F473160

General Info

Members Datasets Scaffolds Average Seq Length
658 328 650 341

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10025103|Ga0075367_100251033
Length 355
Sequence MTPLGADISDLTADMRSAAAKGLSIVVPCYNEGAGLPNLHERIAALAAKLKQAYGLATEVIYVDDGSRDDTLVVAQGLPATTLDVNVISLSRNFGKEAALMAGLDHARRGGAVLFMDGDGQHPPAMAETLVRHWVEDGYDVVYTAKAHRNNESPVLRLAVRGFYSLMNFRARHKIPPDAGDFRLLSPRAAAALRQLPERNRFFKGLSSWIGFKQLRVDYNPEPRAHGRTSFNPAALIALSIDGLTSFSVAPLRAAVMLGAAIAFGAFIVGLMILWETFIDGKTVPGYASVIVGVMVLGGMQLVMIGVVGEYIGKIIYELKARPVYFVAEKSLRRAGSDEMQTDLQLAEEPRTAAE

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2643221651 Afipia sp. Root123D2 Isolate Unclassified
3 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
4 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
5 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
6 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
7 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
8 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
319 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
320 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
323 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
324 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 0.61
Rhizoplane 7.9
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004166 3300001979 Bacteria 6243
2 JGI24742J22300_10004103 3300002244 Bacteria 2372
3 JGI24751J29686_10002127 3300002459 Bacteria 4021
4 JGI25406J46586_10005158 3300003203 Bacteria 6062
5 Ga0070670_100064976 3300005331 Bacteria 3130
6 Ga0070666_10344062 3300005335 Bacteria 1066
7 Ga0070680_100022449 3300005336 Bacteria 5027
8 Ga0070682_100000780 3300005337 Bacteria 18750
9 Ga0070682_100043052 3300005337 Bacteria 2790
10 Ga0070682_100070570 3300005337 Bacteria 2234
11 Ga0068868_100002032 3300005338 Bacteria 13916
12 Ga0070660_100089111 3300005339 Bacteria 2431
13 Ga0070689_100060535 3300005340 Bacteria 2944
14 Ga0070689_100423272 3300005340 Bacteria 1129
15 Ga0070687_100015318 3300005343 Bacteria 3464
16 Ga0070692_10076067 3300005345 Bacteria 1799
17 Ga0070675_100000032 3300005354 Bacteria 97014
18 Ga0070675_100125656 3300005354 Bacteria 2181
19 Ga0070671_100005241 3300005355 Bacteria 10331
20 Ga0070671_100090643 3300005355 Bacteria 2560
21 Ga0070674_100221671 3300005356 Bacteria 1471
22 Ga0070673_100024738 3300005364 Bacteria 4407
23 Ga0070659_100193674 3300005366 Bacteria 1671
24 Ga0070667_100263461 3300005367 Bacteria 1544
25 Ga0070709_10031650 3300005434 Bacteria 3183
26 Ga0070714_100005190 3300005435 Bacteria 9912
27 Ga0070714_100153421 3300005435 Bacteria 2077
28 Ga0070713_100021309 3300005436 Bacteria 4982
29 Ga0070713_100139129 3300005436 Bacteria 2148
30 Ga0070710_10000253 3300005437 Bacteria 25297
31 Ga0070701_10126742 3300005438 Bacteria 1446
32 Ga0070711_100005561 3300005439 Bacteria 7546
33 Ga0070711_100017594 3300005439 Bacteria 4553
34 Ga0070711_100337251 3300005439 Bacteria 1209
35 Ga0070694_100070698 3300005444 Bacteria 2404
36 Ga0070663_100082213 3300005455 Bacteria 2369
37 Ga0070678_100064322 3300005456 Bacteria 2718
38 Ga0070662_100171653 3300005457 Bacteria 1703
39 Ga0070681_10022386 3300005458 Bacteria 6346
40 Ga0070679_100166948 3300005530 Bacteria 2174
41 Ga0070684_100028668 3300005535 Bacteria 4711
42 Ga0068853_100013479 3300005539 Bacteria 6675
43 Ga0068853_100015323 3300005539 Bacteria 6298
44 Ga0068853_100369418 3300005539 Bacteria 1338
45 Ga0070672_100341504 3300005543 Bacteria 1275
46 Ga0070695_100140304 3300005545 Bacteria 1675
47 Ga0070696_100046991 3300005546 Bacteria 2994
48 Ga0070693_100003454 3300005547 Bacteria 7369
49 Ga0068855_100052673 3300005563 Bacteria 4790
50 Ga0068855_100359476 3300005563 Bacteria 1602
51 Ga0070664_100197236 3300005564 Bacteria 1795
52 Ga0068857_100085133 3300005577 Bacteria 2825
53 Ga0068857_100093003 3300005577 Bacteria 2700
54 Ga0068857_100130977 3300005577 Bacteria 2262
55 Ga0068854_100023314 3300005578 Bacteria 4226
56 Ga0068854_100032935 3300005578 Bacteria 3610
57 Ga0068856_100026997 3300005614 Bacteria 5601
58 Ga0068856_100039697 3300005614 Bacteria 4622
59 Ga0068856_100124187 3300005614 Bacteria 2584
60 Ga0070702_100075651 3300005615 Bacteria 2002
61 Ga0068852_100155903 3300005616 Bacteria 2127
62 Ga0068859_100072561 3300005617 Bacteria 3479
63 Ga0068864_100013256 3300005618 Bacteria 6828
64 Ga0068866_10112680 3300005718 Bacteria 1521
65 Ga0068851_10009002 3300005834 Bacteria 4633
66 Ga0068863_100018899 3300005841 Bacteria 6594
67 Ga0068863_100208583 3300005841 Bacteria 1881
68 Ga0068858_100008307 3300005842 Bacteria 9983
69 Ga0068858_100123684 3300005842 Bacteria 2421
70 Ga0068858_100158478 3300005842 Bacteria 2131
71 Ga0068860_100046274 3300005843 Bacteria 4148
72 Ga0068860_100199233 3300005843 Bacteria 1940
73 Ga0068860_100203541 3300005843 Bacteria 1919
74 Ga0068862_100264520 3300005844 Bacteria 1571
75 Ga0081455_10018438 3300005937 Bacteria 6650
76 Ga0081455_10027309 3300005937 Bacteria 5232
77 Ga0081538_10009715 3300005981 Bacteria 7980
78 Ga0081538_10013135 3300005981 Bacteria 6577
79 Ga0081538_10034008 3300005981 Bacteria 3380
80 Ga0081538_10041734 3300005981 Bacteria 2906
81 Ga0081540_1000128 3300005983 Bacteria 80512
82 Ga0081539_10004097 3300005985 Bacteria 16636
83 Ga0075365_10001566 3300006038 Bacteria 10488
84 Ga0075365_10002820 3300006038 Bacteria 8708
85 Ga0075365_10004187 3300006038 Bacteria 7596
86 Ga0075368_10004438 3300006042 Bacteria 4758
87 Ga0075364_10015753 3300006051 Bacteria 4693
88 Ga0075364_10027704 3300006051 Bacteria 3622
89 Ga0075364_10119463 3300006051 Bacteria 1764
90 Ga0070715_10004079 3300006163 Bacteria 4745
91 Ga0070715_10051649 3300006163 Bacteria 1770
92 Ga0070716_100019984 3300006173 Bacteria 3510
93 Ga0070716_100024936 3300006173 Bacteria 3185
94 Ga0075367_10019891 3300006178 Bacteria 3730
95 Ga0075367_10025103 3300006178 Bacteria 3367
96 Ga0075367_10201713 3300006178 Bacteria 1243
97 Ga0075369_10012776 3300006186 Bacteria 3319
98 Ga0068871_100040303 3300006358 Bacteria 3741
99 Ga0068871_100091383 3300006358 Bacteria 2537
100 Ga0075428_100016903 3300006844 Bacteria 8057
101 Ga0075430_100000192 3300006846 Bacteria 41250
102 Ga0075430_100093152 3300006846 Bacteria 2519
103 Ga0075431_100007794 3300006847 Bacteria 10664
104 Ga0075431_100071704 3300006847 Bacteria 3574
105 Ga0075434_100067569 3300006871 Bacteria 3560
106 Ga0075434_100217255 3300006871 Bacteria 1932
107 Ga0075429_100022886 3300006880 Bacteria 5418
108 Ga0068865_100029037 3300006881 Bacteria 3665
109 Ga0075436_100030184 3300006914 Bacteria 3731
110 Ga0097620_100072561 3300006931 Bacteria 3479
111 Ga0099795_10001649 3300007788 Bacteria 4940
112 Ga0105250_10016562 3300009092 Bacteria 3000
113 Ga0105240_10110605 3300009093 Bacteria 3325
114 Ga0105240_10215302 3300009093 Bacteria 2242
115 Ga0111539_10000271 3300009094 Bacteria 61942
116 Ga0105245_10001842 3300009098 Bacteria 19297
117 Ga0105245_10070958 3300009098 Bacteria 3162
118 Ga0105245_10330640 3300009098 Bacteria 1504
119 Ga0105247_10011595 3300009101 Bacteria 5309
120 Ga0114129_10001108 3300009147 Bacteria 35473
121 Ga0114129_10030745 3300009147 Bacteria 7594
122 Ga0114129_10119612 3300009147 Bacteria 3628
123 Ga0114129_10161711 3300009147 Bacteria 3058
124 Ga0114129_10267181 3300009147 Bacteria 2290
125 Ga0105243_10030920 3300009148 Bacteria 4126
126 Ga0105243_10119551 3300009148 Bacteria 2219
127 Ga0105241_10000279 3300009174 Bacteria 38098
128 Ga0105241_10047766 3300009174 Bacteria 3256
129 Ga0105241_10127920 3300009174 Bacteria 2053
130 Ga0105241_10317682 3300009174 Bacteria 1342
131 Ga0105241_10320476 3300009174 Bacteria 1336
132 Ga0105242_10023413 3300009176 Bacteria 4866
133 Ga0105248_10026707 3300009177 Bacteria 6420
134 Ga0105248_10028866 3300009177 Bacteria 6184
135 Ga0105248_10091898 3300009177 Bacteria 3418
136 Ga0105237_10101566 3300009545 Bacteria 2868
137 Ga0105237_10319045 3300009545 Bacteria 1557
138 Ga0105238_10022315 3300009551 Bacteria 6453
139 Ga0105238_10037111 3300009551 Bacteria 4955
140 Ga0105238_10077992 3300009551 Bacteria 3304
141 Ga0105238_10156614 3300009551 Bacteria 2253
142 Ga0105238_10308413 3300009551 Bacteria 1567
143 Ga0105249_10270150 3300009553 Bacteria 1694
144 Ga0099796_10025823 3300010159 Bacteria 1860
145 Ga0105239_10020680 3300010375 Bacteria 7261
146 Ga0105239_10029386 3300010375 Bacteria 6043
147 Ga0105239_10158383 3300010375 Bacteria 2529
148 Ga0157370_10026511 3300013104 Bacteria 5721
149 Ga0157370_10286894 3300013104 Bacteria 1520
150 Ga0157369_10001790 3300013105 Bacteria 26002
151 Ga0157369_10506012 3300013105 Bacteria 1250
152 Ga0157374_10022803 3300013296 Bacteria 5591
153 Ga0157378_10069174 3300013297 Bacteria 3167
154 Ga0157378_10172631 3300013297 Bacteria 2029
155 Ga0157372_10006678 3300013307 Bacteria 12273
156 Ga0157375_10016004 3300013308 Bacteria 6728
157 Ga0163163_10027040 3300014325 Bacteria 5490
158 Ga0157380_10086311 3300014326 Bacteria 2578
159 Ga0157379_10033973 3300014968 Bacteria 4546
160 Ga0157379_10047725 3300014968 Bacteria 3821
161 Ga0157376_10034976 3300014969 Bacteria 4060
162 Ga0163161_10061716 3300017792 Bacteria 2729
163 Ga0213874_10012496 3300021377 Bacteria 2179
164 Ga0213876_10115931 3300021384 Bacteria 1421
165 Ga0213875_10000040 3300021388 Bacteria 156362
166 Ga0207656_10015290 3300025321 Bacteria 2968
167 Ga0207656_10052762 3300025321 Bacteria 1762
168 Ga0207692_10000440 3300025898 Bacteria 14667
169 Ga0207692_10025522 3300025898 Bacteria 2761
