_1829_c1 | nmdc:mga06r32_1829_c1_6230_7258 | 322 |
| 160 | 3300050511 | nmdc:mga08y16_767_c1 | nmdc:mga08y16_767_c1_2113_3141 | 322 |
| 161 | 3300050514 | nmdc:mga08x19_70208_c1 | nmdc:mga08x19_70208_c1_1123_2172 | 322 |
| 162 | 3300005336 | Ga0070680_100022449 | Ga0070680_1000224492 | 323 |
| 163 | 3300005337 | Ga0070682_100000780 | Ga0070682_10000078013 | 323 |
| 164 | 3300005437 | Ga0070710_10000253 | Ga0070710_1000025320 | 323 |
| 165 | 3300005439 | Ga0070711_100005561 | Ga0070711_1000055616 | 323 |
| 166 | 3300005439 | Ga0070711_100337251 | Ga0070711_1003372511 | 323 |
| 167 | 3300005455 | Ga0070663_100082213 | Ga0070663_1000822132 | 323 |
| 168 | 3300005458 | Ga0070681_10022386 | Ga0070681_100223864 | 323 |
| 169 | 3300005530 | Ga0070679_100166948 | Ga0070679_1001669483 | 323 |
| 170 | 3300005539 | Ga0068853_100013479 | Ga0068853_1000134794 | 323 |
| 171 | 3300005547 | Ga0070693_100003454 | Ga0070693_1000034544 | 323 |
| 172 | 3300005577 | Ga0068857_100130977 | Ga0068857_1001309773 | 323 |
| 173 | 3300006173 | Ga0070716_100024936 | Ga0070716_1000249362 | 323 |
| 174 | 3300007788 | Ga0099795_10001649 | Ga0099795_100016494 | 323 |
| 175 | 3300009551 | Ga0105238_10037111 | Ga0105238_100371114 | 323 |
| 176 | 3300010159 | Ga0099796_10025823 | Ga0099796_100258232 | 323 |
| 177 | 3300025898 | Ga0207692_10000440 | Ga0207692_100004403 | 323 |
| 178 | 3300025906 | Ga0207699_10000179 | Ga0207699_1000017917 | 323 |
| 179 | 3300025912 | Ga0207707_10037008 | Ga0207707_100370084 | 323 |
| 180 | 3300025916 | Ga0207663_10002457 | Ga0207663_100024573 | 323 |
| 181 | 3300025921 | Ga0207652_10063312 | Ga0207652_100633123 | 323 |
| 182 | 3300025928 | Ga0207700_10035924 | Ga0207700_100359242 | 323 |
| 183 | 3300025939 | Ga0207665_10002443 | Ga0207665_100024433 | 323 |
| 184 | 3300025939 | Ga0207665_10176987 | Ga0207665_101769871 | 323 |
| 185 | 3300025949 | Ga0207667_10012471 | Ga0207667_100124719 | 323 |
| 186 | 3300026041 | Ga0207639_10069696 | Ga0207639_100696963 | 323 |
| 187 | 3300026116 | Ga0207674_10327793 | Ga0207674_103277932 | 323 |
| 188 | 3300027512 | Ga0209179_1018034 | Ga0209179_10180342 | 323 |
| 189 | 3300027512 | Ga0209179_1021684 | Ga0209179_10216841 | 323 |
| 190 | 3300035111 | Ga0373923_0020162 | Ga0373923_0020162_1126_2151 | 323 |
| 191 | 3300035113 | Ga0373936_0002874 | Ga0373936_0002874_3750_4775 | 323 |
| 192 | 3300035116 | Ga0373945_0002940 | Ga0373945_0002940_377_1402 | 323 |
| 193 | 3300035118 | Ga0373954_0007087 | Ga0373954_0007087_38_1063 | 323 |
| 194 | 3300035119 | Ga0373956_0013792 | Ga0373956_0013792_491_1516 | 323 |
| 195 | 3300035120 | Ga0373957_0007950 | Ga0373957_0007950_1542_2567 | 323 |
| 196 | 3300035170 | Ga0373943_0033867 | Ga0373943_0033867_581_1606 | 323 |
| 197 | 3300035172 | Ga0373955_0000069 | Ga0373955_0000069_1568_2593 | 323 |
| 198 | 3300035410 | Ga0373924_0004716 | Ga0373924_0004716_350_1375 | 323 |
| 199 | 3300035692 | Ga0373935_0000207 | Ga0373935_0000207_21521_22546 | 323 |
| 200 | 3300035695 | Ga0373927_0007692 | Ga0373927_0007692_455_1480 | 323 |
| 201 | 3300035695 | Ga0373927_0077712 | Ga0373927_0077712_17_1063 | 323 |
| 202 | 3300035725 | Ga0373947_0000313 | Ga0373947_0000313_2815_3840 | 323 |
| 203 | 3300036401 | Ga0373937_0000385 | Ga0373937_0000385_14604_15629 | 323 |
| 204 | 3300037068 | Ga0373925_0000038 | Ga0373925_0000038_130668_131693 | 323 |
| 205 | 3300046454 | Ga0495592_0000090 | Ga0495592_0000090_54595_55620 | 323 |
| 206 | 3300046459 | Ga0495629_0007111 | Ga0495629_0007111_6739_7764 | 323 |
| 207 | 3300046462 | Ga0495651_0000396 | Ga0495651_0000396_4508_5533 | 323 |
| 208 | 3300046463 | Ga0495653_0000107 | Ga0495653_0000107_52625_53650 | 323 |
| 209 | 3300046476 | Ga0495662_0003350 | Ga0495662_0003350_965_1990 | 323 |
| 210 | 3300046477 | Ga0495664_0000009 | Ga0495664_0000009_9523_10548 | 323 |
| 211 | 3300046511 | Ga0495608_0000022 | Ga0495608_0000022_107200_108225 | 323 |
| 212 | 3300046514 | Ga0495618_0000016 | Ga0495618_0000016_137028_138053 | 323 |
| 213 | 3300046516 | Ga0495628_0000035 | Ga0495628_0000035_55024_56049 | 323 |
| 214 | 3300046517 | Ga0495630_0000246 | Ga0495630_0000246_10930_11955 | 323 |
| 215 | 3300046529 | Ga0495652_0000062 | Ga0495652_0000062_55036_56061 | 323 |
| 216 | 3300046533 | Ga0495640_0000021 | Ga0495640_0000021_56887_57912 | 323 |
| 217 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_55036_56061 | 323 |
| 218 | 3300046536 | Ga0495587_0124842 | Ga0495587_0124842_402_1427 | 323 |
| 219 | 3300046543 | Ga0495645_0000090 | Ga0495645_0000090_52641_53666 | 323 |
| 220 | 3300046559 | Ga0495667_0000011 | Ga0495667_0000011_211788_212813 | 323 |
| 221 | 3300046642 | Ga0495634_0000291 | Ga0495634_0000291_10228_11253 | 323 |
| 222 | 3300046663 | Ga0495635_0000018 | Ga0495635_0000018_137953_138978 | 323 |
| 223 | 3300046675 | Ga0495657_0004577 | Ga0495657_0004577_4812_5837 | 323 |