170 Ga0207642_10071808 3300025899 Bacteria 1650
171 Ga0207688_10000850 3300025901 Bacteria 15383
172 Ga0207699_10000179 3300025906 Bacteria 38433
173 Ga0207699_10104006 3300025906 Bacteria 1807
174 Ga0207645_10048253 3300025907 Bacteria 2719
175 Ga0207654_10009490 3300025911 Bacteria 4944
176 Ga0207654_10185046 3300025911 Bacteria 1361
177 Ga0207707_10037008 3300025912 Bacteria 4264
178 Ga0207695_10014600 3300025913 Bacteria 9289
179 Ga0207671_10175484 3300025914 Bacteria 1666
180 Ga0207693_10014507 3300025915 Bacteria 6333
181 Ga0207663_10000348 3300025916 Bacteria 20103
182 Ga0207663_10002457 3300025916 Bacteria 8919
183 Ga0207663_10009766 3300025916 Bacteria 5078
184 Ga0207663_10178224 3300025916 Bacteria 1515
185 Ga0207660_10246219 3300025917 Bacteria 1410
186 Ga0207662_10000473 3300025918 Bacteria 17944
187 Ga0207657_10096509 3300025919 Bacteria 2459
188 Ga0207657_10135423 3300025919 Bacteria 2016
189 Ga0207649_10061819 3300025920 Bacteria 2359
190 Ga0207652_10063312 3300025921 Bacteria 3198
191 Ga0207681_10054428 3300025923 Bacteria 2721
192 Ga0207694_10003514 3300025924 Bacteria 12437
193 Ga0207650_10194166 3300025925 Bacteria 1623
194 Ga0207687_10040957 3300025927 Bacteria 3178
195 Ga0207687_10150804 3300025927 Bacteria 1774
196 Ga0207700_10035924 3300025928 Bacteria 3574
197 Ga0207664_10084467 3300025929 Bacteria 2590
198 Ga0207690_10053678 3300025932 Bacteria 2706
199 Ga0207706_10008224 3300025933 Bacteria 9624
200 Ga0207706_10028751 3300025933 Bacteria 4962
201 Ga0207686_10250803 3300025934 Bacteria 1293
202 Ga0207709_10233867 3300025935 Bacteria 1333
203 Ga0207670_10084208 3300025936 Bacteria 2232
204 Ga0207670_10290340 3300025936 Bacteria 1277
205 Ga0207669_10093736 3300025937 Bacteria 1963
206 Ga0207704_10023798 3300025938 Bacteria 3308
207 Ga0207665_10000646 3300025939 Bacteria 23470
208 Ga0207665_10002443 3300025939 Bacteria 12562
209 Ga0207665_10176987 3300025939 Bacteria 1543
210 Ga0207691_10003704 3300025940 Bacteria 14824
211 Ga0207691_10167377 3300025940 Bacteria 1926
212 Ga0207691_10432576 3300025940 Bacteria 1121
213 Ga0207711_10136758 3300025941 Bacteria 2201
214 Ga0207689_10002348 3300025942 Bacteria 17690
215 Ga0207679_10335081 3300025945 Bacteria 1314
216 Ga0207667_10012471 3300025949 Bacteria 9788
217 Ga0207667_10020545 3300025949 Bacteria 7339
218 Ga0207667_10301103 3300025949 Bacteria 1638
219 Ga0207651_10056255 3300025960 Bacteria 2706
220 Ga0207640_10135985 3300025981 Bacteria 1784
221 Ga0207640_10312937 3300025981 Bacteria 1247
222 Ga0207658_10168872 3300025986 Bacteria 1800
223 Ga0207703_10033233 3300026035 Bacteria 4087
224 Ga0207703_10134658 3300026035 Bacteria 2138
225 Ga0207703_10166358 3300026035 Bacteria 1936
226 Ga0207639_10033263 3300026041 Bacteria 3802
227 Ga0207639_10069696 3300026041 Bacteria 2744
228 Ga0207639_10359733 3300026041 Bacteria 1302
229 Ga0207678_10080349 3300026067 Bacteria 2792
230 Ga0207708_10001478 3300026075 Bacteria 17560
231 Ga0207702_10000003 3300026078 Bacteria 434196
232 Ga0207702_10202082 3300026078 Bacteria 1843
233 Ga0207641_10029835 3300026088 Bacteria 4511
234 Ga0207648_10004845 3300026089 Bacteria 13728
235 Ga0207676_10012844 3300026095 Bacteria 6013
236 Ga0207674_10009375 3300026116 Bacteria 11195
237 Ga0207674_10012016 3300026116 Bacteria 9700
238 Ga0207674_10043490 3300026116 Bacteria 4631
239 Ga0207674_10327793 3300026116 Bacteria 1481
240 Ga0207675_100007144 3300026118 Bacteria 10554
241 Ga0207683_10023336 3300026121 Bacteria 5321
242 Ga0207683_10065125 3300026121 Bacteria 3213
243 Ga0207683_10079133 3300026121 Bacteria 2914
244 Ga0207698_10041773 3300026142 Bacteria 3420
245 Ga0207698_10304017 3300026142 Bacteria 1486
246 Ga0209179_1018034 3300027512 Bacteria 1345
247 Ga0209179_1021684 3300027512 Bacteria 1255
248 Ga0268265_10100007 3300028380 Bacteria 2339
249 Ga0268265_10326615 3300028380 Bacteria 1392
250 Ga0268264_10167840 3300028381 Bacteria 1983
251 Ga0265332_10000741 3300031238 Bacteria 20288
252 Ga0265325_10000062 3300031241 Bacteria 74697
253 Ga0265325_10009387 3300031241 Bacteria 5712
254 Ga0265325_10046591 3300031241 Bacteria 2248
255 Ga0265325_10054504 3300031241 Bacteria 2046
256 Ga0265329_10032932 3300031242 Bacteria 1678
257 Ga0265340_10001287 3300031247 Bacteria 14395
258 Ga0265340_10017749 3300031247 Bacteria 3681
259 Ga0265340_10047375 3300031247 Bacteria 2094
260 Ga0265339_10000016 3300031249 Bacteria 185313
261 Ga0265339_10021091 3300031249 Bacteria 3797
262 Ga0265331_10005011 3300031250 Bacteria 8120
263 Ga0265331_10033558 3300031250 Bacteria 2537
264 Ga0265316_10139631 3300031344 Bacteria 1821
265 Ga0307513_10188793 3300031456 Bacteria 1915
266 Ga0265313_10000060 3300031595 Bacteria 107224
267 Ga0265313_10010950 3300031595 Bacteria 5680
268 Ga0265342_10000109 3300031712 Bacteria 91321
269 Ga0316578_10003852 3300031728 Bacteria 6961
270 Ga0307516_10043914 3300031730 Bacteria 4426
271 Ga0307516_10055519 3300031730 Bacteria 3865
272 Ga0307410_10053160 3300031852 Bacteria 2740
273 Ga0307409_100288030 3300031995 Unclassified 1522
274 Ga0373926_0001552 3300035083 Bacteria 7052
275 Ga0373926_0004666 3300035083 Bacteria 4500
276 Ga0373934_0006859 3300035086 Bacteria 4228
277 Ga0373923_0005076 3300035111 Bacteria 4438
278 Ga0373923_0020162 3300035111 Bacteria 2587
279 Ga0373923_0068700 3300035111 Bacteria 1518
280 Ga0373936_0002874 3300035113 Bacteria 6431
281 Ga0373939_0044366 3300035114 Bacteria 1353
282 Ga0373945_0002940 3300035116 Bacteria 5352
283 Ga0373945_0004858 3300035116 Bacteria 4281
284 Ga0373953_0006521 3300035117 Bacteria 3851
285 Ga0373953_0078435 3300035117 Bacteria 1370
286 Ga0373954_0004278 3300035118 Bacteria 6134
287 Ga0373954_0007087 3300035118 Bacteria 4893
288 Ga0373956_0004206 3300035119 Bacteria 5773
289 Ga0373956_0010260 3300035119 Bacteria 3834
290 Ga0373956_0013792 3300035119 Bacteria 3366
291 Ga0373956_0047208 3300035119 Bacteria 1926
292 Ga0373957_0003413 3300035120 Bacteria 4692
293 Ga0373957_0007950 3300035120 Bacteria 3415
294 Ga0373960_0012702 3300035121 Bacteria 2097
295 Ga0373943_0007946 3300035170 Bacteria 4762
296 Ga0373943_0033867 3300035170 Bacteria 2436
297 Ga0373943_0128159 3300035170 Bacteria 1356
298 Ga0373946_0005172 3300035171 Bacteria 4703
299 Ga0373946_0006482 3300035171 Bacteria 4243
300 Ga0373946_0080432 3300035171 Bacteria 1426
301 Ga0373955_0000069 3300035172 Bacteria 41106
302 Ga0373955_0010220 3300035172 Bacteria 4425
303 Ga0373955_0021712 3300035172 Bacteria 3245
304 Ga0373955_0026669 3300035172 Bacteria 2979
305 Ga0373955_0128712 3300035172 Bacteria 1477
306 Ga0373961_0015155 3300035241 Bacteria 1967
307 Ga0373962_0011082 3300035242 Bacteria 2255
308 Ga0373924_0004716 3300035410 Bacteria 4782
309 Ga0373924_0009743 3300035410 Bacteria 3527
310 Ga0373924_0075827 3300035410 Bacteria 1424
311 Ga0373931_0009176 3300035691 Bacteria 4723
312 Ga0373931_0059797 3300035691 Bacteria 2050
313 Ga0373931_0142214 3300035691 Bacteria 1391
314 Ga0373935_0000207 3300035692 Bacteria 28322
315 Ga0373935_0015387 3300035692 Bacteria 4624
316 Ga0373927_0007692 3300035695 Bacteria 7291
317 Ga0373927_0015778 3300035695 Bacteria 4984
318 Ga0373927_0034470 3300035695 Bacteria 3292
319 Ga0373927_0043667 3300035695 Bacteria 2901
320 Ga0373927_0077712 3300035695 Bacteria 2150
321 Ga0373927_0082343 3300035695 Bacteria 2086
322 Ga0373947_0000313 3300035725 Bacteria 27468
323 Ga0373947_0018325 3300035725 Bacteria 4030
324 Ga0373947_0061244 3300035725 Bacteria 2287
325 Ga0373937_0000385 3300036401 Bacteria 41073
326 Ga0373937_0000851 3300036401 Bacteria 26158
327 Ga0373937_0000862 3300036401 Bacteria 26051
328 Ga0373937_0009142 3300036401 Bacteria 8597
329 Ga0316584_0003028 3300036712 Bacteria 10823
330 Ga0373925_0000038 3300037068 Bacteria 142088
331 Ga0373925_0006412 3300037068 Bacteria 8660
332 Ga0373925_0013965 3300037068 Bacteria 5813
333 Ga0373925_0028965 3300037068 Bacteria 4060
334 Ga0373925_0058405 3300037068 Bacteria 2892
335 Ga0436364_0393613 3300037853 Bacteria 56153
336 Ga0436365_0097136 3300039437 Bacteria 1899
337 Ga0436365_0279576 3300039437 Bacteria 4000
338 Ga0436365_0846031 3300039437 Bacteria 3570
339 Ga0436363_0823495 3300039450 Bacteria 3304
340 Ga0466963_0035482 3300044694 Bacteria 3249
341 Ga0466957_0015174 3300044842 Bacteria 4498
342 Ga0466959_0057389 3300045049 Bacteria 2838
343 Ga0466958_0022745 3300045836 Bacteria 3675
344 Ga0495592_0000090 3300046454 Bacteria 80171
345 Ga0495592_0010297 3300046454 Bacteria 7049
346 Ga0495592_0011377 3300046454 Bacteria 6731
347 Ga0495592_0032282 3300046454 Bacteria 3952
348 Ga0495603_0010225 3300046455 Bacteria 5679
349 Ga0495603_0029788 3300046455 Bacteria 3290
350 Ga0495629_0007111 3300046459 Bacteria 8245
351 Ga0495629_0053094 3300046459 Bacteria 2836
352 Ga0495638_0003991 3300046460 Bacteria 11345
353 Ga0495641_0019159 3300046461 Bacteria 3510
354 Ga0495641_0037006 3300046461 Bacteria 2289
355 Ga0495641_0059029 3300046461 Bacteria 1734
356 Ga0495641_0126803 3300046461 Bacteria 1139
357 Ga0495651_0000396 3300046462 Bacteria 33745
358 Ga0495651_0007457 3300046462 Bacteria 8365
359 Ga0495651_0021404 3300046462 Bacteria 5026
360 Ga0495651_0038247 3300046462 Bacteria 3736
361 Ga0495651_0156090 3300046462 Bacteria 1640
362 Ga0495653_0000107 3300046463 Bacteria 69282
363 Ga0495653_0002676 3300046463 Bacteria 14187
364 Ga0495653_0023498 3300046463 Bacteria 4978
365 Ga0495653_0110838 3300046463 Bacteria 1972