| 224 | 3300046678 | Ga0495599_0000032 | Ga0495599_0000032_52636_53661 | 323 |
| 225 | 3300046679 | Ga0495623_0000099 | Ga0495623_0000099_15470_16495 | 323 |
| 226 | 3300046680 | Ga0495646_0000045 | Ga0495646_0000045_9716_10741 | 323 |
| 227 | 3300046689 | Ga0495613_0023198 | Ga0495613_0023198_2100_3125 | 323 |
| 228 | 3300046809 | Ga0495600_0000022 | Ga0495600_0000022_36878_37903 | 323 |
| 229 | 3300047315 | Ga0495581_0077009 | Ga0495581_0077009_473_1498 | 323 |
| 230 | 3300047315 | Ga0495581_0200855 | Ga0495581_0200855_116_1141 | 323 |
| 231 | 3300047317 | Ga0495604_0000011 | Ga0495604_0000011_54614_55639 | 323 |
| 232 | 3300047319 | Ga0495674_0000034 | Ga0495674_0000034_55036_56061 | 323 |
| 233 | 3300047322 | Ga0495680_0000290 | Ga0495680_0000290_54607_55632 | 323 |
| 234 | 3300047444 | Ga0495675_0004665 | Ga0495675_0004665_363_1388 | 323 |
| 235 | 3300047471 | Ga0495684_0000012 | Ga0495684_0000012_129322_130347 | 323 |
| 236 | 3300047673 | Ga0495593_0008117 | Ga0495593_0008117_4203_5228 | 323 |
| 237 | 3300048088 | Ga0495602_0000064 | Ga0495602_0000064_54614_55639 | 323 |
| 238 | 3300048928 | Ga0496125_0109666 | Ga0496125_0109666_651_1694 | 323 |
| 239 | 3300050514 | nmdc:mga08x19_133822_c1 | nmdc:mga08x19_133822_c1_166_1191 | 323 |
| 240 | 3300053077 | Ga0495601_0000015 | Ga0495601_0000015_54614_55639 | 323 |
| 241 | 3300053078 | Ga0495612_0000016 | Ga0495612_0000016_16848_17873 | 323 |
| 242 | 3300053084 | Ga0495595_0000035 | Ga0495595_0000035_24241_25266 | 323 |
| 243 | 3300053085 | Ga0495619_0000044 | Ga0495619_0000044_54914_55939 | 323 |
| 244 | 3300053102 | Ga0500554_003915 | Ga0500554_003915_1219_2265 | 323 |
| 245 | 3300053119 | Ga0500595_000068 | Ga0500595_000068_68926_69972 | 323 |
| 246 | 3300053162 | Ga0500638_007519 | Ga0500638_007519_1114_2160 | 323 |
| 247 | 3300053178 | Ga0500637_0000128 | Ga0500637_0000128_6374_7420 | 323 |
| 248 | 3300055283 | Ga0500661_000237 | Ga0500661_000237_6134_7180 | 323 |
| 249 | 3300005842 | Ga0068858_100158478 | Ga0068858_1001584782 | 324 |
| 250 | 3300005844 | Ga0068862_100264520 | Ga0068862_1002645201 | 324 |
| 251 | 3300005981 | Ga0081538_10034008 | Ga0081538_100340083 | 324 |
| 252 | 3300009174 | Ga0105241_10127920 | Ga0105241_101279202 | 324 |
| 253 | 3300021377 | Ga0213874_10012496 | Ga0213874_100124962 | 324 |
| 254 | 3300025911 | Ga0207654_10185046 | Ga0207654_101850462 | 324 |
| 255 | 3300028380 | Ga0268265_10326615 | Ga0268265_103266151 | 324 |
| 256 | 3300035725 | Ga0373947_0061244 | Ga0373947_0061244_773_1822 | 324 |
| 257 | 3300039450 | Ga0436363_0823495 | Ga0436363_0823495_422_1477 | 324 |
| 258 | 3300046684 | Ga0495669_0045412 | Ga0495669_0045412_548_1591 | 324 |
| 259 | 3300047471 | Ga0495684_0039328 | Ga0495684_0039328_2274_3296 | 324 |
| 260 | 3300048903 | Ga0496100_0000907 | Ga0496100_0000907_12429_13478 | 324 |
| 261 | 3300048905 | Ga0496102_0053595 | Ga0496102_0053595_920_1969 | 324 |
| 262 | 3300048908 | Ga0496105_0026526 | Ga0496105_0026526_3579_4628 | 324 |
| 263 | 3300048910 | Ga0496107_0010934 | Ga0496107_0010934_4915_5964 | 324 |
| 264 | 3300048914 | Ga0496111_0014311 | Ga0496111_0014311_2491_3540 | 324 |
| 265 | 3300048915 | Ga0496112_0041429 | Ga0496112_0041429_3269_4318 | 324 |
| 266 | 3300048918 | Ga0496115_0032159 | Ga0496115_0032159_649_1698 | 324 |
| 267 | 3300049568 | Ga0501031_0011996 | Ga0501031_0011996_465_1505 | 324 |
| 268 | 3300049569 | Ga0501032_0052919 | Ga0501032_0052919_152_1192 | 324 |
| 269 | 3300049570 | Ga0501033_0012533 | Ga0501033_0012533_981_2021 | 324 |
| 270 | 3300049572 | Ga0501036_0038418 | Ga0501036_0038418_836_1876 | 324 |
| 271 | 3300049574 | Ga0501038_0026844 | Ga0501038_0026844_696_1736 | 324 |
| 272 | 3300049579 | Ga0501043_0278250 | Ga0501043_0278250_151_1191 | 324 |
| 273 | 3300049581 | Ga0501047_0221671 | Ga0501047_0221671_488_1528 | 324 |
| 274 | 3300049586 | Ga0501070_0220028 | Ga0501070_0220028_202_1242 | 324 |
| 275 | 3300049744 | Ga0501083_0067192 | Ga0501083_0067192_803_1873 | 324 |
| 276 | 3300049822 | Ga0501035_0101156 | Ga0501035_0101156_733_1773 | 324 |
| 277 | 3300049823 | Ga0501044_0030230 | Ga0501044_0030230_4518_5558 | 324 |
| 278 | 3300050513 | nmdc:mga0rr50_222433_c1 | nmdc:mga0rr50_222433_c1_231_1262 | 324 |
| 279 | 3300050514 | nmdc:mga08x19_2162_c1 | nmdc:mga08x19_2162_c1_3499_4530 | 324 |
| 280 | 3300005335 | Ga0070666_10344062 | Ga0070666_103440621 | 325 |
| 281 | 3300005339 | Ga0070660_100089111 | Ga0070660_1000891113 | 325 |
| 282 | 3300005355 | Ga0070671_100090643 | Ga0070671_1000906432 | 325 |
| 283 | 3300005436 | Ga0070713_100139129 | Ga0070713_1001391293 | 325 |
| 284 | 3300005444 | Ga0070694_100070698 | Ga0070694_1000706982 | 325 |
| 285 | 3300005543 | Ga0070672_100341504 | Ga0070672_1003415041 | 325 |
| 286 | 3300005546 | Ga0070696_100046991 | Ga0070696_1000469914 | 325 |
| 287 | 3300005564 | Ga0070664_100197236 | Ga0070664_1001972362 | 325 |
| 288 | 3300005614 | Ga0068856_100124187 | Ga0068856_1001241873 | 325 |
| 289 | 3300005615 | Ga0070702_100075651 | Ga0070702_1000756512 | 325 |
| 290 | 3300009098 | Ga0105245_10070958 | Ga0105245_100709583 | 325 |
| 291 | 3300009148 | Ga0105243_10030920 | Ga0105243_100309203 | 325 |
| 292 | 3300009174 | Ga0105241_10317682 | Ga0105241_103176822 | 325 |
| 293 | 3300009176 | Ga0105242_10023413 | Ga0105242_100234133 | 325 |
| 294 | 3300009177 | Ga0105248_10091898 | Ga0105248_100918982 | 325 |
| 295 | 3300009545 | Ga0105237_10101566 | Ga0105237_101015662 | 325 |
| 296 | 3300009551 | Ga0105238_10156614 | Ga0105238_101566142 | 325 |
| 297 | 3300009553 | Ga0105249_10270150 | Ga0105249_102701502 | 325 |
| 298 | 3300010375 | Ga0105239_10158383 | Ga0105239_101583832 | 325 |
| 299 | 3300013297 | Ga0157378_10069174 | Ga0157378_100691742 | 325 |
| 300 | 3300013308 | Ga0157375_10016004 | Ga0157375_100160043 | 325 |
| 301 | 3300014968 | Ga0157379_10033973 | Ga0157379_100339733 | 325 |
| 302 | 3300025915 | Ga0207693_10014507 | Ga0207693_100145076 | 325 |
| 303 | 3300025919 | Ga0207657_10096509 | Ga0207657_100965093 | 325 |
| 304 | 3300025920 | Ga0207649_10061819 | Ga0207649_100618193 | 325 |
| 305 | 3300025927 | Ga0207687_10150804 | Ga0207687_101508042 | 325 |
| 306 | 3300025932 | Ga0207690_10053678 | Ga0207690_100536783 | 325 |
| 307 | 3300025933 | Ga0207706_10028751 | Ga0207706_100287513 | 325 |
| 308 | 3300025934 | Ga0207686_10250803 | Ga0207686_102508032 | 325 |
| 309 | 3300025935 | Ga0207709_10233867 | Ga0207709_102338671 | 325 |
| 310 | 3300025937 | Ga0207669_10093736 | Ga0207669_100937361 | 325 |
| 311 | 3300025938 | Ga0207704_10023798 | Ga0207704_100237983 | 325 |
| 312 | 3300025940 | Ga0207691_10432576 | Ga0207691_104325761 | 325 |
| 313 | 3300026035 | Ga0207703_10134658 | Ga0207703_101346583 | 325 |
| 314 | 3300026078 | Ga0207702_10202082 | Ga0207702_102020822 | 325 |
| 315 | 3300026121 | Ga0207683_10023336 | Ga0207683_100233362 | 325 |
| 316 | 3300031238 | Ga0265332_10000741 | Ga0265332_1000074111 | 325 |
| 317 | 3300031247 | Ga0265340_10001287 | Ga0265340_1000128714 | 325 |
| 318 | 3300031250 | Ga0265331_10033558 | Ga0265331_100335582 | 325 |
| 319 | 3300031712 | Ga0265342_10000109 | Ga0265342_1000010939 | 325 |
| 320 | 3300035083 | Ga0373926_0001552 | Ga0373926_0001552_2382_3422 | 325 |
| 321 | 3300035086 | Ga0373934_0006859 | Ga0373934_0006859_1744_2784 | 325 |
| 322 | 3300035111 | Ga0373923_0005076 | Ga0373923_0005076_1892_2932 | 325 |
| 323 | 3300035117 | Ga0373953_0006521 | Ga0373953_0006521_2404_3444 | 325 |
| 324 | 3300035118 | Ga0373954_0004278 | Ga0373954_0004278_1617_2657 | 325 |
| 325 | 3300035119 | Ga0373956_0004206 | Ga0373956_0004206_1839_2879 | 325 |
| 326 | 3300035120 | Ga0373957_0003413 | Ga0373957_0003413_1146_2186 | 325 |
| 327 | 3300035170 | Ga0373943_0007946 | Ga0373943_0007946_2979_4019 | 325 |
| 328 | 3300035171 | Ga0373946_0006482 | Ga0373946_0006482_458_1498 | 325 |
| 329 | 3300035172 | Ga0373955_0026669 | Ga0373955_0026669_320_1360 | 325 |
| 330 | 3300035410 | Ga0373924_0009743 | Ga0373924_0009743_290_1330 | 325 |
| 331 | 3300035691 | Ga0373931_0142214 | Ga0373931_0142214_152_1192 | 325 |
| 332 | 3300035695 | Ga0373927_0034470 | Ga0373927_0034470_71_1111 | 325 |
| 333 | 3300036401 | Ga0373937_0009142 | Ga0373937_0009142_3337_4377 | 325 |
| 334 | 3300037068 | Ga0373925_0058405 | Ga0373925_0058405_1016_2056 | 325 |
| 335 | 3300046454 | Ga0495592_0032282 | Ga0495592_0032282_2247_3287 | 325 |
| 336 | 3300046455 | Ga0495603_0029788 | Ga0495603_0029788_2175_3215 | 325 |
| 337 | 3300046461 | Ga0495641_0037006 | Ga0495641_0037006_216_1256 | 325 |
| 338 | 3300046462 | Ga0495651_0007457 | Ga0495651_0007457_4136_5176 | 325 |
| 339 | 3300046463 | Ga0495653_0002676 | Ga0495653_0002676_9118_10158 | 325 |
| 340 | 3300046472 | Ga0495580_0025839 | Ga0495580_0025839_1298_2338 | 325 |
| 341 | 3300046473 | Ga0495582_0048377 | Ga0495582_0048377_1150_2190 | 325 |
| 342 | 3300046475 | Ga0495639_0011034 | Ga0495639_0011034_489_1529 | 325 |
| 343 | 3300046476 | Ga0495662_0007266 | Ga0495662_0007266_2262_3302 | 325 |
| 344 | 3300046477 | Ga0495664_0001582 | Ga0495664_0001582_5465_6505 | 325 |
| 345 | 3300046477 | Ga0495664_0011628 | Ga0495664_0011628_2684_3724 | 325 |
| 346 | 3300046477 | Ga0495664_0114367 | Ga0495664_0114367_443_1489 | 325 |
| 347 | 3300046499 | Ga0495594_0075716 | Ga0495594_0075716_453_1493 | 325 |
| 348 | 3300046511 | Ga0495608_0029573 | Ga0495608_0029573_1603_2643 | 325 |
| 349 | 3300046514 | Ga0495618_0004894 | Ga0495618_0004894_2884_3924 | 325 |
| 350 | 3300046514 | Ga0495618_0054698 | Ga0495618_0054698_1009_2049 | 325 |
| 351 | 3300046516 | Ga0495628_0198212 | Ga0495628_0198212_263_1303 | 325 |
| 352 | 3300046517 | Ga0495630_0084142 | Ga0495630_0084142_710_1756 | 325 |
| 353 | 3300046517 | Ga0495630_0147969 | Ga0495630_0147969_727_1767 | 325 |