366 Ga0495653_0215520 3300046463 Bacteria 1294
367 Ga0495650_0022305 3300046471 Bacteria 3040
368 Ga0495580_0025839 3300046472 Bacteria 4288
369 Ga0495580_0085837 3300046472 Bacteria 2192
370 Ga0495582_0021818 3300046473 Bacteria 3503
371 Ga0495582_0048377 3300046473 Bacteria 2341
372 Ga0495639_0011034 3300046475 Bacteria 3893
373 Ga0495639_0019367 3300046475 Bacteria 2970
374 Ga0495662_0003350 3300046476 Bacteria 8125
375 Ga0495662_0007266 3300046476 Bacteria 5482
376 Ga0495664_0000009 3300046477 Bacteria 289534
377 Ga0495664_0001582 3300046477 Bacteria 12075
378 Ga0495664_0011628 3300046477 Bacteria 4966
379 Ga0495664_0114367 3300046477 Bacteria 1630
380 Ga0495664_0155988 3300046477 Bacteria 1385
381 Ga0495584_0047127 3300046491 Bacteria 2174
382 Ga0495585_0041799 3300046492 Bacteria 2570
383 Ga0495594_0075716 3300046499 Bacteria 1876
384 Ga0495594_0088158 3300046499 Bacteria 1737
385 Ga0495608_0000022 3300046511 Bacteria 165111
386 Ga0495608_0006901 3300046511 Bacteria 8043
387 Ga0495608_0029573 3300046511 Bacteria 3714
388 Ga0495618_0000016 3300046514 Bacteria 151770
389 Ga0495618_0004894 3300046514 Bacteria 8186
390 Ga0495618_0054698 3300046514 Bacteria 2526
391 Ga0495628_0000035 3300046516 Bacteria 111560
392 Ga0495628_0001730 3300046516 Bacteria 19868
393 Ga0495628_0198212 3300046516 Bacteria 1513
394 Ga0495630_0000246 3300046517 Bacteria 43555
395 Ga0495630_0084142 3300046517 Bacteria 2402
396 Ga0495630_0105842 3300046517 Bacteria 2130
397 Ga0495630_0147969 3300046517 Bacteria 1786
398 Ga0495666_0004260 3300046526 Bacteria 7212
399 Ga0495666_0077976 3300046526 Bacteria 1569
400 Ga0495666_0085765 3300046526 Bacteria 1487
401 Ga0495652_0000062 3300046529 Bacteria 111572
402 Ga0495652_0000531 3300046529 Bacteria 44460
403 Ga0495652_0021556 3300046529 Bacteria 5726
404 Ga0495652_0155482 3300046529 Bacteria 1781
405 Ga0495665_0009811 3300046531 Bacteria 5183
406 Ga0495665_0095731 3300046531 Bacteria 1559
407 Ga0495640_0000021 3300046533 Bacteria 110511
408 Ga0495640_0013247 3300046533 Bacteria 6270
409 Ga0495640_0014011 3300046533 Bacteria 6084
410 Ga0495640_0018589 3300046533 Bacteria 5148
411 Ga0495587_0000006 3300046536 Bacteria 310070
412 Ga0495587_0048333 3300046536 Bacteria 2519
413 Ga0495587_0048631 3300046536 Bacteria 2511
414 Ga0495587_0124842 3300046536 Bacteria 1473
415 Ga0495598_0001181 3300046537 Bacteria 5045
416 Ga0495645_0000090 3300046543 Bacteria 63443
417 Ga0495645_0001513 3300046543 Bacteria 15682
418 Ga0495645_0003462 3300046543 Bacteria 10707
419 Ga0495667_0000011 3300046559 Bacteria 222545
420 Ga0495667_0086856 3300046559 Bacteria 2028
421 Ga0495668_0030599 3300046616 Bacteria 3039
422 Ga0495668_0072446 3300046616 Bacteria 1893
423 Ga0495634_0000291 3300046642 Bacteria 48026
424 Ga0495634_0011447 3300046642 Bacteria 6456
425 Ga0495634_0021869 3300046642 Bacteria 4513
426 Ga0495635_0000018 3300046663 Bacteria 193591
427 Ga0495635_0003726 3300046663 Bacteria 10580
428 Ga0495635_0029673 3300046663 Bacteria 3804
429 Ga0495588_0002105 3300046674 Bacteria 8543
430 Ga0495588_0006339 3300046674 Bacteria 5325
431 Ga0495657_0002845 3300046675 Bacteria 14362
432 Ga0495657_0004577 3300046675 Bacteria 11043
433 Ga0495657_0010336 3300046675 Bacteria 7027
434 Ga0495657_0010948 3300046675 Bacteria 6803
435 Ga0495599_0000032 3300046678 Bacteria 108178
436 Ga0495599_0001644 3300046678 Bacteria 12894
437 Ga0495599_0002601 3300046678 Bacteria 10524
438 Ga0495623_0000099 3300046679 Bacteria 52531
439 Ga0495623_0000187 3300046679 Bacteria 39206
440 Ga0495623_0035261 3300046679 Bacteria 3207
441 Ga0495646_0000045 3300046680 Bacteria 63367
442 Ga0495646_0004935 3300046680 Bacteria 8425
443 Ga0495647_0003806 3300046681 Bacteria 4854
444 Ga0495658_0023632 3300046683 Bacteria 3264
445 Ga0495658_0068767 3300046683 Bacteria 2051
446 Ga0495669_0045412 3300046684 Bacteria 1959
447 Ga0495613_0023198 3300046689 Bacteria 4623
448 Ga0495613_0034322 3300046689 Bacteria 3768
449 Ga0495613_0092162 3300046689 Bacteria 2194
450 Ga0495624_0064708 3300046690 Bacteria 2285
451 Ga0495624_0066788 3300046690 Bacteria 2245
452 Ga0495624_0093426 3300046690 Bacteria 1854
453 Ga0495670_0027986 3300046691 Bacteria 2794
454 Ga0495600_0000022 3300046809 Bacteria 94789
455 Ga0495600_0008920 3300046809 Bacteria 6176
456 Ga0495581_0040321 3300047315 Bacteria 2702
457 Ga0495581_0077009 3300047315 Bacteria 1930
458 Ga0495581_0200855 3300047315 Bacteria 1166
459 Ga0495581_0216735 3300047315 Bacteria 1119
460 Ga0495604_0000011 3300047317 Bacteria 292024
461 Ga0495604_0002167 3300047317 Bacteria 15769
462 Ga0495604_0004215 3300047317 Bacteria 11385
463 Ga0495604_0024351 3300047317 Bacteria 4828
464 Ga0495604_0061002 3300047317 Bacteria 2886
465 Ga0495674_0000034 3300047319 Bacteria 110674
466 Ga0495674_0016757 3300047319 Bacteria 6835
467 Ga0495674_0032012 3300047319 Bacteria 4773
468 Ga0495674_0051042 3300047319 Bacteria 3647
469 Ga0495674_0247300 3300047319 Bacteria 1468
470 Ga0495676_0048198 3300047321 Bacteria 3437
471 Ga0495680_0000290 3300047322 Bacteria 56506
472 Ga0495680_0001596 3300047322 Bacteria 24170
473 Ga0495680_0007052 3300047322 Bacteria 10356
474 Ga0495680_0025820 3300047322 Bacteria 4856
475 Ga0495675_0000781 3300047444 Bacteria 19671
476 Ga0495675_0004665 3300047444 Bacteria 8324
477 Ga0495684_0000012 3300047471 Bacteria 187118
478 Ga0495684_0039328 3300047471 Bacteria 3625
479 Ga0495593_0008117 3300047673 Bacteria 6109
480 Ga0495593_0026064 3300047673 Bacteria 3231
481 Ga0495593_0027723 3300047673 Bacteria 3115
482 Ga0495602_0000064 3300048088 Bacteria 104858
483 Ga0495602_0004816 3300048088 Bacteria 14117
484 Ga0495602_0013239 3300048088 Bacteria 8437
485 Ga0495614_0074482 3300048089 Bacteria 1466
486 Ga0496100_0000907 3300048903 Bacteria 14109
487 Ga0496100_0013883 3300048903 Bacteria 4661
488 Ga0496101_0034822 3300048904 Bacteria 3559
489 Ga0496101_0038186 3300048904 Bacteria 3410
490 Ga0496101_0099849 3300048904 Bacteria 2170
491 Ga0496102_0053595 3300048905 Bacteria 3676
492 Ga0496102_0056646 3300048905 Bacteria 3576
493 Ga0496102_0248895 3300048905 Bacteria 1675
494 Ga0496104_0000273 3300048907 Bacteria 45919
495 Ga0496104_0006342 3300048907 Bacteria 10403
496 Ga0496104_0023148 3300048907 Bacteria 5711
497 Ga0496104_0024587 3300048907 Bacteria 5541
498 Ga0496104_0046341 3300048907 Bacteria 4094
499 Ga0496105_0004529 3300048908 Bacteria 10472
500 Ga0496105_0006140 3300048908 Bacteria 9205
501 Ga0496105_0013298 3300048908 Bacteria 6531
502 Ga0496105_0026526 3300048908 Bacteria 4727
503 Ga0496105_0115171 3300048908 Bacteria 2217
504 Ga0496105_0133393 3300048908 Bacteria 2046
505 Ga0496106_0098215 3300048909 Bacteria 2268
506 Ga0496106_0337594 3300048909 Bacteria 1210
507 Ga0496107_0004948 3300048910 Bacteria 9068
508 Ga0496107_0010934 3300048910 Bacteria 6313
509 Ga0496107_0059473 3300048910 Bacteria 2765
510 Ga0496108_0001300 3300048911 Bacteria 19621
511 Ga0496108_0016150 3300048911 Bacteria 6086
512 Ga0496108_0126306 3300048911 Bacteria 2196
513 Ga0496108_0155205 3300048911 Bacteria 1976
514 Ga0496109_0005518 3300048912 Bacteria 10593
515 Ga0496109_0268469 3300048912 Bacteria 1607
516 Ga0496110_0012371 3300048913 Bacteria 7016
517 Ga0496111_0007704 3300048914 Bacteria 7081
518 Ga0496111_0014311 3300048914 Bacteria 5417
519 Ga0496111_0023381 3300048914 Bacteria 4338
520 Ga0496112_0006238 3300048915 Bacteria 10446
521 Ga0496112_0021763 3300048915 Bacteria 6101
522 Ga0496112_0041429 3300048915 Bacteria 4506
523 Ga0496112_0161641 3300048915 Bacteria 2206
524 Ga0496113_0002743 3300048916 Bacteria 10355
525 Ga0496113_0048125 3300048916 Bacteria 3171
526 Ga0496114_0022869 3300048917 Bacteria 5095
527 Ga0496114_0046379 3300048917 Bacteria 3611
528 Ga0496114_0066816 3300048917 Bacteria 3015
529 Ga0496114_0211646 3300048917 Bacteria 1700
530 Ga0496115_0016067 3300048918 Bacteria 5693
531 Ga0496115_0021246 3300048918 Bacteria 5012
532 Ga0496115_0032159 3300048918 Bacteria 4138
533 Ga0496115_0053892 3300048918 Bacteria 3229
534 Ga0496115_0082429 3300048918 Bacteria 2620
535 Ga0496115_0099490 3300048918 Bacteria 2383
536 Ga0496115_0154383 3300048918 Bacteria 1896
537 Ga0496125_0109666 3300048928 Bacteria 2003
538 Ga0496126_0254935 3300048929 Bacteria 1461
539 Ga0501031_0011996 3300049568 Bacteria 5651
540 Ga0501032_0021229 3300049569 Bacteria 4516
541 Ga0501032_0052919 3300049569 Bacteria 2735
542 Ga0501033_0012533 3300049570 Bacteria 6469
543 Ga0501033_0019871 3300049570 Bacteria 5076
544 Ga0501034_0082621 3300049571 Bacteria 3214
545 Ga0501034_0132098 3300049571 Bacteria 2479
546 Ga0501034_0217274 3300049571 Bacteria 1865
547 Ga0501034_0336839 3300049571 Bacteria 1439
548 Ga0501036_0038418 3300049572 Bacteria 4051
549 Ga0501038_0026844 3300049574 Bacteria 5127
550 Ga0501038_0059471 3300049574 Bacteria 3273
551 Ga0501039_0096064 3300049575 Bacteria 2310
552 Ga0501043_0007153 3300049579 Bacteria 8877
553 Ga0501043_0014715 3300049579 Bacteria 6125
554 Ga0501043_0278250 3300049579 Bacteria 1283
555 Ga0501047_0009919 3300049581 Bacteria 9005
556 Ga0501047_0069970 3300049581 Bacteria 3378
557 Ga0501047_0071339 3300049581 Bacteria 3343
558 Ga0501047_0221671 3300049581 Bacteria 1747
559 Ga0501068_0013679 3300049584 Bacteria 4621
560 Ga0501069_0011527 3300049585 Bacteria 4684
561 Ga0501070_0022631 3300049586 Bacteria 5262
562 Ga0501070_0025890 3300049586 Bacteria 4921
563 Ga0501070_0065981 3300049586 Bacteria 2997