| 354 | 3300046526 | Ga0495666_0004260 | Ga0495666_0004260_5687_6727 | 325 |
| 355 | 3300046529 | Ga0495652_0021556 | Ga0495652_0021556_211_1251 | 325 |
| 356 | 3300046531 | Ga0495665_0009811 | Ga0495665_0009811_3666_4706 | 325 |
| 357 | 3300046533 | Ga0495640_0013247 | Ga0495640_0013247_2865_3905 | 325 |
| 358 | 3300046533 | Ga0495640_0014011 | Ga0495640_0014011_787_1827 | 325 |
| 359 | 3300046536 | Ga0495587_0048333 | Ga0495587_0048333_1397_2437 | 325 |
| 360 | 3300046543 | Ga0495645_0001513 | Ga0495645_0001513_7460_8500 | 325 |
| 361 | 3300046642 | Ga0495634_0011447 | Ga0495634_0011447_1298_2338 | 325 |
| 362 | 3300046642 | Ga0495634_0021869 | Ga0495634_0021869_879_1919 | 325 |
| 363 | 3300046663 | Ga0495635_0003726 | Ga0495635_0003726_5627_6667 | 325 |
| 364 | 3300046674 | Ga0495588_0006339 | Ga0495588_0006339_1664_2704 | 325 |
| 365 | 3300046675 | Ga0495657_0002845 | Ga0495657_0002845_2135_3175 | 325 |
| 366 | 3300046678 | Ga0495599_0001644 | Ga0495599_0001644_8548_9588 | 325 |
| 367 | 3300046679 | Ga0495623_0000187 | Ga0495623_0000187_18511_19551 | 325 |
| 368 | 3300046680 | Ga0495646_0004935 | Ga0495646_0004935_211_1251 | 325 |
| 369 | 3300046681 | Ga0495647_0003806 | Ga0495647_0003806_3315_4355 | 325 |
| 370 | 3300046683 | Ga0495658_0023632 | Ga0495658_0023632_1281_2321 | 325 |
| 371 | 3300046689 | Ga0495613_0092162 | Ga0495613_0092162_879_1919 | 325 |
| 372 | 3300046690 | Ga0495624_0066788 | Ga0495624_0066788_881_1921 | 325 |
| 373 | 3300046809 | Ga0495600_0008920 | Ga0495600_0008920_4229_5269 | 325 |
| 374 | 3300047315 | Ga0495581_0040321 | Ga0495581_0040321_478_1518 | 325 |
| 375 | 3300047317 | Ga0495604_0004215 | Ga0495604_0004215_6184_7224 | 325 |
| 376 | 3300047319 | Ga0495674_0016757 | Ga0495674_0016757_5585_6625 | 325 |
| 377 | 3300047321 | Ga0495676_0048198 | Ga0495676_0048198_2169_3209 | 325 |
| 378 | 3300047322 | Ga0495680_0007052 | Ga0495680_0007052_6811_7851 | 325 |
| 379 | 3300047444 | Ga0495675_0000781 | Ga0495675_0000781_12007_13047 | 325 |
| 380 | 3300047673 | Ga0495593_0026064 | Ga0495593_0026064_674_1714 | 325 |
| 381 | 3300048088 | Ga0495602_0004816 | Ga0495602_0004816_1072_2112 | 325 |
| 382 | 3300048904 | Ga0496101_0034822 | Ga0496101_0034822_2156_3196 | 325 |
| 383 | 3300048908 | Ga0496105_0013298 | Ga0496105_0013298_1433_2473 | 325 |
| 384 | 3300048909 | Ga0496106_0098215 | Ga0496106_0098215_303_1343 | 325 |
| 385 | 3300048911 | Ga0496108_0126306 | Ga0496108_0126306_559_1599 | 325 |
| 386 | 3300048912 | Ga0496109_0268469 | Ga0496109_0268469_360_1400 | 325 |
| 387 | 3300048917 | Ga0496114_0211646 | Ga0496114_0211646_611_1651 | 325 |
| 388 | 3300048918 | Ga0496115_0021246 | Ga0496115_0021246_712_1752 | 325 |
| 389 | 3300049586 | Ga0501070_0022631 | Ga0501070_0022631_552_1589 | 325 |
| 390 | 3300053077 | Ga0495601_0023296 | Ga0495601_0023296_909_1949 | 325 |
| 391 | 3300053077 | Ga0495601_0081365 | Ga0495601_0081365_744_1784 | 325 |
| 392 | 3300053077 | Ga0495601_0137015 | Ga0495601_0137015_522_1568 | 325 |
| 393 | 3300053084 | Ga0495595_0001073 | Ga0495595_0001073_6174_7214 | 325 |
| 394 | 3300053085 | Ga0495619_0001648 | Ga0495619_0001648_4726_5766 | 325 |
| 395 | 3300053085 | Ga0495619_0076402 | Ga0495619_0076402_946_1986 | 325 |
| 396 | iso_pu_bacteria | 2643221547 | 2643755081 | 325 |
| 397 | 3300005354 | Ga0070675_100000032 | Ga0070675_10000003215 | 326 |
| 398 | 3300006846 | Ga0075430_100000192 | Ga0075430_10000019218 | 326 |
| 399 | 3300006847 | Ga0075431_100007794 | Ga0075431_10000779411 | 326 |
| 400 | 3300006880 | Ga0075429_100022886 | Ga0075429_1000228865 | 326 |
| 401 | 3300009147 | Ga0114129_10030745 | Ga0114129_100307453 | 326 |
| 402 | 3300009147 | Ga0114129_10161711 | Ga0114129_101617113 | 326 |
| 403 | 3300025916 | Ga0207663_10178224 | Ga0207663_101782242 | 326 |
| 404 | 3300025936 | Ga0207670_10290340 | Ga0207670_102903401 | 326 |
| 405 | 3300031241 | Ga0265325_10000062 | Ga0265325_1000006249 | 326 |
| 406 | 3300035114 | Ga0373939_0044366 | Ga0373939_0044366_278_1321 | 326 |
| 407 | 3300035117 | Ga0373953_0078435 | Ga0373953_0078435_182_1225 | 326 |
| 408 | 3300035119 | Ga0373956_0010260 | Ga0373956_0010260_101_1144 | 326 |
| 409 | 3300035119 | Ga0373956_0047208 | Ga0373956_0047208_832_1875 | 326 |
| 410 | 3300035172 | Ga0373955_0010220 | Ga0373955_0010220_597_1640 | 326 |
| 411 | 3300035172 | Ga0373955_0021712 | Ga0373955_0021712_2011_3054 | 326 |
| 412 | 3300035692 | Ga0373935_0015387 | Ga0373935_0015387_904_1947 | 326 |
| 413 | 3300036401 | Ga0373937_0000851 | Ga0373937_0000851_13742_14785 | 326 |
| 414 | 3300037068 | Ga0373925_0013965 | Ga0373925_0013965_4414_5457 | 326 |
| 415 | 3300046454 | Ga0495592_0010297 | Ga0495592_0010297_2287_3330 | 326 |
| 416 | 3300046454 | Ga0495592_0011377 | Ga0495592_0011377_1835_2878 | 326 |
| 417 | 3300046461 | Ga0495641_0059029 | Ga0495641_0059029_577_1620 | 326 |
| 418 | 3300046462 | Ga0495651_0021404 | Ga0495651_0021404_2362_3405 | 326 |
| 419 | 3300046462 | Ga0495651_0038247 | Ga0495651_0038247_2029_3072 | 326 |
| 420 | 3300046463 | Ga0495653_0023498 | Ga0495653_0023498_1992_3035 | 326 |
| 421 | 3300046463 | Ga0495653_0215520 | Ga0495653_0215520_128_1171 | 326 |
| 422 | 3300046473 | Ga0495582_0021818 | Ga0495582_0021818_1986_3029 | 326 |
| 423 | 3300046475 | Ga0495639_0019367 | Ga0495639_0019367_1087_2130 | 326 |
| 424 | 3300046511 | Ga0495608_0006901 | Ga0495608_0006901_5760_6803 | 326 |
| 425 | 3300046516 | Ga0495628_0001730 | Ga0495628_0001730_18551_19594 | 326 |
| 426 | 3300046526 | Ga0495666_0077976 | Ga0495666_0077976_117_1160 | 326 |
| 427 | 3300046529 | Ga0495652_0000531 | Ga0495652_0000531_18750_19793 | 326 |
| 428 | 3300046529 | Ga0495652_0155482 | Ga0495652_0155482_402_1445 | 326 |
| 429 | 3300046536 | Ga0495587_0048631 | Ga0495587_0048631_1308_2351 | 326 |
| 430 | 3300046543 | Ga0495645_0003462 | Ga0495645_0003462_2267_3310 | 326 |
| 431 | 3300046675 | Ga0495657_0010948 | Ga0495657_0010948_5193_6236 | 326 |
| 432 | 3300046678 | Ga0495599_0002601 | Ga0495599_0002601_639_1682 | 326 |
| 433 | 3300046679 | Ga0495623_0035261 | Ga0495623_0035261_1494_2537 | 326 |
| 434 | 3300046690 | Ga0495624_0093426 | Ga0495624_0093426_577_1620 | 326 |
| 435 | 3300047317 | Ga0495604_0002167 | Ga0495604_0002167_10115_11158 | 326 |
| 436 | 3300047317 | Ga0495604_0024351 | Ga0495604_0024351_3625_4668 | 326 |
| 437 | 3300047319 | Ga0495674_0051042 | Ga0495674_0051042_966_2009 | 326 |
| 438 | 3300047322 | Ga0495680_0001596 | Ga0495680_0001596_19021_20064 | 326 |
| 439 | 3300047673 | Ga0495593_0027723 | Ga0495593_0027723_1260_2303 | 326 |
| 440 | 3300048088 | Ga0495602_0013239 | Ga0495602_0013239_6391_7434 | 326 |
| 441 | 3300048904 | Ga0496101_0038186 | Ga0496101_0038186_1678_2727 | 326 |
| 442 | 3300048907 | Ga0496104_0000273 | Ga0496104_0000273_29809_30852 | 326 |
| 443 | 3300048907 | Ga0496104_0046341 | Ga0496104_0046341_1205_2254 | 326 |
| 444 | 3300048908 | Ga0496105_0004529 | Ga0496105_0004529_1404_2447 | 326 |
| 445 | 3300048908 | Ga0496105_0115171 | Ga0496105_0115171_142_1191 | 326 |
| 446 | 3300048917 | Ga0496114_0046379 | Ga0496114_0046379_1039_2088 | 326 |
| 447 | 3300048918 | Ga0496115_0099490 | Ga0496115_0099490_819_1868 | 326 |
| 448 | 3300049574 | Ga0501038_0059471 | Ga0501038_0059471_1576_2613 | 326 |
| 449 | 3300049575 | Ga0501039_0096064 | Ga0501039_0096064_71_1108 | 326 |
| 450 | 3300049579 | Ga0501043_0007153 | Ga0501043_0007153_1042_2079 | 326 |
| 451 | 3300049581 | Ga0501047_0069970 | Ga0501047_0069970_862_1899 | 326 |
| 452 | 3300049584 | Ga0501068_0013679 | Ga0501068_0013679_3313_4350 | 326 |
| 453 | 3300049585 | Ga0501069_0011527 | Ga0501069_0011527_2578_3615 | 326 |
| 454 | 3300049586 | Ga0501070_0025890 | Ga0501070_0025890_1905_2942 | 326 |
| 455 | 3300049586 | Ga0501070_0215132 | Ga0501070_0215132_19_1059 | 326 |
| 456 | 3300049588 | Ga0501072_0061584 | Ga0501072_0061584_1853_2890 | 326 |
| 457 | 3300049589 | Ga0501073_0022087 | Ga0501073_0022087_2145_3182 | 326 |
| 458 | 3300049590 | Ga0501074_0108894 | Ga0501074_0108894_493_1530 | 326 |
| 459 | 3300049590 | Ga0501074_0316468 | Ga0501074_0316468_49_1089 | 326 |
| 460 | 3300049741 | Ga0501079_0014774 | Ga0501079_0014774_4345_5382 | 326 |
| 461 | 3300049744 | Ga0501083_0044749 | Ga0501083_0044749_1428_2477 | 326 |
| 462 | 3300049823 | Ga0501044_0120059 | Ga0501044_0120059_18_1055 | 326 |
| 463 | 3300050507 | nmdc:mga05p37_99191_c1 | nmdc:mga05p37_99191_c1_1137_2186 | 326 |
| 464 | 3300050509 | nmdc:mga0qj67_130_c1 | nmdc:mga0qj67_130_c1_8857_9909 | 326 |
| 465 | 3300050509 | nmdc:mga0qj67_7319_c1 | nmdc:mga0qj67_7319_c1_4263_5312 | 326 |
| 466 | 3300050510 | nmdc:mga06r32_27981_c1 | nmdc:mga06r32_27981_c1_2093_3142 | 326 |
| 467 | 3300053077 | Ga0495601_0000081 | Ga0495601_0000081_23803_24846 | 326 |
| 468 | 3300053078 | Ga0495612_0000687 | Ga0495612_0000687_11640_12683 | 326 |
| 469 | 3300053084 | Ga0495595_0004961 | Ga0495595_0004961_2134_3177 | 326 |
| 470 | 3300053085 | Ga0495619_0001859 | Ga0495619_0001859_12860_13903 | 326 |
| 471 | 3300053094 | Ga0500566_0138514 | Ga0500566_0138514_36_1079 | 326 |
| 472 | 3300053730 | Ga0500645_000216 | Ga0500645_000216_37277_38344 | 326 |
| 473 | 3300060353 | Ga0501082_0000230 | Ga0501082_0000230_2634_3683 | 326 |
| 474 | 3300005434 | Ga0070709_10031650 | Ga0070709_100316504 | 327 |
| 475 | 3300005435 | Ga0070714_100005190 | Ga0070714_1000051905 | 327 |
| 476 | 3300005439 | Ga0070711_100017594 | Ga0070711_1000175944 | 327 |
| 477 | 3300006163 | Ga0070715_10004079 | Ga0070715_100040794 | 327 |
| 478 | 3300006173 | Ga0070716_100019984 | Ga0070716_1000199844 | 327 |
| 479 | 3300006871 | Ga0075434_100067569 | Ga0075434_1000675693 | 327 |
| 480 | 3300013104 | Ga0157370_10286894 | Ga0157370_102868941 | 327 |
| 481 | 3300025916 | Ga0207663_10000348 | Ga0207663_1000034819 | 327 |