564 Ga0501070_0127233 3300049586 Bacteria 2105
565 Ga0501070_0215132 3300049586 Bacteria 1577
566 Ga0501070_0220028 3300049586 Bacteria 1557
567 Ga0501072_0002738 3300049588 Bacteria 13230
568 Ga0501072_0061584 3300049588 Bacteria 2960
569 Ga0501073_0022087 3300049589 Bacteria 4585
570 Ga0501074_0108894 3300049590 Bacteria 1982
571 Ga0501074_0316468 3300049590 Bacteria 1108
572 Ga0501076_0058257 3300049592 Bacteria 3070
573 Ga0501079_0014774 3300049741 Bacteria 5953
574 Ga0501079_0227287 3300049741 Bacteria 1458
575 Ga0501083_0044749 3300049744 Bacteria 2996
576 Ga0501083_0067192 3300049744 Bacteria 2387
577 Ga0501035_0036759 3300049822 Bacteria 4437
578 Ga0501035_0040772 3300049822 Bacteria 4194
579 Ga0501035_0101156 3300049822 Bacteria 2529
580 Ga0501044_0030230 3300049823 Bacteria 5709
581 Ga0501044_0063764 3300049823 Bacteria 3763
582 Ga0501044_0079770 3300049823 Bacteria 3316
583 Ga0501044_0120059 3300049823 Bacteria 2630
584 Ga0501044_0322136 3300049823 Bacteria 1470
585 nmdc:mga03n38_4275_c1 3300050490 Bacteria 4704
586 nmdc:mga00v17_172621_c1 3300050491 Bacteria 1394
587 nmdc:mga00v17_19033_c1 3300050491 Bacteria 3913
588 nmdc:mga0yw44_1089_c1 3300050492 Bacteria 10440
589 nmdc:mga0yw44_7700_c1 3300050492 Bacteria 5316
590 nmdc:mga0yw44_9690_c1 3300050492 Bacteria 4889
591 nmdc:mga06z11_3146_c1 3300050494 Bacteria 6370
592 nmdc:mga06z11_6520_c1 3300050494 Bacteria 4756
593 nmdc:mga04h51_6638_c1 3300050495 Bacteria 3012
594 nmdc:mga05p37_12095_c1 3300050507 Bacteria 10302
595 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
596 nmdc:mga05p37_99191_c1 3300050507 Bacteria 3588
597 nmdc:mga09592_6636_c1 3300050508 Bacteria 9425
598 nmdc:mga0qj67_130_c1 3300050509 Bacteria 49784
599 nmdc:mga0qj67_7319_c1 3300050509 Bacteria 8160
600 nmdc:mga06r32_156939_c1 3300050510 Bacteria 2257
601 nmdc:mga06r32_1829_c1 3300050510 Bacteria 18995
602 nmdc:mga06r32_27981_c1 3300050510 Bacteria 5273
603 nmdc:mga06r32_88416_c1 3300050510 Bacteria 3024
604 nmdc:mga08y16_267550_c1 3300050511 Bacteria 1765
605 nmdc:mga08y16_767_c1 3300050511 Bacteria 30554
606 nmdc:mga0rr50_222433_c1 3300050513 Bacteria 1559
607 nmdc:mga08x19_133822_c1 3300050514 Bacteria 1670
608 nmdc:mga08x19_2162_c1 3300050514 Bacteria 12008
609 nmdc:mga08x19_70208_c1 3300050514 Bacteria 2282
610 nmdc:mga0sz30_3923_c1 3300050516 Bacteria 5362
611 Ga0495601_0000015 3300053077 Bacteria 213851
612 Ga0495601_0000081 3300053077 Bacteria 51417
613 Ga0495601_0018837 3300053077 Bacteria 4205
614 Ga0495601_0023296 3300053077 Bacteria 3804
615 Ga0495601_0035847 3300053077 Bacteria 3098
616 Ga0495601_0073460 3300053077 Bacteria 2186
617 Ga0495601_0081365 3300053077 Bacteria 2078
618 Ga0495601_0137015 3300053077 Bacteria 1596
619 Ga0495612_0000016 3300053078 Bacteria 158947
620 Ga0495612_0000687 3300053078 Bacteria 13648
621 Ga0495612_0014554 3300053078 Bacteria 3162
622 Ga0495612_0042786 3300053078 Bacteria 1850
623 Ga0495595_0000035 3300053084 Bacteria 79822
624 Ga0495595_0001073 3300053084 Bacteria 10579
625 Ga0495595_0004961 3300053084 Bacteria 5368
626 Ga0495595_0011345 3300053084 Bacteria 3723
627 Ga0495595_0018770 3300053084 Bacteria 2992
628 Ga0495619_0000044 3300053085 Bacteria 108581
629 Ga0495619_0000270 3300053085 Bacteria 37699
630 Ga0495619_0001648 3300053085 Bacteria 14730
631 Ga0495619_0001859 3300053085 Bacteria 14050
632 Ga0495619_0006596 3300053085 Bacteria 7345
633 Ga0495619_0008987 3300053085 Bacteria 6304
634 Ga0495619_0076402 3300053085 Bacteria 2248
635 Ga0495619_0113773 3300053085 Bacteria 1851
636 Ga0500651_0009647 3300053093 Bacteria 5750
637 Ga0500566_0138514 3300053094 Bacteria 1294
638 Ga0500554_003915 3300053102 Bacteria 3098
639 Ga0500593_005233 3300053117 Bacteria 5087
640 Ga0500595_000068 3300053119 Bacteria 73931
641 Ga0500595_013575 3300053119 Bacteria 3118
642 Ga0500638_007519 3300053162 Bacteria 4566
643 Ga0500636_0007372 3300053177 Bacteria 6361
644 Ga0500637_0000128 3300053178 Bacteria 27550
645 Ga0500645_000216 3300053730 Bacteria 43997
646 Ga0501084_0101144 3300054114 Bacteria 2420
647 Ga0500661_000237 3300055283 Bacteria 9856
648 Ga0501082_0000230 3300060353 Bacteria 48963
649 Ga0501082_0016001 3300060353 Bacteria 6453
650 Ga0501082_0124993 3300060353 Bacteria 2231

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10167377 Ga0207691_101673771 292
2 3300031247 Ga0265340_10047375 Ga0265340_100473753 295
3 3300046462 Ga0495651_0156090 Ga0495651_0156090_653_1618 298
4 3300053085 Ga0495619_0008987 Ga0495619_0008987_417_1376 303
5 3300049569 Ga0501032_0021229 Ga0501032_0021229_899_1909 305
6 3300049570 Ga0501033_0019871 Ga0501033_0019871_258_1268 305
7 3300049579 Ga0501043_0014715 Ga0501043_0014715_2483_3493 305
8 3300049581 Ga0501047_0009919 Ga0501047_0009919_4417_5427 305
9 3300049822 Ga0501035_0036759 Ga0501035_0036759_1878_2888 305
10 3300049823 Ga0501044_0063764 Ga0501044_0063764_166_1176 305
11 3300031728 Ga0316578_10003852 Ga0316578_100038526 306
12 3300036712 Ga0316584_0003028 Ga0316584_0003028_9516_10598 306
13 3300049586 Ga0501070_0127233 Ga0501070_0127233_1003_2028 306
14 3300021388 Ga0213875_10000040 Ga0213875_1000004036 308
15 3300035170 Ga0373943_0128159 Ga0373943_0128159_24_1091 308
16 3300035695 Ga0373927_0082343 Ga0373927_0082343_683_1750 308
17 3300048903 Ga0496100_0013883 Ga0496100_0013883_3034_4101 308
18 3300048905 Ga0496102_0056646 Ga0496102_0056646_2459_3526 308
19 3300048905 Ga0496102_0248895 Ga0496102_0248895_681_1661 308
20 3300048913 Ga0496110_0012371 Ga0496110_0012371_5179_6246 308
21 3300053077 Ga0495601_0073460 Ga0495601_0073460_150_1217 308
22 3300005337 Ga0070682_100043052 Ga0070682_1000430523 309
23 3300005843 Ga0068860_100199233 Ga0068860_1001992333 309
24 3300013105 Ga0157369_10506012 Ga0157369_105060122 309
25 3300025898 Ga0207692_10025522 Ga0207692_100255223 309
26 3300031247 Ga0265340_10017749 Ga0265340_100177493 309
27 3300035410 Ga0373924_0075827 Ga0373924_0075827_204_1187 309
28 3300046459 Ga0495629_0053094 Ga0495629_0053094_1482_2465 309
29 3300046461 Ga0495641_0126803 Ga0495641_0126803_56_1039 309
30 3300046463 Ga0495653_0110838 Ga0495653_0110838_515_1498 309
31 3300046477 Ga0495664_0155988 Ga0495664_0155988_134_1117 309
32 3300046559 Ga0495667_0086856 Ga0495667_0086856_868_1851 309
33 3300046663 Ga0495635_0029673 Ga0495635_0029673_1105_2088 309
34 3300047315 Ga0495581_0216735 Ga0495581_0216735_93_1076 309
35 3300047317 Ga0495604_0061002 Ga0495604_0061002_971_1954 309
36 3300047322 Ga0495680_0025820 Ga0495680_0025820_2157_3140 309
37 3300048089 Ga0495614_0074482 Ga0495614_0074482_50_1033 309
38 3300053077 Ga0495601_0018837 Ga0495601_0018837_930_1907 309
39 3300053078 Ga0495612_0014554 Ga0495612_0014554_1685_2668 309
40 3300053078 Ga0495612_0042786 Ga0495612_0042786_281_1258 309
41 3300053084 Ga0495595_0018770 Ga0495595_0018770_158_1141 309
42 3300053085 Ga0495619_0000270 Ga0495619_0000270_19723_20706 309
43 3300009177 Ga0105248_10026707 Ga0105248_100267078 310
44 3300025941 Ga0207711_10136758 Ga0207711_101367583 310
45 3300035241 Ga0373961_0015155 Ga0373961_0015155_667_1659 310
46 3300035691 Ga0373931_0009176 Ga0373931_0009176_885_1877 310
47 3300048910 Ga0496107_0059473 Ga0496107_0059473_49_1041 310
48 3300048917 Ga0496114_0066816 Ga0496114_0066816_1722_2714 310
49 3300005718 Ga0068866_10112680 Ga0068866_101126802 311
50 3300006358 Ga0068871_100091383 Ga0068871_1000913833 311
51 3300025899 Ga0207642_10071808 Ga0207642_100718082 312
52 3300046460 Ga0495638_0003991 Ga0495638_0003991_7153_8142 313
53 3300048915 Ga0496112_0161641 Ga0496112_0161641_166_1173 313
54 3300049588 Ga0501072_0002738 Ga0501072_0002738_6899_7888 313
55 3300054114 Ga0501084_0101144 Ga0501084_0101144_43_1032 313
56 3300060353 Ga0501082_0124993 Ga0501082_0124993_139_1128 313
57 3300009174 Ga0105241_10047766 Ga0105241_100477662 314
58 3300013104 Ga0157370_10026511 Ga0157370_100265113 314
59 3300013307 Ga0157372_10006678 Ga0157372_100066788 314
60 3300006042 Ga0075368_10004438 Ga0075368_100044382 315
61 3300006051 Ga0075364_10119463 Ga0075364_101194632 315
62 3300009092 Ga0105250_10016562 Ga0105250_100165623 315
63 3300009101 Ga0105247_10011595 Ga0105247_100115954 315
64 3300009174 Ga0105241_10320476 Ga0105241_103204761 315
65 3300009551 Ga0105238_10077992 Ga0105238_100779923 315
66 3300010375 Ga0105239_10020680 Ga0105239_100206807 315
67 3300013105 Ga0157369_10001790 Ga0157369_1000179022 315
68 3300013296 Ga0157374_10022803 Ga0157374_100228035 315
69 3300013297 Ga0157378_10172631 Ga0157378_101726312 315
70 3300014326 Ga0157380_10086311 Ga0157380_100863112 315
71 3300014968 Ga0157379_10047725 Ga0157379_100477253 315
72 3300014969 Ga0157376_10034976 Ga0157376_100349764 315
73 3300035083 Ga0373926_0004666 Ga0373926_0004666_1592_2590 315
74 3300035116 Ga0373945_0004858 Ga0373945_0004858_1050_2048 315
75 3300035171 Ga0373946_0005172 Ga0373946_0005172_2659_3657 315
76 3300035172 Ga0373955_0128712 Ga0373955_0128712_259_1257 315
77 3300035695 Ga0373927_0015778 Ga0373927_0015778_2632_3630 315
78 3300037068 Ga0373925_0006412 Ga0373925_0006412_3025_4023 315
79 3300046455 Ga0495603_0010225 Ga0495603_0010225_2843_3841 315
80 3300046461 Ga0495641_0019159 Ga0495641_0019159_1526_2524 315
81 3300046472 Ga0495580_0085837 Ga0495580_0085837_1112_2110 315
82 3300046491 Ga0495584_0047127 Ga0495584_0047127_328_1326 315
83 3300046492 Ga0495585_0041799 Ga0495585_0041799_854_1852 315
84 3300046499 Ga0495594_0088158 Ga0495594_0088158_402_1400 315
85 3300046517 Ga0495630_0105842 Ga0495630_0105842_668_1666 315
86 3300046526 Ga0495666_0085765 Ga0495666_0085765_146_1144 315
87 3300046531 Ga0495665_0095731 Ga0495665_0095731_40_1038 315
88 3300046537 Ga0495598_0001181 Ga0495598_0001181_3169_4167 315
89 3300046616 Ga0495668_0030599 Ga0495668_0030599_1032_2030 315
90 3300046674 Ga0495588_0002105 Ga0495588_0002105_6148_7146 315
91 3300046683 Ga0495658_0068767 Ga0495658_0068767_963_1961 315
92 3300046689 Ga0495613_0034322 Ga0495613_0034322_550_1548 315
93 3300046690 Ga0495624_0064708 Ga0495624_0064708_682_1680 315
94 3300046691 Ga0495670_0027986 Ga0495670_0027986_1425_2423 315
95 3300048904 Ga0496101_0099849 Ga0496101_0099849_1049_2047 315
96 3300048908 Ga0496105_0006140 Ga0496105_0006140_4155_5153 315
97 3300048911 Ga0496108_0016150 Ga0496108_0016150_358_1356 315
98 3300048916 Ga0496113_0048125 Ga0496113_0048125_358_1356 315
99 3300048917 Ga0496114_0022869 Ga0496114_0022869_2602_3600 315
100 3300048918 Ga0496115_0082429 Ga0496115_0082429_1499_2497 315
101 3300050491 nmdc:mga00v17_172621_c1 nmdc:mga00v17_172621_c1_321_1355 315
102 3300050492 nmdc:mga0yw44_7700_c1 nmdc:mga0yw44_7700_c1_3902_4900 315
103 3300050510 nmdc:mga06r32_88416_c1 nmdc:mga06r32_88416_c1_623_1639 315
104 3300050511 nmdc:mga08y16_267550_c1 nmdc:mga08y16_267550_c1_152_1150 315
105 3300053093 Ga0500651_0009647 Ga0500651_0009647_1483_2493 315
106 3300053117 Ga0500593_005233 Ga0500593_005233_505_1530 315
107 3300003203 JGI25406J46586_10005158 JGI25406J46586_100051582 316
108 3300005981 Ga0081538_10041734 Ga0081538_100417341 316
109 3300005985 Ga0081539_10004097 Ga0081539_100040979 316
110 3300005435 Ga0070714_100153421 Ga0070714_1001534212 317
111 3300005937 Ga0081455_10018438 Ga0081455_100184386 317
112 3300044694 Ga0466963_0035482 Ga0466963_0035482_232_1263 317
113 3300044842 Ga0466957_0015174 Ga0466957_0015174_137_1168 317
114 3300045049 Ga0466959_0057389 Ga0466959_0057389_533_1564 317
115 3300045836 Ga0466958_0022745 Ga0466958_0022745_804_1835 317
116 3300006038 Ga0075365_10002820 Ga0075365_100028201 318
117 3300006844 Ga0075428_100016903 Ga0075428_1000169033 318
118 3300006846 Ga0075430_100093152 Ga0075430_1000931522 318
119 3300006847 Ga0075431_100071704 Ga0075431_1000717043 318
120 3300031241 Ga0265325_10046591 Ga0265325_100465912 318
121 3300031250 Ga0265331_10005011 Ga0265331_100050117 318
122 3300049823 Ga0501044_0322136 Ga0501044_0322136_339_1388 318
123 3300050492 nmdc:mga0yw44_1089_c1 nmdc:mga0yw44_1089_c1_8291_9313 318
124 3300050510 nmdc:mga06r32_156939_c1 nmdc:mga06r32_156939_c1_911_1933 318
125 3300049571 Ga0501034_0217274 Ga0501034_0217274_654_1673 319
126 3300006871 Ga0075434_100217255 Ga0075434_1002172552 320
127 3300031241 Ga0265325_10054504 Ga0265325_100545042 321
128 3300031249 Ga0265339_10021091 Ga0265339_100210912 321
129 3300031344 Ga0265316_10139631 Ga0265316_101396311 321
130 3300031595 Ga0265313_10010950 Ga0265313_100109504 321
131 3300005340 Ga0070689_100423272 Ga0070689_1004232721 322
132 3300005367 Ga0070667_100263461 Ga0070667_1002634612 322
133 3300005539 Ga0068853_100369418 Ga0068853_1003694181 322
134 3300005843 Ga0068860_100203541 Ga0068860_1002035412 322
135 3300005937 Ga0081455_10027309 Ga0081455_100273092 322
136 3300006358 Ga0068871_100040303 Ga0068871_1000403033 322
137 3300006914 Ga0075436_100030184 Ga0075436_1000301842 322
138 3300009094 Ga0111539_10000271 Ga0111539_100002715 322
139 3300009098 Ga0105245_10001842 Ga0105245_100018425 322
140 3300009147 Ga0114129_10001108 Ga0114129_1000110813 322
141 3300009177 Ga0105248_10028866 Ga0105248_100288667 322
142 3300021384 Ga0213876_10115931 Ga0213876_101159312 322
143 3300025927 Ga0207687_10040957 Ga0207687_100409573 322
144 3300025981 Ga0207640_10312937 Ga0207640_103129372 322
145 3300025986 Ga0207658_10168872 Ga0207658_101688722 322
146 3300026035 Ga0207703_10166358 Ga0207703_101663582 322
147 3300026041 Ga0207639_10359733 Ga0207639_103597332 322
148 3300028381 Ga0268264_10167840 Ga0268264_101678401 322
149 3300031456 Ga0307513_10188793 Ga0307513_101887932 322
150 3300031730 Ga0307516_10043914 Ga0307516_100439144 322
151 3300031730 Ga0307516_10055519 Ga0307516_100555193 322
152 3300035111 Ga0373923_0068700 Ga0373923_0068700_174_1253 322
153 3300036401 Ga0373937_0000862 Ga0373937_0000862_18130_19209 322
154 3300037853 Ga0436364_0393613 Ga0436364_0393613_47726_48763 322
155 3300039437 Ga0436365_0097136 Ga0436365_0097136_131_1168 322
156 3300039437 Ga0436365_0279576 Ga0436365_0279576_568_1605 322
157 3300050507 nmdc:mga05p37_57_c1 nmdc:mga05p37_57_c1_88006_89034 322
158 3300050508 nmdc:mga09592_6636_c1 nmdc:mga09592_6636_c1_5978_7006 322
159 3300050510 nmdc:mga06r32_1829_c1 nmdc:mga06r32_1829_c1_6230_7258 322
160 3300050511 nmdc:mga08y16_767_c1 nmdc:mga08y16_767_c1_2113_3141 322
161 3300050514 nmdc:mga08x19_70208_c1 nmdc:mga08x19_70208_c1_1123_2172 322
162 3300005336 Ga0070680_100022449 Ga0070680_1000224492 323
163 3300005337 Ga0070682_100000780 Ga0070682_10000078013 323
164 3300005437 Ga0070710_10000253 Ga0070710_1000025320 323
165 3300005439 Ga0070711_100005561 Ga0070711_1000055616 323
166 3300005439 Ga0070711_100337251 Ga0070711_1003372511 323
167 3300005455 Ga0070663_100082213 Ga0070663_1000822132 323
168 3300005458 Ga0070681_10022386 Ga0070681_100223864 323
169 3300005530 Ga0070679_100166948 Ga0070679_1001669483 323
170 3300005539 Ga0068853_100013479 Ga0068853_1000134794 323
171 3300005547 Ga0070693_100003454 Ga0070693_1000034544 323
172 3300005577 Ga0068857_100130977 Ga0068857_1001309773 323
173 3300006173 Ga0070716_100024936 Ga0070716_1000249362 323
174 3300007788 Ga0099795_10001649 Ga0099795_100016494 323
175 3300009551 Ga0105238_10037111 Ga0105238_100371114 323
176 3300010159 Ga0099796_10025823 Ga0099796_100258232 323
177 3300025898 Ga0207692_10000440 Ga0207692_100004403 323
178 3300025906 Ga0207699_10000179 Ga0207699_1000017917 323
179 3300025912 Ga0207707_10037008 Ga0207707_100370084 323
180 3300025916 Ga0207663_10002457 Ga0207663_100024573 323
181 3300025921 Ga0207652_10063312 Ga0207652_100633123 323
182 3300025928 Ga0207700_10035924 Ga0207700_100359242 323
183 3300025939 Ga0207665_10002443 Ga0207665_100024433 323
184 3300025939 Ga0207665_10176987 Ga0207665_101769871 323
185 3300025949 Ga0207667_10012471 Ga0207667_100124719 323
186 3300026041 Ga0207639_10069696 Ga0207639_100696963 323
187 3300026116 Ga0207674_10327793 Ga0207674_103277932 323
188 3300027512 Ga0209179_1018034 Ga0209179_10180342 323
189 3300027512 Ga0209179_1021684 Ga0209179_10216841 323
190 3300035111 Ga0373923_0020162 Ga0373923_0020162_1126_2151 323
191 3300035113 Ga0373936_0002874 Ga0373936_0002874_3750_4775 323
192 3300035116 Ga0373945_0002940 Ga0373945_0002940_377_1402 323
193 3300035118 Ga0373954_0007087 Ga0373954_0007087_38_1063 323
194 3300035119 Ga0373956_0013792 Ga0373956_0013792_491_1516 323
195 3300035120 Ga0373957_0007950 Ga0373957_0007950_1542_2567 323
196 3300035170 Ga0373943_0033867 Ga0373943_0033867_581_1606 323
197 3300035172 Ga0373955_0000069 Ga0373955_0000069_1568_2593 323
198 3300035410 Ga0373924_0004716 Ga0373924_0004716_350_1375 323
199 3300035692 Ga0373935_0000207 Ga0373935_0000207_21521_22546 323
200 3300035695 Ga0373927_0007692 Ga0373927_0007692_455_1480 323
201 3300035695 Ga0373927_0077712 Ga0373927_0077712_17_1063 323
202 3300035725 Ga0373947_0000313 Ga0373947_0000313_2815_3840 323
203 3300036401 Ga0373937_0000385 Ga0373937_0000385_14604_15629 323
204 3300037068 Ga0373925_0000038 Ga0373925_0000038_130668_131693 323
205 3300046454 Ga0495592_0000090 Ga0495592_0000090_54595_55620 323
206 3300046459 Ga0495629_0007111 Ga0495629_0007111_6739_7764 323
207 3300046462 Ga0495651_0000396 Ga0495651_0000396_4508_5533 323
208 3300046463 Ga0495653_0000107 Ga0495653_0000107_52625_53650 323
209 3300046476 Ga0495662_0003350 Ga0495662_0003350_965_1990 323
210 3300046477 Ga0495664_0000009 Ga0495664_0000009_9523_10548 323
211 3300046511 Ga0495608_0000022 Ga0495608_0000022_107200_108225 323
212 3300046514 Ga0495618_0000016 Ga0495618_0000016_137028_138053 323
213 3300046516 Ga0495628_0000035 Ga0495628_0000035_55024_56049 323
214 3300046517 Ga0495630_0000246 Ga0495630_0000246_10930_11955 323
215 3300046529 Ga0495652_0000062 Ga0495652_0000062_55036_56061 323
216 3300046533 Ga0495640_0000021 Ga0495640_0000021_56887_57912 323
217 3300046536 Ga0495587_0000006 Ga0495587_0000006_55036_56061 323
218 3300046536 Ga0495587_0124842 Ga0495587_0124842_402_1427 323
219 3300046543 Ga0495645_0000090 Ga0495645_0000090_52641_53666 323
220 3300046559 Ga0495667_0000011 Ga0495667_0000011_211788_212813 323
221 3300046642 Ga0495634_0000291 Ga0495634_0000291_10228_11253 323
222 3300046663 Ga0495635_0000018 Ga0495635_0000018_137953_138978 323
223 3300046675 Ga0495657_0004577 Ga0495657_0004577_4812_5837 323
224 3300046678 Ga0495599_0000032 Ga0495599_0000032_52636_53661 323
225 3300046679 Ga0495623_0000099 Ga0495623_0000099_15470_16495 323
226 3300046680 Ga0495646_0000045 Ga0495646_0000045_9716_10741 323
227 3300046689 Ga0495613_0023198 Ga0495613_0023198_2100_3125 323
228 3300046809 Ga0495600_0000022 Ga0495600_0000022_36878_37903 323
229 3300047315 Ga0495581_0077009 Ga0495581_0077009_473_1498 323
230 3300047315 Ga0495581_0200855 Ga0495581_0200855_116_1141 323
231 3300047317 Ga0495604_0000011 Ga0495604_0000011_54614_55639 323
232 3300047319 Ga0495674_0000034 Ga0495674_0000034_55036_56061 323
233 3300047322 Ga0495680_0000290 Ga0495680_0000290_54607_55632 323
234 3300047444 Ga0495675_0004665 Ga0495675_0004665_363_1388 323
235 3300047471 Ga0495684_0000012 Ga0495684_0000012_129322_130347 323
236 3300047673 Ga0495593_0008117 Ga0495593_0008117_4203_5228 323
237 3300048088 Ga0495602_0000064 Ga0495602_0000064_54614_55639 323
238 3300048928 Ga0496125_0109666 Ga0496125_0109666_651_1694 323
239 3300050514 nmdc:mga08x19_133822_c1 nmdc:mga08x19_133822_c1_166_1191 323
240 3300053077 Ga0495601_0000015 Ga0495601_0000015_54614_55639 323
241 3300053078 Ga0495612_0000016 Ga0495612_0000016_16848_17873 323
242 3300053084 Ga0495595_0000035 Ga0495595_0000035_24241_25266 323
243 3300053085 Ga0495619_0000044 Ga0495619_0000044_54914_55939 323
244 3300053102 Ga0500554_003915 Ga0500554_003915_1219_2265 323
245 3300053119 Ga0500595_000068 Ga0500595_000068_68926_69972 323
246 3300053162 Ga0500638_007519 Ga0500638_007519_1114_2160 323
247 3300053178 Ga0500637_0000128 Ga0500637_0000128_6374_7420 323
248 3300055283 Ga0500661_000237 Ga0500661_000237_6134_7180 323
249 3300005842 Ga0068858_100158478 Ga0068858_1001584782 324
250 3300005844 Ga0068862_100264520 Ga0068862_1002645201 324
251 3300005981 Ga0081538_10034008 Ga0081538_100340083 324
252 3300009174 Ga0105241_10127920 Ga0105241_101279202 324
253 3300021377 Ga0213874_10012496 Ga0213874_100124962 324
254 3300025911 Ga0207654_10185046 Ga0207654_101850462 324
255 3300028380 Ga0268265_10326615 Ga0268265_103266151 324
256 3300035725 Ga0373947_0061244 Ga0373947_0061244_773_1822 324
257 3300039450 Ga0436363_0823495 Ga0436363_0823495_422_1477 324
258 3300046684 Ga0495669_0045412 Ga0495669_0045412_548_1591 324
259 3300047471 Ga0495684_0039328 Ga0495684_0039328_2274_3296 324
260 3300048903 Ga0496100_0000907 Ga0496100_0000907_12429_13478 324
261 3300048905 Ga0496102_0053595 Ga0496102_0053595_920_1969 324
262 3300048908 Ga0496105_0026526 Ga0496105_0026526_3579_4628 324
263 3300048910 Ga0496107_0010934 Ga0496107_0010934_4915_5964 324
264 3300048914 Ga0496111_0014311 Ga0496111_0014311_2491_3540 324
265 3300048915 Ga0496112_0041429 Ga0496112_0041429_3269_4318 324
266 3300048918 Ga0496115_0032159 Ga0496115_0032159_649_1698 324
267 3300049568 Ga0501031_0011996 Ga0501031_0011996_465_1505 324
268 3300049569 Ga0501032_0052919 Ga0501032_0052919_152_1192 324
269 3300049570 Ga0501033_0012533 Ga0501033_0012533_981_2021 324
270 3300049572 Ga0501036_0038418 Ga0501036_0038418_836_1876 324
271 3300049574 Ga0501038_0026844 Ga0501038_0026844_696_1736 324
272 3300049579 Ga0501043_0278250 Ga0501043_0278250_151_1191 324
273 3300049581 Ga0501047_0221671 Ga0501047_0221671_488_1528 324
274 3300049586 Ga0501070_0220028 Ga0501070_0220028_202_1242 324
275 3300049744 Ga0501083_0067192 Ga0501083_0067192_803_1873 324
276 3300049822 Ga0501035_0101156 Ga0501035_0101156_733_1773 324
277 3300049823 Ga0501044_0030230 Ga0501044_0030230_4518_5558 324
278 3300050513 nmdc:mga0rr50_222433_c1 nmdc:mga0rr50_222433_c1_231_1262 324
279 3300050514 nmdc:mga08x19_2162_c1 nmdc:mga08x19_2162_c1_3499_4530 324
280 3300005335 Ga0070666_10344062 Ga0070666_103440621 325
281 3300005339 Ga0070660_100089111 Ga0070660_1000891113 325
282 3300005355 Ga0070671_100090643 Ga0070671_1000906432 325
283 3300005436 Ga0070713_100139129 Ga0070713_1001391293 325
284 3300005444 Ga0070694_100070698 Ga0070694_1000706982 325
285 3300005543 Ga0070672_100341504 Ga0070672_1003415041 325
286 3300005546 Ga0070696_100046991 Ga0070696_1000469914 325
287 3300005564 Ga0070664_100197236 Ga0070664_1001972362 325
288 3300005614 Ga0068856_100124187 Ga0068856_1001241873 325
289 3300005615 Ga0070702_100075651 Ga0070702_1000756512 325
290 3300009098 Ga0105245_10070958 Ga0105245_100709583 325
291 3300009148 Ga0105243_10030920 Ga0105243_100309203 325
292 3300009174 Ga0105241_10317682 Ga0105241_103176822 325
293 3300009176 Ga0105242_10023413 Ga0105242_100234133 325
294 3300009177 Ga0105248_10091898 Ga0105248_100918982 325
295 3300009545 Ga0105237_10101566 Ga0105237_101015662 325
296 3300009551 Ga0105238_10156614 Ga0105238_101566142 325
297 3300009553 Ga0105249_10270150 Ga0105249_102701502 325
298 3300010375 Ga0105239_10158383 Ga0105239_101583832 325
299 3300013297 Ga0157378_10069174 Ga0157378_100691742 325
300 3300013308 Ga0157375_10016004 Ga0157375_100160043 325
301 3300014968 Ga0157379_10033973 Ga0157379_100339733 325
302 3300025915 Ga0207693_10014507 Ga0207693_100145076 325
303 3300025919 Ga0207657_10096509 Ga0207657_100965093 325
304 3300025920 Ga0207649_10061819 Ga0207649_100618193 325
305 3300025927 Ga0207687_10150804 Ga0207687_101508042 325
306 3300025932 Ga0207690_10053678 Ga0207690_100536783 325
307 3300025933 Ga0207706_10028751 Ga0207706_100287513 325
308 3300025934 Ga0207686_10250803 Ga0207686_102508032 325
309 3300025935 Ga0207709_10233867 Ga0207709_102338671 325
310 3300025937 Ga0207669_10093736 Ga0207669_100937361 325
311 3300025938 Ga0207704_10023798 Ga0207704_100237983 325
312 3300025940 Ga0207691_10432576 Ga0207691_104325761 325
313 3300026035 Ga0207703_10134658 Ga0207703_101346583 325
314 3300026078 Ga0207702_10202082 Ga0207702_102020822 325
315 3300026121 Ga0207683_10023336 Ga0207683_100233362 325
316 3300031238 Ga0265332_10000741 Ga0265332_1000074111 325
317 3300031247 Ga0265340_10001287 Ga0265340_1000128714 325
318 3300031250 Ga0265331_10033558 Ga0265331_100335582 325
319 3300031712 Ga0265342_10000109 Ga0265342_1000010939 325
320 3300035083 Ga0373926_0001552 Ga0373926_0001552_2382_3422 325
321 3300035086 Ga0373934_0006859 Ga0373934_0006859_1744_2784 325
322 3300035111 Ga0373923_0005076 Ga0373923_0005076_1892_2932 325
323 3300035117 Ga0373953_0006521 Ga0373953_0006521_2404_3444 325
324 3300035118 Ga0373954_0004278 Ga0373954_0004278_1617_2657 325
325 3300035119 Ga0373956_0004206 Ga0373956_0004206_1839_2879 325
326 3300035120 Ga0373957_0003413 Ga0373957_0003413_1146_2186 325
327 3300035170 Ga0373943_0007946 Ga0373943_0007946_2979_4019 325
328 3300035171 Ga0373946_0006482 Ga0373946_0006482_458_1498 325
329 3300035172 Ga0373955_0026669 Ga0373955_0026669_320_1360 325
330 3300035410 Ga0373924_0009743 Ga0373924_0009743_290_1330 325
331 3300035691 Ga0373931_0142214 Ga0373931_0142214_152_1192 325
332 3300035695 Ga0373927_0034470 Ga0373927_0034470_71_1111 325
333 3300036401 Ga0373937_0009142 Ga0373937_0009142_3337_4377 325
334 3300037068 Ga0373925_0058405 Ga0373925_0058405_1016_2056 325
335 3300046454 Ga0495592_0032282 Ga0495592_0032282_2247_3287 325
336 3300046455 Ga0495603_0029788 Ga0495603_0029788_2175_3215 325
337 3300046461 Ga0495641_0037006 Ga0495641_0037006_216_1256 325
338 3300046462 Ga0495651_0007457 Ga0495651_0007457_4136_5176 325
339 3300046463 Ga0495653_0002676 Ga0495653_0002676_9118_10158 325
340 3300046472 Ga0495580_0025839 Ga0495580_0025839_1298_2338 325
341 3300046473 Ga0495582_0048377 Ga0495582_0048377_1150_2190 325
342 3300046475 Ga0495639_0011034 Ga0495639_0011034_489_1529 325
343 3300046476 Ga0495662_0007266 Ga0495662_0007266_2262_3302 325
344 3300046477 Ga0495664_0001582 Ga0495664_0001582_5465_6505 325
345 3300046477 Ga0495664_0011628 Ga0495664_0011628_2684_3724 325
346 3300046477 Ga0495664_0114367 Ga0495664_0114367_443_1489 325
347 3300046499 Ga0495594_0075716 Ga0495594_0075716_453_1493 325
348 3300046511 Ga0495608_0029573 Ga0495608_0029573_1603_2643 325
349 3300046514 Ga0495618_0004894 Ga0495618_0004894_2884_3924 325
350 3300046514 Ga0495618_0054698 Ga0495618_0054698_1009_2049 325
351 3300046516 Ga0495628_0198212 Ga0495628_0198212_263_1303 325
352 3300046517 Ga0495630_0084142 Ga0495630_0084142_710_1756 325
353 3300046517 Ga0495630_0147969 Ga0495630_0147969_727_1767 325
354 3300046526 Ga0495666_0004260 Ga0495666_0004260_5687_6727 325
355 3300046529 Ga0495652_0021556 Ga0495652_0021556_211_1251 325
356 3300046531 Ga0495665_0009811 Ga0495665_0009811_3666_4706 325
357 3300046533 Ga0495640_0013247 Ga0495640_0013247_2865_3905 325
358 3300046533 Ga0495640_0014011 Ga0495640_0014011_787_1827 325
359 3300046536 Ga0495587_0048333 Ga0495587_0048333_1397_2437 325
360 3300046543 Ga0495645_0001513 Ga0495645_0001513_7460_8500 325
361 3300046642 Ga0495634_0011447 Ga0495634_0011447_1298_2338 325
362 3300046642 Ga0495634_0021869 Ga0495634_0021869_879_1919 325
363 3300046663 Ga0495635_0003726 Ga0495635_0003726_5627_6667 325
364 3300046674 Ga0495588_0006339 Ga0495588_0006339_1664_2704 325
365 3300046675 Ga0495657_0002845 Ga0495657_0002845_2135_3175 325
366 3300046678 Ga0495599_0001644 Ga0495599_0001644_8548_9588 325
367 3300046679 Ga0495623_0000187 Ga0495623_0000187_18511_19551 325
368 3300046680 Ga0495646_0004935 Ga0495646_0004935_211_1251 325
369 3300046681 Ga0495647_0003806 Ga0495647_0003806_3315_4355 325
370 3300046683 Ga0495658_0023632 Ga0495658_0023632_1281_2321 325
371 3300046689 Ga0495613_0092162 Ga0495613_0092162_879_1919 325
372 3300046690 Ga0495624_0066788 Ga0495624_0066788_881_1921 325
373 3300046809 Ga0495600_0008920 Ga0495600_0008920_4229_5269 325
374 3300047315 Ga0495581_0040321 Ga0495581_0040321_478_1518 325
375 3300047317 Ga0495604_0004215 Ga0495604_0004215_6184_7224 325
376 3300047319 Ga0495674_0016757 Ga0495674_0016757_5585_6625 325
377 3300047321 Ga0495676_0048198 Ga0495676_0048198_2169_3209 325
378 3300047322 Ga0495680_0007052 Ga0495680_0007052_6811_7851 325
379 3300047444 Ga0495675_0000781 Ga0495675_0000781_12007_13047 325
380 3300047673 Ga0495593_0026064 Ga0495593_0026064_674_1714 325
381 3300048088 Ga0495602_0004816 Ga0495602_0004816_1072_2112 325
382 3300048904 Ga0496101_0034822 Ga0496101_0034822_2156_3196 325
383 3300048908 Ga0496105_0013298 Ga0496105_0013298_1433_2473 325
384 3300048909 Ga0496106_0098215 Ga0496106_0098215_303_1343 325
385 3300048911 Ga0496108_0126306 Ga0496108_0126306_559_1599 325
386 3300048912 Ga0496109_0268469 Ga0496109_0268469_360_1400 325
387 3300048917 Ga0496114_0211646 Ga0496114_0211646_611_1651 325
388 3300048918 Ga0496115_0021246 Ga0496115_0021246_712_1752 325
389 3300049586 Ga0501070_0022631 Ga0501070_0022631_552_1589 325
390 3300053077 Ga0495601_0023296 Ga0495601_0023296_909_1949 325
391 3300053077 Ga0495601_0081365 Ga0495601_0081365_744_1784 325
392 3300053077 Ga0495601_0137015 Ga0495601_0137015_522_1568 325
393 3300053084 Ga0495595_0001073 Ga0495595_0001073_6174_7214 325
394 3300053085 Ga0495619_0001648 Ga0495619_0001648_4726_5766 325
395 3300053085 Ga0495619_0076402 Ga0495619_0076402_946_1986 325
396 iso_pu_bacteria 2643221547 2643755081 325
397 3300005354 Ga0070675_100000032 Ga0070675_10000003215 326
398 3300006846 Ga0075430_100000192 Ga0075430_10000019218 326
399 3300006847 Ga0075431_100007794 Ga0075431_10000779411 326
400 3300006880 Ga0075429_100022886 Ga0075429_1000228865 326
401 3300009147 Ga0114129_10030745 Ga0114129_100307453 326
402 3300009147 Ga0114129_10161711 Ga0114129_101617113 326
403 3300025916 Ga0207663_10178224 Ga0207663_101782242 326
404 3300025936 Ga0207670_10290340 Ga0207670_102903401 326
405 3300031241 Ga0265325_10000062 Ga0265325_1000006249 326
406 3300035114 Ga0373939_0044366 Ga0373939_0044366_278_1321 326
407 3300035117 Ga0373953_0078435 Ga0373953_0078435_182_1225 326
408 3300035119 Ga0373956_0010260 Ga0373956_0010260_101_1144 326
409 3300035119 Ga0373956_0047208 Ga0373956_0047208_832_1875 326
410 3300035172 Ga0373955_0010220 Ga0373955_0010220_597_1640 326
411 3300035172 Ga0373955_0021712 Ga0373955_0021712_2011_3054 326
412 3300035692 Ga0373935_0015387 Ga0373935_0015387_904_1947 326
413 3300036401 Ga0373937_0000851 Ga0373937_0000851_13742_14785 326
414 3300037068 Ga0373925_0013965 Ga0373925_0013965_4414_5457 326
415 3300046454 Ga0495592_0010297 Ga0495592_0010297_2287_3330 326
416 3300046454 Ga0495592_0011377 Ga0495592_0011377_1835_2878 326
417 3300046461 Ga0495641_0059029 Ga0495641_0059029_577_1620 326
418 3300046462 Ga0495651_0021404 Ga0495651_0021404_2362_3405 326
419 3300046462 Ga0495651_0038247 Ga0495651_0038247_2029_3072 326
420 3300046463 Ga0495653_0023498 Ga0495653_0023498_1992_3035 326
421 3300046463 Ga0495653_0215520 Ga0495653_0215520_128_1171 326
422 3300046473 Ga0495582_0021818 Ga0495582_0021818_1986_3029 326
423 3300046475 Ga0495639_0019367 Ga0495639_0019367_1087_2130 326
424 3300046511 Ga0495608_0006901 Ga0495608_0006901_5760_6803 326
425 3300046516 Ga0495628_0001730 Ga0495628_0001730_18551_19594 326
426 3300046526 Ga0495666_0077976 Ga0495666_0077976_117_1160 326
427 3300046529 Ga0495652_0000531 Ga0495652_0000531_18750_19793 326
428 3300046529 Ga0495652_0155482 Ga0495652_0155482_402_1445 326
429 3300046536 Ga0495587_0048631 Ga0495587_0048631_1308_2351 326
430 3300046543 Ga0495645_0003462 Ga0495645_0003462_2267_3310 326
431 3300046675 Ga0495657_0010948 Ga0495657_0010948_5193_6236 326
432 3300046678 Ga0495599_0002601 Ga0495599_0002601_639_1682 326
433 3300046679 Ga0495623_0035261 Ga0495623_0035261_1494_2537 326
434 3300046690 Ga0495624_0093426 Ga0495624_0093426_577_1620 326
435 3300047317 Ga0495604_0002167 Ga0495604_0002167_10115_11158 326
436 3300047317 Ga0495604_0024351 Ga0495604_0024351_3625_4668 326
437 3300047319 Ga0495674_0051042 Ga0495674_0051042_966_2009 326
438 3300047322 Ga0495680_0001596 Ga0495680_0001596_19021_20064 326
439 3300047673 Ga0495593_0027723 Ga0495593_0027723_1260_2303 326
440 3300048088 Ga0495602_0013239 Ga0495602_0013239_6391_7434 326
441 3300048904 Ga0496101_0038186 Ga0496101_0038186_1678_2727 326
442 3300048907 Ga0496104_0000273 Ga0496104_0000273_29809_30852 326
443 3300048907 Ga0496104_0046341 Ga0496104_0046341_1205_2254 326
444 3300048908 Ga0496105_0004529 Ga0496105_0004529_1404_2447 326
445 3300048908 Ga0496105_0115171 Ga0496105_0115171_142_1191 326
446 3300048917 Ga0496114_0046379 Ga0496114_0046379_1039_2088 326
447 3300048918 Ga0496115_0099490 Ga0496115_0099490_819_1868 326
448 3300049574 Ga0501038_0059471 Ga0501038_0059471_1576_2613 326
449 3300049575 Ga0501039_0096064 Ga0501039_0096064_71_1108 326
450 3300049579 Ga0501043_0007153 Ga0501043_0007153_1042_2079 326
451 3300049581 Ga0501047_0069970 Ga0501047_0069970_862_1899 326
452 3300049584 Ga0501068_0013679 Ga0501068_0013679_3313_4350 326
453 3300049585 Ga0501069_0011527 Ga0501069_0011527_2578_3615 326
454 3300049586 Ga0501070_0025890 Ga0501070_0025890_1905_2942 326
455 3300049586 Ga0501070_0215132 Ga0501070_0215132_19_1059 326
456 3300049588 Ga0501072_0061584 Ga0501072_0061584_1853_2890 326
457 3300049589 Ga0501073_0022087 Ga0501073_0022087_2145_3182 326
458 3300049590 Ga0501074_0108894 Ga0501074_0108894_493_1530 326
459 3300049590 Ga0501074_0316468 Ga0501074_0316468_49_1089 326
460 3300049741 Ga0501079_0014774 Ga0501079_0014774_4345_5382 326
461 3300049744 Ga0501083_0044749 Ga0501083_0044749_1428_2477 326
462 3300049823 Ga0501044_0120059 Ga0501044_0120059_18_1055 326
463 3300050507 nmdc:mga05p37_99191_c1 nmdc:mga05p37_99191_c1_1137_2186 326
464 3300050509 nmdc:mga0qj67_130_c1 nmdc:mga0qj67_130_c1_8857_9909 326
465 3300050509 nmdc:mga0qj67_7319_c1 nmdc:mga0qj67_7319_c1_4263_5312 326
466 3300050510 nmdc:mga06r32_27981_c1 nmdc:mga06r32_27981_c1_2093_3142 326
467 3300053077 Ga0495601_0000081 Ga0495601_0000081_23803_24846 326
468 3300053078 Ga0495612_0000687 Ga0495612_0000687_11640_12683 326
469 3300053084 Ga0495595_0004961 Ga0495595_0004961_2134_3177 326
470 3300053085 Ga0495619_0001859 Ga0495619_0001859_12860_13903 326
471 3300053094 Ga0500566_0138514 Ga0500566_0138514_36_1079 326
472 3300053730 Ga0500645_000216 Ga0500645_000216_37277_38344 326
473 3300060353 Ga0501082_0000230 Ga0501082_0000230_2634_3683 326
474 3300005434 Ga0070709_10031650 Ga0070709_100316504 327
475 3300005435 Ga0070714_100005190 Ga0070714_1000051905 327
476 3300005439 Ga0070711_100017594 Ga0070711_1000175944 327
477 3300006163 Ga0070715_10004079 Ga0070715_100040794 327
478 3300006173 Ga0070716_100019984 Ga0070716_1000199844 327
479 3300006871 Ga0075434_100067569 Ga0075434_1000675693 327
480 3300013104 Ga0157370_10286894 Ga0157370_102868941 327
481 3300025916 Ga0207663_10000348 Ga0207663_1000034819 327
482 3300025917 Ga0207660_10246219 Ga0207660_102462192 327
483 3300025925 Ga0207650_10194166 Ga0207650_101941661 327
484 3300025929 Ga0207664_10084467 Ga0207664_100844672 327
485 3300025939 Ga0207665_10000646 Ga0207665_1000064615 327
486 3300026121 Ga0207683_10079133 Ga0207683_100791333 327
487 3300031852 Ga0307410_10053160 Ga0307410_100531603 327
488 3300031995 Ga0307409_100288030 Ga0307409_1002880302 327
489 3300049571 Ga0501034_0132098 Ga0501034_0132098_747_1802 327
490 3300060353 Ga0501082_0016001 Ga0501082_0016001_4823_5878 327
491 3300005981 Ga0081538_10009715 Ga0081538_100097153 328
492 3300006163 Ga0070715_10051649 Ga0070715_100516492 328
493 3300009098 Ga0105245_10330640 Ga0105245_103306402 328
494 3300009147 Ga0114129_10119612 Ga0114129_101196123 328
495 3300009148 Ga0105243_10119551 Ga0105243_101195512 328
496 3300009551 Ga0105238_10308413 Ga0105238_103084132 328
497 3300035121 Ga0373960_0012702 Ga0373960_0012702_45_1097 328
498 3300035242 Ga0373962_0011082 Ga0373962_0011082_981_2033 328
499 3300039437 Ga0436365_0846031 Ga0436365_0846031_185_1270 328
500 3300046675 Ga0495657_0010336 Ga0495657_0010336_1234_2289 328
501 3300047319 Ga0495674_0247300 Ga0495674_0247300_313_1356 328
502 3300048907 Ga0496104_0023148 Ga0496104_0023148_723_1775 328
503 3300048909 Ga0496106_0337594 Ga0496106_0337594_32_1084 328
504 3300050492 nmdc:mga0yw44_9690_c1 nmdc:mga0yw44_9690_c1_2350_3405 328
505 3300050507 nmdc:mga05p37_12095_c1 nmdc:mga05p37_12095_c1_7884_8942 328
506 3300002244 JGI24742J22300_10004103 JGI24742J22300_100041032 329
507 3300002459 JGI24751J29686_10002127 JGI24751J29686_100021273 329
508 3300005331 Ga0070670_100064976 Ga0070670_1000649762 329
509 3300005337 Ga0070682_100070570 Ga0070682_1000705703 329
510 3300005338 Ga0068868_100002032 Ga0068868_10000203212 329
511 3300005340 Ga0070689_100060535 Ga0070689_1000605352 329
512 3300005343 Ga0070687_100015318 Ga0070687_1000153184 329
513 3300005345 Ga0070692_10076067 Ga0070692_100760672 329
514 3300005354 Ga0070675_100125656 Ga0070675_1001256563 329
515 3300005355 Ga0070671_100005241 Ga0070671_1000052413 329
516 3300005356 Ga0070674_100221671 Ga0070674_1002216712 329
517 3300005364 Ga0070673_100024738 Ga0070673_1000247383 329
518 3300005366 Ga0070659_100193674 Ga0070659_1001936741 329
519 3300005438 Ga0070701_10126742 Ga0070701_101267422 329
520 3300005456 Ga0070678_100064322 Ga0070678_1000643222 329
521 3300005535 Ga0070684_100028668 Ga0070684_1000286683 329
522 3300005545 Ga0070695_100140304 Ga0070695_1001403042 329
523 3300005578 Ga0068854_100023314 Ga0068854_1000233144 329
524 3300005617 Ga0068859_100072561 Ga0068859_1000725613 329
525 3300005618 Ga0068864_100013256 Ga0068864_1000132567 329
526 3300005841 Ga0068863_100018899 Ga0068863_1000188994 329
527 3300005842 Ga0068858_100008307 Ga0068858_1000083073 329
528 3300005843 Ga0068860_100046274 Ga0068860_1000462742 329
529 3300005983 Ga0081540_1000128 Ga0081540_10001286 329
530 3300006881 Ga0068865_100029037 Ga0068865_1000290373 329
531 3300006931 Ga0097620_100072561 Ga0097620_1000725613 329
532 3300017792 Ga0163161_10061716 Ga0163161_100617163 329
533 3300025321 Ga0207656_10052762 Ga0207656_100527622 329
534 3300025901 Ga0207688_10000850 Ga0207688_1000085012 329
535 3300025907 Ga0207645_10048253 Ga0207645_100482533 329
536 3300025918 Ga0207662_10000473 Ga0207662_100004739 329
537 3300025919 Ga0207657_10135423 Ga0207657_101354232 329
538 3300025923 Ga0207681_10054428 Ga0207681_100544283 329
539 3300025933 Ga0207706_10008224 Ga0207706_100082247 329
540 3300025936 Ga0207670_10084208 Ga0207670_100842082 329
541 3300025940 Ga0207691_10003704 Ga0207691_100037045 329
542 3300025942 Ga0207689_10002348 Ga0207689_100023487 329
543 3300025945 Ga0207679_10335081 Ga0207679_103350811 329
544 3300025960 Ga0207651_10056255 Ga0207651_100562552 329
545 3300025981 Ga0207640_10135985 Ga0207640_101359852 329
546 3300026035 Ga0207703_10033233 Ga0207703_100332332 329
547 3300026075 Ga0207708_10001478 Ga0207708_1000147812 329
548 3300026088 Ga0207641_10029835 Ga0207641_100298353 329
549 3300026089 Ga0207648_10004845 Ga0207648_100048458 329
550 3300026095 Ga0207676_10012844 Ga0207676_100128443 329
551 3300026116 Ga0207674_10043490 Ga0207674_100434904 329
552 3300026118 Ga0207675_100007144 Ga0207675_1000071446 329
553 3300026121 Ga0207683_10065125 Ga0207683_100651252 329
554 3300028380 Ga0268265_10100007 Ga0268265_101000071 329
555 3300031241 Ga0265325_10009387 Ga0265325_100093873 329
556 3300031242 Ga0265329_10032932 Ga0265329_100329322 329
557 3300031249 Ga0265339_10000016 Ga0265339_10000016130 329
558 3300031595 Ga0265313_10000060 Ga0265313_100000609 329
559 3300035691 Ga0373931_0059797 Ga0373931_0059797_759_1820 329
560 3300035695 Ga0373927_0043667 Ga0373927_0043667_362_1432 329
561 3300048907 Ga0496104_0006342 Ga0496104_0006342_734_1795 329
562 3300048908 Ga0496105_0133393 Ga0496105_0133393_226_1287 329
563 3300048918 Ga0496115_0053892 Ga0496115_0053892_1434_2495 329
564 3300049592 Ga0501076_0058257 Ga0501076_0058257_1366_2427 329
565 3300049741 Ga0501079_0227287 Ga0501079_0227287_143_1204 329
566 3300053085 Ga0495619_0113773 Ga0495619_0113773_685_1743 329
567 3300053119 Ga0500595_013575 Ga0500595_013575_925_1995 329
568 3300053177 Ga0500636_0007372 Ga0500636_0007372_2342_3412 329
569 3300009147 Ga0114129_10267181 Ga0114129_102671812 330
570 3300048910 Ga0496107_0004948 Ga0496107_0004948_2383_3429 330
571 3300048911 Ga0496108_0001300 Ga0496108_0001300_3952_4998 330
572 3300048912 Ga0496109_0005518 Ga0496109_0005518_3965_5011 330
573 3300048914 Ga0496111_0007704 Ga0496111_0007704_2622_3668 330
574 3300048915 Ga0496112_0006238 Ga0496112_0006238_3825_4871 330
575 3300048918 Ga0496115_0016067 Ga0496115_0016067_3905_4951 330
576 3300049571 Ga0501034_0336839 Ga0501034_0336839_108_1154 330
577 3300053077 Ga0495601_0035847 Ga0495601_0035847_1768_2817 330
578 3300053084 Ga0495595_0011345 Ga0495595_0011345_1982_3031 330
579 3300053085 Ga0495619_0006596 Ga0495619_0006596_3533_4582 330
580 iso_pu_bacteria 2643221651 2644289874 330
581 iso_pu_bacteria 2667528175 2671120902 330
582 iso_pu_bacteria 2889033259 2889034014 330
583 iso_pu_bacteria 2935630451 2935633272 330
584 iso_pu_bacteria 2941507105 2941509426 330
585 iso_pu_bacteria 2941515067 2941517255 330
586 iso_pu_bacteria 2941523033 2941526792 330
587 3300006038 Ga0075365_10004187 Ga0075365_100041875 331
588 3300006051 Ga0075364_10015753 Ga0075364_100157533 331
589 3300006178 Ga0075367_10019891 Ga0075367_100198912 331
590 3300006186 Ga0075369_10012776 Ga0075369_100127764 331
591 3300035171 Ga0373946_0080432 Ga0373946_0080432_33_1151 331
592 3300035725 Ga0373947_0018325 Ga0373947_0018325_1891_3009 331
593 3300037068 Ga0373925_0028965 Ga0373925_0028965_131_1249 331
594 3300046533 Ga0495640_0018589 Ga0495640_0018589_335_1453 331
595 3300047319 Ga0495674_0032012 Ga0495674_0032012_1678_2796 331
596 3300050490 nmdc:mga03n38_4275_c1 nmdc:mga03n38_4275_c1_699_1775 331
597 3300050491 nmdc:mga00v17_19033_c1 nmdc:mga00v17_19033_c1_2370_3446 331
598 3300050494 nmdc:mga06z11_3146_c1 nmdc:mga06z11_3146_c1_3250_4326 331
599 3300050495 nmdc:mga04h51_6638_c1 nmdc:mga04h51_6638_c1_960_2036 331
600 3300050516 nmdc:mga0sz30_3923_c1 nmdc:mga0sz30_3923_c1_374_1450 331
601 3300005981 Ga0081538_10013135 Ga0081538_100131356 333
602 3300049822 Ga0501035_0040772 Ga0501035_0040772_2883_3938 333
603 3300001979 JGI24740J21852_10004166 JGI24740J21852_100041662 334
604 3300005436 Ga0070713_100021309 Ga0070713_1000213093 334
605 3300005457 Ga0070662_100171653 Ga0070662_1001716532 334
606 3300005539 Ga0068853_100015323 Ga0068853_1000153235 334
607 3300005563 Ga0068855_100052673 Ga0068855_1000526734 334
608 3300005563 Ga0068855_100359476 Ga0068855_1003594762 334
609 3300005577 Ga0068857_100085133 Ga0068857_1000851332 334
610 3300005577 Ga0068857_100093003 Ga0068857_1000930032 334
611 3300005578 Ga0068854_100032935 Ga0068854_1000329353 334
612 3300005614 Ga0068856_100026997 Ga0068856_1000269972 334
613 3300005614 Ga0068856_100039697 Ga0068856_1000396973 334
614 3300005616 Ga0068852_100155903 Ga0068852_1001559032 334
615 3300005834 Ga0068851_10009002 Ga0068851_100090022 334
616 3300005841 Ga0068863_100208583 Ga0068863_1002085832 334
617 3300005842 Ga0068858_100123684 Ga0068858_1001236842 334
618 3300006038 Ga0075365_10001566 Ga0075365_100015669 334
619 3300006051 Ga0075364_10027704 Ga0075364_100277043 334
620 3300006178 Ga0075367_10025103 Ga0075367_100251033 334
621 3300006178 Ga0075367_10201713 Ga0075367_102017131 334
622 3300009093 Ga0105240_10110605 Ga0105240_101106053 334
623 3300009093 Ga0105240_10215302 Ga0105240_102153022 334
624 3300009174 Ga0105241_10000279 Ga0105241_1000027924 334
625 3300009545 Ga0105237_10319045 Ga0105237_103190451 334
626 3300009551 Ga0105238_10022315 Ga0105238_100223154 334
627 3300010375 Ga0105239_10029386 Ga0105239_100293862 334
628 3300014325 Ga0163163_10027040 Ga0163163_100270403 334
629 3300025321 Ga0207656_10015290 Ga0207656_100152902 334
630 3300025906 Ga0207699_10104006 Ga0207699_101040062 334
631 3300025911 Ga0207654_10009490 Ga0207654_100094905 334
632 3300025913 Ga0207695_10014600 Ga0207695_100146008 334
633 3300025914 Ga0207671_10175484 Ga0207671_101754841 334
634 3300025916 Ga0207663_10009766 Ga0207663_100097665 334
635 3300025924 Ga0207694_10003514 Ga0207694_100035148 334
636 3300025949 Ga0207667_10020545 Ga0207667_100205454 334
637 3300025949 Ga0207667_10301103 Ga0207667_103011032 334
638 3300026041 Ga0207639_10033263 Ga0207639_100332633 334
639 3300026067 Ga0207678_10080349 Ga0207678_100803492 334
640 3300026078 Ga0207702_10000003 Ga0207702_10000003117 334
641 3300026116 Ga0207674_10009375 Ga0207674_100093756 334
642 3300026116 Ga0207674_10012016 Ga0207674_100120166 334
643 3300026142 Ga0207698_10041773 Ga0207698_100417731 334
644 3300026142 Ga0207698_10304017 Ga0207698_103040171 334
645 3300046471 Ga0495650_0022305 Ga0495650_0022305_1304_2371 334
646 3300046616 Ga0495668_0072446 Ga0495668_0072446_313_1359 334
647 3300048907 Ga0496104_0024587 Ga0496104_0024587_3992_5038 334
648 3300048911 Ga0496108_0155205 Ga0496108_0155205_503_1549 334
649 3300048914 Ga0496111_0023381 Ga0496111_0023381_711_1757 334
650 3300048915 Ga0496112_0021763 Ga0496112_0021763_1871_2917 334
651 3300048916 Ga0496113_0002743 Ga0496113_0002743_2755_3801 334
652 3300048918 Ga0496115_0154383 Ga0496115_0154383_808_1854 334
653 3300048929 Ga0496126_0254935 Ga0496126_0254935_289_1335 334
654 3300049571 Ga0501034_0082621 Ga0501034_0082621_427_1485 334
655 3300049581 Ga0501047_0071339 Ga0501047_0071339_2270_3328 334
656 3300049586 Ga0501070_0065981 Ga0501070_0065981_737_1795 334
657 3300049823 Ga0501044_0079770 Ga0501044_0079770_1995_3053 334
658 3300050494 nmdc:mga06z11_6520_c1 nmdc:mga06z11_6520_c1_2367_3434 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

24

194

0.94

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

20

216

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wry-assembly1.cif.gz_A crystal structure of helicase complex 2 0.7024 21 68
7au2-assembly1.cif.gz_A cryo-em structure of human exostosin-like 3 (extl3) 0.6985 20 144
2z86-assembly2.cif.gz_D crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.6941 20 186
5uw0-assembly1.cif.gz_A activated state ygsy2p in complex with udp-2-fluoro-2-deoxy-glucose 0.693 19 65
5nqa-assembly1.cif.gz_A crystal structure of galnac-t4 in complex with the monoglycopeptide 3 0.6805 20 142
ID Description Score Start End Superfamily
af_Q497B3_19_206_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8957 235 298 1.20.140.150
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8572 21 227 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8495 21 227 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8149 20 237 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8121 21 211 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3M0WV41-F1-model_v4 Glycosyltransferase 0.9049 22 191 GO:0005886
GO:0016757
AF-A0A350UYC4-F1-model_v4 Glycosyltransferase 0.9007 22 204 GO:0005886
GO:0016757
AF-A0A401FVE3-F1-model_v4 Glycosyl transferase family 2 0.8963 20 136 GO:0016757
AF-A0A2N2ZS93-F1-model_v4 Glycosyltransferase 0.896 21 204 GO:0005886
GO:0099621
AF-A0A381VHB4-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.8917 22 184 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
73.91 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map