| 482 | 3300025917 | Ga0207660_10246219 | Ga0207660_102462192 | 327 |
| 483 | 3300025925 | Ga0207650_10194166 | Ga0207650_101941661 | 327 |
| 484 | 3300025929 | Ga0207664_10084467 | Ga0207664_100844672 | 327 |
| 485 | 3300025939 | Ga0207665_10000646 | Ga0207665_1000064615 | 327 |
| 486 | 3300026121 | Ga0207683_10079133 | Ga0207683_100791333 | 327 |
| 487 | 3300031852 | Ga0307410_10053160 | Ga0307410_100531603 | 327 |
| 488 | 3300031995 | Ga0307409_100288030 | Ga0307409_1002880302 | 327 |
| 489 | 3300049571 | Ga0501034_0132098 | Ga0501034_0132098_747_1802 | 327 |
| 490 | 3300060353 | Ga0501082_0016001 | Ga0501082_0016001_4823_5878 | 327 |
| 491 | 3300005981 | Ga0081538_10009715 | Ga0081538_100097153 | 328 |
| 492 | 3300006163 | Ga0070715_10051649 | Ga0070715_100516492 | 328 |
| 493 | 3300009098 | Ga0105245_10330640 | Ga0105245_103306402 | 328 |
| 494 | 3300009147 | Ga0114129_10119612 | Ga0114129_101196123 | 328 |
| 495 | 3300009148 | Ga0105243_10119551 | Ga0105243_101195512 | 328 |
| 496 | 3300009551 | Ga0105238_10308413 | Ga0105238_103084132 | 328 |
| 497 | 3300035121 | Ga0373960_0012702 | Ga0373960_0012702_45_1097 | 328 |
| 498 | 3300035242 | Ga0373962_0011082 | Ga0373962_0011082_981_2033 | 328 |
| 499 | 3300039437 | Ga0436365_0846031 | Ga0436365_0846031_185_1270 | 328 |
| 500 | 3300046675 | Ga0495657_0010336 | Ga0495657_0010336_1234_2289 | 328 |
| 501 | 3300047319 | Ga0495674_0247300 | Ga0495674_0247300_313_1356 | 328 |
| 502 | 3300048907 | Ga0496104_0023148 | Ga0496104_0023148_723_1775 | 328 |
| 503 | 3300048909 | Ga0496106_0337594 | Ga0496106_0337594_32_1084 | 328 |
| 504 | 3300050492 | nmdc:mga0yw44_9690_c1 | nmdc:mga0yw44_9690_c1_2350_3405 | 328 |
| 505 | 3300050507 | nmdc:mga05p37_12095_c1 | nmdc:mga05p37_12095_c1_7884_8942 | 328 |
| 506 | 3300002244 | JGI24742J22300_10004103 | JGI24742J22300_100041032 | 329 |
| 507 | 3300002459 | JGI24751J29686_10002127 | JGI24751J29686_100021273 | 329 |
| 508 | 3300005331 | Ga0070670_100064976 | Ga0070670_1000649762 | 329 |
| 509 | 3300005337 | Ga0070682_100070570 | Ga0070682_1000705703 | 329 |
| 510 | 3300005338 | Ga0068868_100002032 | Ga0068868_10000203212 | 329 |
| 511 | 3300005340 | Ga0070689_100060535 | Ga0070689_1000605352 | 329 |
| 512 | 3300005343 | Ga0070687_100015318 | Ga0070687_1000153184 | 329 |
| 513 | 3300005345 | Ga0070692_10076067 | Ga0070692_100760672 | 329 |
| 514 | 3300005354 | Ga0070675_100125656 | Ga0070675_1001256563 | 329 |
| 515 | 3300005355 | Ga0070671_100005241 | Ga0070671_1000052413 | 329 |
| 516 | 3300005356 | Ga0070674_100221671 | Ga0070674_1002216712 | 329 |
| 517 | 3300005364 | Ga0070673_100024738 | Ga0070673_1000247383 | 329 |
| 518 | 3300005366 | Ga0070659_100193674 | Ga0070659_1001936741 | 329 |
| 519 | 3300005438 | Ga0070701_10126742 | Ga0070701_101267422 | 329 |
| 520 | 3300005456 | Ga0070678_100064322 | Ga0070678_1000643222 | 329 |
| 521 | 3300005535 | Ga0070684_100028668 | Ga0070684_1000286683 | 329 |
| 522 | 3300005545 | Ga0070695_100140304 | Ga0070695_1001403042 | 329 |
| 523 | 3300005578 | Ga0068854_100023314 | Ga0068854_1000233144 | 329 |
| 524 | 3300005617 | Ga0068859_100072561 | Ga0068859_1000725613 | 329 |
| 525 | 3300005618 | Ga0068864_100013256 | Ga0068864_1000132567 | 329 |
| 526 | 3300005841 | Ga0068863_100018899 | Ga0068863_1000188994 | 329 |
| 527 | 3300005842 | Ga0068858_100008307 | Ga0068858_1000083073 | 329 |
| 528 | 3300005843 | Ga0068860_100046274 | Ga0068860_1000462742 | 329 |
| 529 | 3300005983 | Ga0081540_1000128 | Ga0081540_10001286 | 329 |
| 530 | 3300006881 | Ga0068865_100029037 | Ga0068865_1000290373 | 329 |
| 531 | 3300006931 | Ga0097620_100072561 | Ga0097620_1000725613 | 329 |
| 532 | 3300017792 | Ga0163161_10061716 | Ga0163161_100617163 | 329 |
| 533 | 3300025321 | Ga0207656_10052762 | Ga0207656_100527622 | 329 |
| 534 | 3300025901 | Ga0207688_10000850 | Ga0207688_1000085012 | 329 |
| 535 | 3300025907 | Ga0207645_10048253 | Ga0207645_100482533 | 329 |
| 536 | 3300025918 | Ga0207662_10000473 | Ga0207662_100004739 | 329 |
| 537 | 3300025919 | Ga0207657_10135423 | Ga0207657_101354232 | 329 |
| 538 | 3300025923 | Ga0207681_10054428 | Ga0207681_100544283 | 329 |
| 539 | 3300025933 | Ga0207706_10008224 | Ga0207706_100082247 | 329 |
| 540 | 3300025936 | Ga0207670_10084208 | Ga0207670_100842082 | 329 |
| 541 | 3300025940 | Ga0207691_10003704 | Ga0207691_100037045 | 329 |
| 542 | 3300025942 | Ga0207689_10002348 | Ga0207689_100023487 | 329 |
| 543 | 3300025945 | Ga0207679_10335081 | Ga0207679_103350811 | 329 |
| 544 | 3300025960 | Ga0207651_10056255 | Ga0207651_100562552 | 329 |
| 545 | 3300025981 | Ga0207640_10135985 | Ga0207640_101359852 | 329 |
| 546 | 3300026035 | Ga0207703_10033233 | Ga0207703_100332332 | 329 |
| 547 | 3300026075 | Ga0207708_10001478 | Ga0207708_1000147812 | 329 |
| 548 | 3300026088 | Ga0207641_10029835 | Ga0207641_100298353 | 329 |
| 549 | 3300026089 | Ga0207648_10004845 | Ga0207648_100048458 | 329 |
| 550 | 3300026095 | Ga0207676_10012844 | Ga0207676_100128443 | 329 |
| 551 | 3300026116 | Ga0207674_10043490 | Ga0207674_100434904 | 329 |
| 552 | 3300026118 | Ga0207675_100007144 | Ga0207675_1000071446 | 329 |
| 553 | 3300026121 | Ga0207683_10065125 | Ga0207683_100651252 | 329 |
| 554 | 3300028380 | Ga0268265_10100007 | Ga0268265_101000071 | 329 |
| 555 | 3300031241 | Ga0265325_10009387 | Ga0265325_100093873 | 329 |
| 556 | 3300031242 | Ga0265329_10032932 | Ga0265329_100329322 | 329 |
| 557 | 3300031249 | Ga0265339_10000016 | Ga0265339_10000016130 | 329 |
| 558 | 3300031595 | Ga0265313_10000060 | Ga0265313_100000609 | 329 |
| 559 | 3300035691 | Ga0373931_0059797 | Ga0373931_0059797_759_1820 | 329 |
| 560 | 3300035695 | Ga0373927_0043667 | Ga0373927_0043667_362_1432 | 329 |
| 561 | 3300048907 | Ga0496104_0006342 | Ga0496104_0006342_734_1795 | 329 |
| 562 | 3300048908 | Ga0496105_0133393 | Ga0496105_0133393_226_1287 | 329 |
| 563 | 3300048918 | Ga0496115_0053892 | Ga0496115_0053892_1434_2495 | 329 |
| 564 | 3300049592 | Ga0501076_0058257 | Ga0501076_0058257_1366_2427 | 329 |
| 565 | 3300049741 | Ga0501079_0227287 | Ga0501079_0227287_143_1204 | 329 |
| 566 | 3300053085 | Ga0495619_0113773 | Ga0495619_0113773_685_1743 | 329 |
| 567 | 3300053119 | Ga0500595_013575 | Ga0500595_013575_925_1995 | 329 |
| 568 | 3300053177 | Ga0500636_0007372 | Ga0500636_0007372_2342_3412 | 329 |
| 569 | 3300009147 | Ga0114129_10267181 | Ga0114129_102671812 | 330 |
| 570 | 3300048910 | Ga0496107_0004948 | Ga0496107_0004948_2383_3429 | 330 |
| 571 | 3300048911 | Ga0496108_0001300 | Ga0496108_0001300_3952_4998 | 330 |
| 572 | 3300048912 | Ga0496109_0005518 | Ga0496109_0005518_3965_5011 | 330 |
| 573 | 3300048914 | Ga0496111_0007704 | Ga0496111_0007704_2622_3668 | 330 |
| 574 | 3300048915 | Ga0496112_0006238 | Ga0496112_0006238_3825_4871 | 330 |
| 575 | 3300048918 | Ga0496115_0016067 | Ga0496115_0016067_3905_4951 | 330 |
| 576 | 3300049571 | Ga0501034_0336839 | Ga0501034_0336839_108_1154 | 330 |
| 577 | 3300053077 | Ga0495601_0035847 | Ga0495601_0035847_1768_2817 | 330 |
| 578 | 3300053084 | Ga0495595_0011345 | Ga0495595_0011345_1982_3031 | 330 |
| 579 | 3300053085 | Ga0495619_0006596 | Ga0495619_0006596_3533_4582 | 330 |
| 580 | iso_pu_bacteria | 2643221651 | 2644289874 | 330 |
| 581 | iso_pu_bacteria | 2667528175 | 2671120902 | 330 |
| 582 | iso_pu_bacteria | 2889033259 | 2889034014 | 330 |
| 583 | iso_pu_bacteria | 2935630451 | 2935633272 | 330 |
| 584 | iso_pu_bacteria | 2941507105 | 2941509426 | 330 |
| 585 | iso_pu_bacteria | 2941515067 | 2941517255 | 330 |
| 586 | iso_pu_bacteria | 2941523033 | 2941526792 | 330 |
| 587 | 3300006038 | Ga0075365_10004187 | Ga0075365_100041875 | 331 |
| 588 | 3300006051 | Ga0075364_10015753 | Ga0075364_100157533 | 331 |
| 589 | 3300006178 | Ga0075367_10019891 | Ga0075367_100198912 | 331 |
| 590 | 3300006186 | Ga0075369_10012776 | Ga0075369_100127764 | 331 |
| 591 | 3300035171 | Ga0373946_0080432 | Ga0373946_0080432_33_1151 | 331 |
| 592 | 3300035725 | Ga0373947_0018325 | Ga0373947_0018325_1891_3009 | 331 |
| 593 | 3300037068 | Ga0373925_0028965 | Ga0373925_0028965_131_1249 | 331 |
| 594 | 3300046533 | Ga0495640_0018589 | Ga0495640_0018589_335_1453 | 331 |
| 595 | 3300047319 | Ga0495674_0032012 | Ga0495674_0032012_1678_2796 | 331 |
| 596 | 3300050490 | nmdc:mga03n38_4275_c1 | nmdc:mga03n38_4275_c1_699_1775 | 331 |
| 597 | 3300050491 | nmdc:mga00v17_19033_c1 | nmdc:mga00v17_19033_c1_2370_3446 | 331 |
| 598 | 3300050494 | nmdc:mga06z11_3146_c1 | nmdc:mga06z11_3146_c1_3250_4326 | 331 |
| 599 | 3300050495 | nmdc:mga04h51_6638_c1 | nmdc:mga04h51_6638_c1_960_2036 | 331 |
| 600 | 3300050516 | nmdc:mga0sz30_3923_c1 | nmdc:mga0sz30_3923_c1_374_1450 | 331 |
| 601 | 3300005981 | Ga0081538_10013135 | Ga0081538_100131356 | 333 |
| 602 | 3300049822 | Ga0501035_0040772 | Ga0501035_0040772_2883_3938 | 333 |
| 603 | 3300001979 | JGI24740J21852_10004166 | JGI24740J21852_100041662 | 334 |
| 604 | 3300005436 | Ga0070713_100021309 | Ga0070713_1000213093 | 334 |
| 605 | 3300005457 | Ga0070662_100171653 | Ga0070662_1001716532 | 334 |
| 606 | 3300005539 | Ga0068853_100015323 | Ga0068853_1000153235 | 334 |
| 607 | 3300005563 | Ga0068855_100052673 | Ga0068855_1000526734 | 334 |
| 608 | 3300005563 | Ga0068855_100359476 | Ga0068855_1003594762 | 334 |
| 609 | 3300005577 | Ga0068857_100085133 | Ga0068857_1000851332 | 334 |
| 610 | 3300005577 | Ga0068857_100093003 | Ga0068857_1000930032 | 334 |
| 611 | 3300005578 | Ga0068854_100032935 | Ga0068854_1000329353 | 334 |
| 612 | 3300005614 | Ga0068856_100026997 | Ga0068856_1000269972 | 334 |
| 613 | 3300005614 | Ga0068856_100039697 | Ga0068856_1000396973 | 334 |
| 614 | 3300005616 | Ga0068852_100155903 | Ga0068852_1001559032 | 334 |
| 615 | 3300005834 | Ga0068851_10009002 | Ga0068851_100090022 | 334 |
| 616 | 3300005841 | Ga0068863_100208583 | Ga0068863_1002085832 | 334 |
| 617 | 3300005842 | Ga0068858_100123684 | Ga0068858_1001236842 | 334 |
| 618 | 3300006038 | Ga0075365_10001566 | Ga0075365_100015669 | 334 |
| 619 | 3300006051 | Ga0075364_10027704 | Ga0075364_100277043 | 334 |
| 620 | 3300006178 | Ga0075367_10025103 | Ga0075367_100251033 | 334 |
| 621 | 3300006178 | Ga0075367_10201713 | Ga0075367_102017131 | 334 |
| 622 | 3300009093 | Ga0105240_10110605 | Ga0105240_101106053 | 334 |
| 623 | 3300009093 | Ga0105240_10215302 | Ga0105240_102153022 | 334 |
| 624 | 3300009174 | Ga0105241_10000279 | Ga0105241_1000027924 | 334 |
| 625 | 3300009545 | Ga0105237_10319045 | Ga0105237_103190451 | 334 |
| 626 | 3300009551 | Ga0105238_10022315 | Ga0105238_100223154 | 334 |
| 627 | 3300010375 | Ga0105239_10029386 | Ga0105239_100293862 | 334 |
| 628 | 3300014325 | Ga0163163_10027040 | Ga0163163_100270403 | 334 |
| 629 | 3300025321 | Ga0207656_10015290 | Ga0207656_100152902 | 334 |
| 630 | 3300025906 | Ga0207699_10104006 | Ga0207699_101040062 | 334 |
| 631 | 3300025911 | Ga0207654_10009490 | Ga0207654_100094905 | 334 |
| 632 | 3300025913 | Ga0207695_10014600 | Ga0207695_100146008 | 334 |
| 633 | 3300025914 | Ga0207671_10175484 | Ga0207671_101754841 | 334 |
| 634 | 3300025916 | Ga0207663_10009766 | Ga0207663_100097665 | 334 |
| 635 | 3300025924 | Ga0207694_10003514 | Ga0207694_100035148 | 334 |
| 636 | 3300025949 | Ga0207667_10020545 | Ga0207667_100205454 | 334 |
| 637 | 3300025949 | Ga0207667_10301103 | Ga0207667_103011032 | 334 |
| 638 | 3300026041 | Ga0207639_10033263 | Ga0207639_100332633 | 334 |
| 639 | 3300026067 | Ga0207678_10080349 | Ga0207678_100803492 | 334 |
| 640 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003117 | 334 |
| 641 | 3300026116 | Ga0207674_10009375 | Ga0207674_100093756 | 334 |
| 642 | 3300026116 | Ga0207674_10012016 | Ga0207674_100120166 | 334 |
| 643 | 3300026142 | Ga0207698_10041773 | Ga0207698_100417731 | 334 |
| 644 | 3300026142 | Ga0207698_10304017 | Ga0207698_103040171 | 334 |
| 645 | 3300046471 | Ga0495650_0022305 | Ga0495650_0022305_1304_2371 | 334 |
| 646 | 3300046616 | Ga0495668_0072446 | Ga0495668_0072446_313_1359 | 334 |
| 647 | 3300048907 | Ga0496104_0024587 | Ga0496104_0024587_3992_5038 | 334 |
| 648 | 3300048911 | Ga0496108_0155205 | Ga0496108_0155205_503_1549 | 334 |
| 649 | 3300048914 | Ga0496111_0023381 | Ga0496111_0023381_711_1757 | 334 |
| 650 | 3300048915 | Ga0496112_0021763 | Ga0496112_0021763_1871_2917 | 334 |
| 651 | 3300048916 | Ga0496113_0002743 | Ga0496113_0002743_2755_3801 | 334 |
| 652 | 3300048918 | Ga0496115_0154383 | Ga0496115_0154383_808_1854 | 334 |
| 653 | 3300048929 | Ga0496126_0254935 | Ga0496126_0254935_289_1335 | 334 |
| 654 | 3300049571 | Ga0501034_0082621 | Ga0501034_0082621_427_1485 | 334 |
| 655 | 3300049581 | Ga0501047_0071339 | Ga0501047_0071339_2270_3328 | 334 |
| 656 | 3300049586 | Ga0501070_0065981 | Ga0501070_0065981_737_1795 | 334 |
| 657 | 3300049823 | Ga0501044_0079770 | Ga0501044_0079770_1995_3053 | 334 |
| 658 | 3300050494 | nmdc:mga06z11_6520_c1 | nmdc:mga06z11_6520_c1_2367_3434 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wry-assembly1.cif.gz_A | crystal structure of helicase complex 2 | 0.7024 | 21 | 68 |
| 7au2-assembly1.cif.gz_A | cryo-em structure of human exostosin-like 3 (extl3) | 0.6985 | 20 | 144 |
| 2z86-assembly2.cif.gz_D | crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp | 0.6941 | 20 | 186 |
| 5uw0-assembly1.cif.gz_A | activated state ygsy2p in complex with udp-2-fluoro-2-deoxy-glucose | 0.693 | 19 | 65 |
| 5nqa-assembly1.cif.gz_A | crystal structure of galnac-t4 in complex with the monoglycopeptide 3 | 0.6805 | 20 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q497B3_19_206_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.8957 | 235 | 298 | 1.20.140.150 |
| af_Q2G2T7_1_208_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8572 | 21 | 227 | 3.90.550.10 |
| af_Q2G2T7_1_208_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8495 | 21 | 227 | 3.90.550.10 |
| af_P77757_4_230_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8149 | 20 | 237 | 3.90.550.10 |
| af_P77293_1_188_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8121 | 21 | 211 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M0WV41-F1-model_v4 | Glycosyltransferase | 0.9049 | 22 | 191 |
GO:0005886
GO:0016757 |
| AF-A0A350UYC4-F1-model_v4 | Glycosyltransferase | 0.9007 | 22 | 204 |
GO:0005886
GO:0016757 |
| AF-A0A401FVE3-F1-model_v4 | Glycosyl transferase family 2 | 0.8963 | 20 | 136 |
GO:0016757
|
| AF-A0A2N2ZS93-F1-model_v4 | Glycosyltransferase | 0.896 | 21 | 204 |
GO:0005886
GO:0099621 |
| AF-A0A381VHB4-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.8917 | 22 | 184 |
GO:0005886
GO:0016757 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar