F473153

General Info

Members Datasets Scaffolds Average Seq Length
658 352 658 147

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_101927255|Ga0070714_1019272551
Length 144
Sequence MPLHLIKLCVGCDSVADLEDWIQQKLREKKRRGQKPEHIHTTRMQPKRAEDLAGGSLYWVIRGQITCRERILALRSATGKDGIKRCQLVLDGKLVLVEPRPRSAFQGWRYLEGKDAPRDLARAAPGAFRMPEQMRRELRELGLL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
215 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
216 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
217 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
218 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
343 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
348 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
349 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 0
Rhizoplane 3.04
Rhizosphere 90.88
Stem 0
Stem Tuber 0
Unclassified 2.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10086473 3300003203 Bacteria 952
2 JGI25405J52794_10039346 3300003911 Unclassified 997
3 Ga0065704_10333562 3300005289 Bacteria 823
4 Ga0065707_10122472 3300005295 Bacteria 2087
5 Ga0070658_10137841 3300005327 Bacteria 2037
6 Ga0070676_10672576 3300005328 Bacteria 753
7 Ga0070683_100259155 3300005329 Bacteria 1654
8 Ga0070690_100153982 3300005330 Bacteria 1570
9 Ga0070670_100013182 3300005331 Bacteria 7080
10 Ga0070670_100206397 3300005331 Bacteria 1708
11 Ga0068869_100070724 3300005334 Bacteria 2582
12 Ga0068869_100501342 3300005334 Bacteria 1014
13 Ga0070666_10006300 3300005335 Bacteria 7298
14 Ga0070666_10081831 3300005335 Bacteria 2208
15 Ga0070682_100011027 3300005337 Bacteria 5153
16 Ga0068868_100194630 3300005338 Unclassified 1687
17 Ga0070660_100723766 3300005339 Bacteria 835
18 Ga0070689_101050319 3300005340 Bacteria 726
19 Ga0070689_101292477 3300005340 Bacteria 657
20 Ga0070687_100124262 3300005343 Bacteria 1480
21 Ga0070687_100171875 3300005343 Bacteria 1290
22 Ga0070687_100253001 3300005343 Bacteria 1095
23 Ga0070661_100047285 3300005344 Bacteria 3148
24 Ga0070661_100398069 3300005344 Bacteria 1088
25 Ga0070668_101180770 3300005347 Unclassified 693
26 Ga0070669_100307605 3300005353 Bacteria 1276
27 Ga0070675_100415291 3300005354 Bacteria 1202
28 Ga0070671_100050140 3300005355 Bacteria 3472
29 Ga0070671_100350017 3300005355 Bacteria 1261
30 Ga0070674_100045236 3300005356 Bacteria 3007
31 Ga0070674_100367218 3300005356 Bacteria 1167
32 Ga0070673_100348700 3300005364 Bacteria 1313
33 Ga0070673_102052632 3300005364 Bacteria 543
34 Ga0070688_100336163 3300005365 Bacteria 1101
35 Ga0070659_100310041 3300005366 Unclassified 1318
36 Ga0070667_100970156 3300005367 Bacteria 792
37 Ga0070709_10003768 3300005434 Bacteria 8153
38 Ga0070709_10697926 3300005434 Bacteria 789
39 Ga0070714_100019011 3300005435 Bacteria 5592
40 Ga0070714_101927255 3300005435 Bacteria 576
41 Ga0070713_100002318 3300005436 Bacteria 12400
42 Ga0070713_100181181 3300005436 Bacteria 1893
43 Ga0070710_10008161 3300005437 Bacteria 5091
44 Ga0070710_10160535 3300005437 Bacteria 1393
45 Ga0070710_10225189 3300005437 Bacteria 1195
46 Ga0070710_10583110 3300005437 Unclassified 776
47 Ga0070711_100092544 3300005439 Bacteria 2182
48 Ga0070711_100142043 3300005439 Bacteria 1801
49 Ga0070711_100301869 3300005439 Bacteria 1273
50 Ga0070711_101131538 3300005439 Archaea 675
51 Ga0070700_100148520 3300005441 Bacteria 1601
52 Ga0070700_101774421 3300005441 Bacteria 531
53 Ga0070663_100793675 3300005455 Bacteria 811
54 Ga0070678_100175432 3300005456 Bacteria 1749
55 Ga0070662_100600206 3300005457 Bacteria 926
56 Ga0070681_10035305 3300005458 Bacteria 5023
57 Ga0070681_10490479 3300005458 Bacteria 1141
58 Ga0068867_100158894 3300005459 Bacteria 1781
59 Ga0068867_101592018 3300005459 Unclassified 610
60 Ga0070685_10023556 3300005466 Bacteria 3372
61 Ga0070698_101264242 3300005471 Bacteria 688
62 Ga0070679_100002402 3300005530 Bacteria 16981
63 Ga0070684_100084206 3300005535 Bacteria 2818
64 Ga0070684_100179541 3300005535 Bacteria 1924
65 Ga0070684_100436862 3300005535 Bacteria 1209
66 Ga0068853_100250317 3300005539 Bacteria 1625
67 Ga0068853_100333224 3300005539 Bacteria 1409
68 Ga0070686_100005122 3300005544 Bacteria 7234
69 Ga0070686_100045805 3300005544 Bacteria 2756
70 Ga0070686_100236217 3300005544 Bacteria 1328
71 Ga0070693_100275548 3300005547 Bacteria 1125
72 Ga0070693_100406140 3300005547 Bacteria 946
73 Ga0070665_100054360 3300005548 Bacteria 4016
74 Ga0068855_100588219 3300005563 Bacteria 1201
75 Ga0070664_100082756 3300005564 Bacteria 2768
76 Ga0070664_100088118 3300005564 Bacteria 2684
77 Ga0068857_100113880 3300005577 Bacteria 2432
78 Ga0068857_100345172 3300005577 Bacteria 1378
79 Ga0068857_102328770 3300005577 Bacteria 526
80 Ga0068854_101246359 3300005578 Bacteria 668
81 Ga0068856_100304550 3300005614 Bacteria 1611
82 Ga0068856_100372112 3300005614 Bacteria 1448
83 Ga0070702_100092938 3300005615 Bacteria 1833
84 Ga0068859_100504790 3300005617 Bacteria 1305
85 Ga0068864_100096201 3300005618 Bacteria 2620
86 Ga0068864_100181158 3300005618 Bacteria 1926
87 Ga0068866_10114499 3300005718 Unclassified 1510
88 Ga0068866_10420455 3300005718 Bacteria 867
89 Ga0068861_100587785 3300005719 Bacteria 1020
90 Ga0068861_100690806 3300005719 Bacteria 947
91 Ga0068861_100698118 3300005719 Bacteria 942
92 Ga0068851_10284088 3300005834 Bacteria 947
93 Ga0068863_100265435 3300005841 Bacteria 1660
94 Ga0068863_100776882 3300005841 Bacteria 954
95 Ga0068858_100109723 3300005842 Bacteria 2576
96 Ga0068858_100154141 3300005842 Bacteria 2161
97 Ga0068860_100026842 3300005843 Bacteria 5549
98 Ga0081455_10000009 3300005937 Bacteria 249885
99 Ga0081539_10002225 3300005985 Bacteria 28285
100 Ga0070717_10046865 3300006028 Bacteria 3538
101 Ga0070717_10360066 3300006028 Bacteria 1302
102 Ga0070717_10451238 3300006028 Bacteria 1159
103 Ga0070717_11114502 3300006028 Bacteria 719
104 Ga0075363_100162774 3300006048 Bacteria 1264
105 Ga0075432_10001176 3300006058 Bacteria 8386
106 Ga0070715_10000335 3300006163 Bacteria 11724
107 Ga0070715_10036610 3300006163 Bacteria 2026
108 Ga0070716_100021991 3300006173 Bacteria 3366
109 Ga0070716_100180886 3300006173 Bacteria 1384
110 Ga0070716_100679198 3300006173 Bacteria 784
111 Ga0070716_101443632 3300006173 Bacteria 561
112 Ga0070712_100002895 3300006175 Bacteria 10646
113 Ga0070712_100011668 3300006175 Bacteria 5581
114 Ga0070712_100072081 3300006175 Bacteria 2473
115 Ga0070712_100248078 3300006175 Bacteria 1421
116 Ga0070712_100258150 3300006175 Bacteria 1395
117 Ga0070712_100398798 3300006175 Bacteria 1136
118 Ga0070712_100931077 3300006175 Bacteria 750
119 Ga0075362_10533837 3300006177 Bacteria 602
120 Ga0075367_10236971 3300006178 Bacteria 1143
121 Ga0075369_10093136 3300006186 Bacteria 1346
122 Ga0075427_10000004 3300006194 Bacteria 15321
123 Ga0097621_102180347 3300006237 Bacteria 530
124 Ga0075370_10644727 3300006353 Bacteria 643
125 Ga0068871_100050987 3300006358 Bacteria 3349
126 Ga0068871_100234468 3300006358 Bacteria 1594
127 Ga0075428_100008326 3300006844 Bacteria 11493
128 Ga0075428_100067187 3300006844 Bacteria 3925
129 Ga0075428_100765921 3300006844 Bacteria 1027
130 Ga0075428_100793794 3300006844 Bacteria 1006
131 Ga0075430_100001186 3300006846 Bacteria 20900
132 Ga0075430_100024049 3300006846 Bacteria 5187
133 Ga0075430_100355025 3300006846 Bacteria 1210
134 Ga0075431_100000495 3300006847 Bacteria 32766
135 Ga0075431_100001446 3300006847 Bacteria 21870
136 Ga0075433_10000215 3300006852 Bacteria 32818
137 Ga0075433_10104188 3300006852 Bacteria 2513
138 Ga0075433_10873017 3300006852 Bacteria 785
139 Ga0075433_11240700 3300006852 Bacteria 647
140 Ga0075434_100003016 3300006871 Bacteria 14968
141 Ga0075434_100025301 3300006871 Bacteria 5807
142 Ga0075434_100125041 3300006871 Bacteria 2589
143 Ga0075434_100359268 3300006871 Bacteria 1477
144 Ga0075434_100759146 3300006871 Bacteria 987
145 Ga0075429_100002098 3300006880 Bacteria 16630
146 Ga0075429_100090214 3300006880 Bacteria 2673
147 Ga0075436_100420179 3300006914 Bacteria 971
148 Ga0097620_100504767 3300006931 Bacteria 1305
149 Ga0075435_100009478 3300007076 Bacteria 7053
150 Ga0075435_100141657 3300007076 Bacteria 2017
151 Ga0075435_100527289 3300007076 Bacteria 1022
152 Ga0105251_10043757 3300009011 Bacteria 2166
153 Ga0105250_10170438 3300009092 Bacteria 911
154 Ga0105240_10317677 3300009093 Bacteria 1776
155 Ga0105240_10678991 3300009093 Bacteria 1126
156 Ga0105240_11719008 3300009093 Bacteria 655
157 Ga0111539_10002796 3300009094 Bacteria 23160
158 Ga0111539_10008242 3300009094 Bacteria 13266
159 Ga0111539_10251597 3300009094 Bacteria 2057
160 Ga0111539_10406262 3300009094 Bacteria 1586
161 Ga0105245_10115883 3300009098 Bacteria 2498
162 Ga0105247_10028332 3300009101 Bacteria 3388
163 Ga0105247_10100661 3300009101 Bacteria 1847
164 Ga0114129_10001495 3300009147 Bacteria 31629
165 Ga0114129_10007384 3300009147 Bacteria 15644
166 Ga0114129_10019783 3300009147 Bacteria 9583
167 Ga0114129_10133267 3300009147 Bacteria 3411
168 Ga0114129_10177048 3300009147 Bacteria 2905
169 Ga0105243_10104484 3300009148 Bacteria 2358
170 Ga0105243_10341872 3300009148 Bacteria 1371
171 Ga0105241_10061040 3300009174 Bacteria 2902
172 Ga0105241_10284963 3300009174 Bacteria 1412
173 Ga0105241_10494820 3300009174 Bacteria 1089
174 Ga0105242_10049393 3300009176 Bacteria 3424
175 Ga0105242_11839339 3300009176 Bacteria 645
176 Ga0105237_10150790 3300009545 Bacteria 2321
177 Ga0105237_10459736 3300009545 Bacteria 1279
178 Ga0105237_11146229 3300009545 Bacteria 784
179 Ga0105238_10135924 3300009551 Bacteria 2436
180 Ga0105238_10331509 3300009551 Bacteria 1509
181 Ga0105249_10540192 3300009553 Bacteria 1215
182 Ga0105246_10053412 3300011119 Bacteria 2780
183 Ga0105246_10208340 3300011119 Bacteria 1524
184 Ga0157346_1009594 3300012480 Bacteria 688
185 Ga0157373_10555732 3300013100 Bacteria 833
186 Ga0157371_10699397 3300013102 Bacteria 759
187 Ga0157370_10310949 3300013104 Bacteria 1454
188 Ga0157370_10339456 3300013104 Bacteria 1385
189 Ga0157369_11079552 3300013105 Bacteria 821
190 Ga0157374_11649764 3300013296 Bacteria 666
191 Ga0157378_10139807 3300013297 Bacteria 2248
192 Ga0157378_10576564 3300013297 Bacteria 1134
193 Ga0157378_12766164 3300013297 Bacteria 543
194 Ga0163162_10165484 3300013306 Bacteria 2335
195 Ga0163162_10923055 3300013306 Bacteria 985
196 Ga0163162_11789809 3300013306 Bacteria 702
197 Ga0157372_11079471 3300013307 Bacteria 929
198 Ga0157375_10120161 3300013308 Bacteria 2736
199 Ga0157375_10298887 3300013308 Bacteria 1773
200 Ga0157375_13795309 3300013308 Bacteria 501
201 Ga0163163_10469870 3300014325 Unclassified 1318
202 Ga0163163_10473011 3300014325 Bacteria 1314
203 Ga0157380_10597913 3300014326 Bacteria 1091
204 Ga0157380_10780205 3300014326 Bacteria 970
205 Ga0157380_10845584 3300014326 Bacteria 936
206 Ga0157380_10911653 3300014326 Bacteria 906
207 Ga0157380_12131205 3300014326 Bacteria 624
208 Ga0182008_10275622 3300014497 Unclassified 874
209 Ga0157377_10044078 3300014745 Bacteria 2486
210 Ga0157377_10188715 3300014745 Bacteria 1301
211 Ga0157379_10064249 3300014968 Bacteria 3280
212 Ga0157379_10361684 3300014968 Bacteria 1330
213 Ga0157376_10375267 3300014969 Bacteria 1368
214 Ga0163161_10260409 3300017792 Bacteria 1355
215 Ga0163161_11233541 3300017792 Bacteria 648
216 Ga0163161_11340637 3300017792 Bacteria 623
217 Ga0206356_11108289 3300020070 Bacteria 1119
218 Ga0213874_10061480 3300021377 Bacteria 1177
219 Ga0213874_10179409 3300021377 Bacteria 753
220 Ga0213876_10073520 3300021384 Bacteria 1805
221 Ga0213876_10146184 3300021384 Bacteria 1257
222 Ga0213875_10199452 3300021388 Bacteria 941
223 Ga0228598_1002219 3300024227 Bacteria 4247
224 Ga0207697_10013424 3300025315 Bacteria 3418
225 Ga0207682_10002089 3300025893 Bacteria 9046
226 Ga0207692_10254017 3300025898 Bacteria 1054
227 Ga0207692_10463361 3300025898 Unclassified 800
228 Ga0207642_10038995 3300025899 Bacteria 2060
229 Ga0207710_10028228 3300025900 Bacteria 2435
230 Ga0207688_10014043 3300025901 Bacteria 4355
231 Ga0207685_10088139 3300025905 Bacteria 1300
232 Ga0207699_10352861 3300025906 Bacteria 1039
233 Ga0207645_10031461 3300025907 Bacteria 3414
234 Ga0207643_10027396 3300025908 Bacteria 3159
235 Ga0207705_10143590 3300025909 Bacteria 1784
236 Ga0207654_10166642 3300025911 Bacteria 1427
237 Ga0207654_10181127 3300025911 Bacteria 1375
238 Ga0207707_10056212 3300025912 Bacteria 3424
239 Ga0207707_10273042 3300025912 Bacteria 1465
240 Ga0207707_10318070 3300025912 Bacteria 1344
241 Ga0207695_10205081 3300025913 Bacteria 1884
242 Ga0207695_10864705 3300025913 Bacteria 784
243 Ga0207671_10235157 3300025914 Unclassified 1438
244 Ga0207671_10365813 3300025914 Bacteria 1145
245 Ga0207693_10003273 3300025915 Bacteria 13868
246 Ga0207693_10005443 3300025915 Bacteria 10616
247 Ga0207693_10014672 3300025915 Bacteria 6295
248 Ga0207693_10174965 3300025915 Bacteria 1689
249 Ga0207663_10079122 3300025916 Bacteria 2146
250 Ga0207663_10939683 3300025916 Archaea 692
251 Ga0207660_10094398 3300025917 Bacteria 2223
252 Ga0207662_10019411 3300025918 Bacteria 3868
253 Ga0207657_10017549 3300025919 Bacteria 6858
254 Ga0207681_10123224 3300025923 Bacteria 1904
255 Ga0207681_10688715 3300025923 Bacteria 849
256 Ga0207694_10114676 3300025924 Bacteria 2146
257 Ga0207650_10550419 3300025925 Bacteria 967
258 Ga0207659_10299907 3300025926 Bacteria 1319
259 Ga0207659_10351761 3300025926 Unclassified 1223
260 Ga0207659_10406867 3300025926 Bacteria 1139
261 Ga0207659_10523704 3300025926 Bacteria 1005
262 Ga0207700_10302824 3300025928 Bacteria 1381
263 Ga0207700_10437230 3300025928 Bacteria 1151
264 Ga0207664_10023134 3300025929 Bacteria 4652
265 Ga0207706_10262066 3300025933 Bacteria 1509
266 Ga0207709_10062004 3300025935 Bacteria 2339
267 Ga0207669_10076635 3300025937 Bacteria 2123
268 Ga0207669_10443128 3300025937 Bacteria 1027
269 Ga0207665_10240069 3300025939 Bacteria 1335
270 Ga0207665_10357104 3300025939 Bacteria 1104
271 Ga0207665_10437298 3300025939 Bacteria 1002
272 Ga0207691_10036320 3300025940 Bacteria 4565
273 Ga0207689_10026402 3300025942 Bacteria 4862
274 Ga0207689_10119517 3300025942 Bacteria 2168
275 Ga0207661_10652341 3300025944 Bacteria 967
276 Ga0207679_10185108 3300025945 Bacteria 1726
277 Ga0207679_10508951 3300025945 Unclassified 1075
278 Ga0207667_10592228 3300025949 Bacteria 1119
279 Ga0207668_10144447 3300025972 Bacteria 1834
280 Ga0207668_10985533 3300025972 Bacteria 753
281 Ga0207658_11403338 3300025986 Bacteria 639
282 Ga0207677_11013672 3300026023 Bacteria 753
283 Ga0207703_10293550 3300026035 Bacteria 1480
284 Ga0207639_10985650 3300026041 Bacteria 789
285 Ga0207708_10282951 3300026075 Bacteria 1344
286 Ga0207702_10151197 3300026078 Bacteria 2112
287 Ga0207641_10823780 3300026088 Bacteria 919
288 Ga0207641_11350220 3300026088 Bacteria 714
289 Ga0207648_11410204 3300026089 Unclassified 655
290 Ga0207676_10377832 3300026095 Bacteria 1318
291 Ga0207674_10132479 3300026116 Bacteria 2455
292 Ga0207674_10312861 3300026116 Bacteria 1520
293 Ga0207675_100110657 3300026118 Bacteria 2592
294 Ga0207675_100723876 3300026118 Bacteria 1005
295 Ga0207683_10008669 3300026121 Bacteria 8695
296 Ga0209966_1011053 3300027695 Bacteria 1639
297 Ga0209998_10011603 3300027717 Unclassified 1825
298 Ga0207428_10000216 3300027907 Bacteria 79777
299 Ga0207428_10005674 3300027907 Bacteria 11593
300 Ga0207428_10363745 3300027907 Bacteria 1063
301 Ga0268265_10253148 3300028380 Bacteria 1561
302 Ga0265337_1001192 3300028556 Bacteria 13219
303 Ga0307517_10449559 3300028786 Bacteria 668
304 Ga0265338_10315196 3300028800 Bacteria 1134
305 Ga0265762_1110991 3300030760 Bacteria 618
306 Ga0265760_10245209 3300031090 Bacteria 619
307 Ga0265330_10043603 3300031235 Bacteria 1984
308 Ga0265330_10044424 3300031235 Bacteria 1962
309 Ga0265328_10100542 3300031239 Bacteria 1071
310 Ga0265325_10336510 3300031241 Bacteria 668
311 Ga0265325_10414322 3300031241 Bacteria 589
312 Ga0265329_10054423 3300031242 Bacteria 1271
313 Ga0265340_10021741 3300031247 Bacteria 3288
314 Ga0265340_10360897 3300031247 Bacteria 642
315 Ga0265339_10085982 3300031249 Bacteria 1655
316 Ga0265316_10062118 3300031344 Bacteria 2899
317 Ga0265316_10204847 3300031344 Bacteria 1461
318 Ga0307513_10157895 3300031456 Bacteria 2165
319 Ga0307513_10326947 3300031456 Bacteria 1289
320 Ga0265313_10091912 3300031595 Bacteria 1361
321 Ga0265313_10333797 3300031595 Bacteria 603
322 Ga0265314_10098095 3300031711 Bacteria 1891
323 Ga0265342_10132046 3300031712 Bacteria 1398
324 Ga0307416_101871711 3300032002 Bacteria 703
325 Ga0307416_102155928 3300032002 Bacteria 659
326 Ga0373926_0027700 3300035083 Unclassified 1987
327 Ga0373923_0207429 3300035111 Unclassified 907
328 Ga0373936_0295959 3300035113 Bacteria 730
329 Ga0373945_0002014 3300035116 Bacteria 6311
330 Ga0373945_0002085 3300035116 Bacteria 6225
331 Ga0373953_0054225 3300035117 Bacteria 1626
332 Ga0373956_0015218 3300035119 Bacteria 3219
333 Ga0373956_0041589 3300035119 Bacteria 2041
334 Ga0373957_0033295 3300035120 Bacteria 1903
335 Ga0373957_0112329 3300035120 Bacteria 1098
336 Ga0373943_0013910 3300035170 Bacteria 3638
337 Ga0373943_0024601 3300035170 Bacteria 2809
338 Ga0373943_0078918 3300035170 Bacteria 1684
339 Ga0373946_0001923 3300035171 Bacteria 7251
340 Ga0373946_0031860 3300035171 Unclassified 2114
341 Ga0373946_0037161 3300035171 Bacteria 1978
342 Ga0373955_0095658 3300035172 Bacteria 1699
343 Ga0373961_0003036 3300035241 Bacteria 4229
344 Ga0373962_0196113 3300035242 Bacteria 681
345 Ga0373924_0184637 3300035410 Bacteria 918
346 Ga0373924_0242140 3300035410 Bacteria 798
347 Ga0373924_0324726 3300035410 Bacteria 685
348 Ga0373931_0027626 3300035691 Bacteria 2898
349 Ga0373931_0133597 3300035691 Bacteria 1431
350 Ga0373931_1233336 3300035691 Bacteria 513
351 Ga0373935_0042243 3300035692 Bacteria 2866
352 Ga0373935_0056027 3300035692 Unclassified 2512
353 Ga0373935_0101292 3300035692 Bacteria 1899
354 Ga0373935_0350398 3300035692 Bacteria 1052
355 Ga0373927_0001051 3300035695 Bacteria 21045
356 Ga0373927_0062052 3300035695 Bacteria 2417
357 Ga0373927_0107975 3300035695 Bacteria 1813
358 Ga0373927_0341711 3300035695 Bacteria 986
359 Ga0373933_0025433 3300035724 Bacteria 3395
360 Ga0373933_0100245 3300035724 Bacteria 1796
361 Ga0373933_0144981 3300035724 Bacteria 1501
362 Ga0373947_0014697 3300035725 Bacteria 4490
363 Ga0373947_0061602 3300035725 Bacteria 2281
364 Ga0373947_0169495 3300035725 Bacteria 1416
365 Ga0373937_0003621 3300036401 Bacteria 13032
366 Ga0373937_0250362 3300036401 Bacteria 1670
367 Ga0373937_0485462 3300036401 Bacteria 1174
368 Ga0373925_0001925 3300037068 Bacteria 17184
369 Ga0373925_0277865 3300037068 Bacteria 1348
370 Ga0436364_0172837 3300037853 Bacteria 944
371 Ga0436364_0768079 3300037853 Bacteria 31728
372 Ga0436365_0015204 3300039437 Bacteria 1784
373 Ga0436365_0330093 3300039437 Bacteria 5700
374 Ga0436365_0956437 3300039437 Bacteria 1500
375 Ga0436365_1020485 3300039437 Bacteria 1119
376 Ga0436365_1274046 3300039437 Bacteria 2308
377 Ga0436360_0975963 3300039438 Bacteria 1281
378 Ga0436360_1342663 3300039438 Bacteria 1462
379 Ga0436363_1229486 3300039450 Bacteria 1508
380 Ga0436363_1459938 3300039450 Bacteria 1627
381 Ga0436362_0612627 3300039453 Bacteria 880
382 Ga0439453_0000869 3300041408 Bacteria 3605
383 Ga0439453_0001995 3300041408 Bacteria 2744
384 Ga0451837_1680603 3300041494 Unclassified 626
385 Ga0439441_007857 3300042001 Bacteria 1731
386 Ga0439443_004727 3300042003 Bacteria 1791
387 Ga0439446_0323384 3300042156 Bacteria 545
388 Ga0439434_0029200 3300042435 Bacteria 1672
389 Ga0439435_0004045 3300042436 Bacteria 3121
390 Ga0439460_0012318 3300042461 Bacteria 2217
391 Ga0439440_0149830 3300042993 Bacteria 667
392 Ga0495592_0011867 3300046454 Bacteria 6602
393 Ga0495592_0180366 3300046454 Bacteria 1439
394 Ga0495603_0266359 3300046455 Bacteria 986
395 Ga0495603_0530640 3300046455 Bacteria 674
396 Ga0495629_0000409 3300046459 Bacteria 35959
397 Ga0495629_0082303 3300046459 Bacteria 2247
398 Ga0495629_0227625 3300046459 Bacteria 1285
399 Ga0495638_0025735 3300046460 Bacteria 3820
400 Ga0495651_0001051 3300046462 Bacteria 21350
401 Ga0495653_0006259 3300046463 Bacteria 9767
402 Ga0495653_0018050 3300046463 Bacteria 5737
403 Ga0495653_0051356 3300046463 Bacteria 3166
404 Ga0495580_0008552 3300046472 Bacteria 8125
405 Ga0495582_0003989 3300046473 Bacteria 8293
406 Ga0495582_0088007 3300046473 Bacteria 1730
407 Ga0495605_0135393 3300046474 Bacteria 1108
408 Ga0495639_0042949 3300046475 Bacteria 2040
409 Ga0495639_0136735 3300046475 Bacteria 1176
410 Ga0495639_0320789 3300046475 Bacteria 775
411 Ga0495662_0016819 3300046476 Bacteria 3539
412 Ga0495662_0056662 3300046476 Bacteria 1893
413 Ga0495662_0130487 3300046476 Bacteria 1235
414 Ga0495662_0169498 3300046476 Bacteria 1076
415 Ga0495664_0005906 3300046477 Bacteria 6737
416 Ga0495664_0030144 3300046477 Bacteria 3177
417 Ga0495664_0072871 3300046477 Bacteria 2053
418 Ga0495585_0003749 3300046492 Bacteria 10143
419 Ga0495594_0015128 3300046499 Bacteria 4050
420 Ga0495594_0396163 3300046499 Bacteria 786
421 Ga0495607_0175372 3300046501 Bacteria 1079
422 Ga0495608_0006648 3300046511 Bacteria 8205
423 Ga0495618_0002201 3300046514 Bacteria 12750
424 Ga0495618_0059037 3300046514 Bacteria 2430
425 Ga0495618_0060883 3300046514 Bacteria 2394
426 Ga0495628_0042060 3300046516 Bacteria 3646
427 Ga0495628_0042157 3300046516 Bacteria 3641
428 Ga0495628_0167358 3300046516 Unclassified 1668
429 Ga0495630_0011056 3300046517 Bacteria 6530
430 Ga0495630_0236109 3300046517 Bacteria 1397
431 Ga0495630_0274270 3300046517 Unclassified 1288
432 Ga0495630_1465810 3300046517 Bacteria 512
433 Ga0495631_0266390 3300046518 Unclassified 730
434 Ga0495644_0002002 3300046523 Bacteria 8189
435 Ga0495666_0012241 3300046526 Bacteria 4278
436 Ga0495666_0231010 3300046526 Bacteria 846
437 Ga0495652_0049908 3300046529 Bacteria 3580
438 Ga0495652_0126228 3300046529 Bacteria 2032
439 Ga0495665_0066837 3300046531 Bacteria 1896
440 Ga0495665_0079457 3300046531 Bacteria 1726
441 Ga0495640_0007732 3300046533 Bacteria 8454
442 Ga0495640_0017299 3300046533 Bacteria 5375
443 Ga0495640_0088894 3300046533 Bacteria 2041
444 Ga0495640_0426770 3300046533 Bacteria 812
445 Ga0495640_0512432 3300046533 Bacteria 729
446 Ga0495586_0115034 3300046535 Bacteria 1499
447 Ga0495587_0005039 3300046536 Bacteria 8644
448 Ga0495587_0025016 3300046536 Bacteria 3652
449 Ga0495598_0029634 3300046537 Bacteria 1527
450 Ga0495621_0031214 3300046539 Bacteria 1826
451 Ga0495645_0054915 3300046543 Bacteria 2893
452 Ga0495645_0083127 3300046543 Bacteria 2295
453 Ga0495622_0005809 3300046557 Bacteria 5725
454 Ga0495633_0062710 3300046558 Bacteria 1740
455 Ga0495667_0007034 3300046559 Bacteria 7635
456 Ga0495667_0025648 3300046559 Bacteria 3971
457 Ga0495656_0004111 3300046615 Bacteria 4959
458 Ga0495656_0472632 3300046615 Bacteria 662
459 Ga0495634_0023235 3300046642 Bacteria 4360
460 Ga0495634_0023747 3300046642 Bacteria 4308
461 Ga0495634_0066626 3300046642 Bacteria 2383
462 Ga0495635_0000123 3300046663 Bacteria 47100
463 Ga0495635_0016669 3300046663 Bacteria 5132
464 Ga0495635_0028200 3300046663 Bacteria 3902
465 Ga0495635_0403273 3300046663 Bacteria 908
466 Ga0495659_0005964 3300046664 Bacteria 3853
467 Ga0495661_0450825 3300046665 Unclassified 619
468 Ga0495657_0053038 3300046675 Bacteria 2715
469 Ga0495657_0578651 3300046675 Unclassified 651
470 Ga0495623_0027923 3300046679 Bacteria 3632
471 Ga0495646_0394989 3300046680 Bacteria 719
472 Ga0495646_0458610 3300046680 Bacteria 657
473 Ga0495658_0028746 3300046683 Bacteria 3003
474 Ga0495658_0070520 3300046683 Bacteria 2028
475 Ga0495613_0011532 3300046689 Bacteria 6572
476 Ga0495613_0075584 3300046689 Bacteria 2452
477 Ga0495613_0581777 3300046689 Bacteria 746
478 Ga0495624_0007113 3300046690 Bacteria 7874
479 Ga0495624_0032056 3300046690 Bacteria 3410
480 Ga0495624_0032178 3300046690 Bacteria 3402
481 Ga0495670_0109158 3300046691 Bacteria 1430
482 Ga0495589_0140097 3300046794 Bacteria 1159
483 Ga0495600_0003659 3300046809 Bacteria 9072
484 Ga0495600_0017154 3300046809 Bacteria 4603
485 Ga0495581_0092475 3300047315 Bacteria 1756
486 Ga0495581_0127145 3300047315 Bacteria 1484
487 Ga0495581_0533863 3300047315 Unclassified 681
488 Ga0495604_0001090 3300047317 Bacteria 22540
489 Ga0495674_0003125 3300047319 Bacteria 16088
490 Ga0495674_0003227 3300047319 Bacteria 15826
491 Ga0495674_0051128 3300047319 Bacteria 3643
492 Ga0495674_0674258 3300047319 Bacteria 813
493 Ga0495672_0068914 3300047320 Bacteria 2009
494 Ga0495672_0083535 3300047320 Bacteria 1773
495 Ga0495672_0390470 3300047320 Bacteria 638
496 Ga0495676_0048612 3300047321 Bacteria 3418
497 Ga0495676_0169834 3300047321 Bacteria 1536
498 Ga0495680_0000795 3300047322 Bacteria 35314
499 Ga0495680_0034293 3300047322 Bacteria 4100
500 Ga0495675_0012693 3300047444 Bacteria 5302
501 Ga0495685_110080 3300047447 Bacteria 907
502 Ga0495684_0000749 3300047471 Bacteria 26152
503 Ga0495684_0005001 3300047471 Bacteria 10343
504 Ga0495684_0045684 3300047471 Bacteria 3351
505 Ga0495684_0241459 3300047471 Unclassified 1317
506 Ga0495684_0386998 3300047471 Bacteria 985
507 Ga0495593_0015854 3300047673 Bacteria 4258
508 Ga0495593_0030374 3300047673 Bacteria 2957
509 Ga0495593_0032696 3300047673 Bacteria 2834
510 Ga0495602_0010500 3300048088 Bacteria 9612
511 Ga0495614_0062147 3300048089 Unclassified 1605
512 Ga0495615_0145978 3300048090 Bacteria 701
513 Ga0496102_0917145 3300048905 Bacteria 797
514 Ga0496102_1043177 3300048905 Bacteria 738
515 Ga0496104_0024135 3300048907 Bacteria 5595
516 Ga0496104_0053401 3300048907 Bacteria 3817
517 Ga0496105_0101024 3300048908 Bacteria 2382
518 Ga0496105_0491339 3300048908 Unclassified 964
519 Ga0496108_0224829 3300048911 Bacteria 1631
520 Ga0496109_0050071 3300048912 Bacteria 3804
521 Ga0496109_0359865 3300048912 Bacteria 1375
522 Ga0496109_0988760 3300048912 Bacteria 779
523 Ga0496110_0877540 3300048913 Bacteria 803
524 Ga0496110_0895654 3300048913 Bacteria 793
525 Ga0496110_1014122 3300048913 Bacteria 737
526 Ga0496112_0033592 3300048915 Bacteria 4988
527 Ga0496112_0291937 3300048915 Unclassified 1576
528 Ga0496112_0487143 3300048915 Bacteria 1169
529 Ga0496113_0583455 3300048916 Bacteria 895
530 Ga0496114_0546219 3300048917 Bacteria 1024
531 Ga0496115_0101256 3300048918 Bacteria 2362
532 Ga0496115_0215529 3300048918 Bacteria 1585
533 Ga0496121_0851621 3300048924 Bacteria 530
534 Ga0501031_0031022 3300049568 Bacteria 3487
535 Ga0501032_0059539 3300049569 Bacteria 2563
536 Ga0501032_0062470 3300049569 Bacteria 2495
537 Ga0501033_0040248 3300049570 Bacteria 3489
538 Ga0501033_0070880 3300049570 Bacteria 2560
539 Ga0501033_0570069 3300049570 Bacteria 779
540 Ga0501034_0013154 3300049571 Bacteria 8526
541 Ga0501034_0096083 3300049571 Bacteria 2959
542 Ga0501034_0146830 3300049571 Bacteria 2335
543 Ga0501034_0294414 3300049571 Bacteria 1560
544 Ga0501036_0044592 3300049572 Bacteria 3756
545 Ga0501036_0113731 3300049572 Bacteria 2287
546 Ga0501036_0114984 3300049572 Bacteria 2273
547 Ga0501036_0147305 3300049572 Bacteria 1986
548 Ga0501037_0042004 3300049573 Bacteria 3361
549 Ga0501037_0060221 3300049573 Bacteria 2769
550 Ga0501038_0011644 3300049574 Bacteria 8022
551 Ga0501038_0069318 3300049574 Bacteria 2996
552 Ga0501038_0604407 3300049574 Bacteria 829
553 Ga0501039_0041347 3300049575 Bacteria 3560
554 Ga0501039_0073039 3300049575 Bacteria 2666
555 Ga0501039_0159357 3300049575 Bacteria 1773
556 Ga0501041_0105902 3300049577 Bacteria 1743
557 Ga0501042_0210813 3300049578 Bacteria 1401
558 Ga0501043_0071642 3300049579 Bacteria 2721
559 Ga0501043_0566252 3300049579 Bacteria 842
560 Ga0501046_0007517 3300049580 Bacteria 9559
561 Ga0501047_0017331 3300049581 Bacteria 6897
562 Ga0501047_0034032 3300049581 Bacteria 4919
563 Ga0501047_0309758 3300049581 Bacteria 1420
564 Ga0501048_0069544 3300049582 Bacteria 2486
565 Ga0501048_0954238 3300049582 Bacteria 617
566 Ga0501068_0148428 3300049584 Bacteria 1472
567 Ga0501069_0004867 3300049585 Bacteria 6952
568 Ga0501069_0339881 3300049585 Bacteria 884
569 Ga0501070_0081637 3300049586 Bacteria 2675
570 Ga0501070_0180298 3300049586 Bacteria 1738
571 Ga0501070_0262070 3300049586 Bacteria 1413
572 Ga0501070_1013826 3300049586 Bacteria 643
573 Ga0501071_0087604 3300049587 Bacteria 2284
574 Ga0501071_0273103 3300049587 Bacteria 1278
575 Ga0501071_0385727 3300049587 Bacteria 1069
576 Ga0501071_0774074 3300049587 Bacteria 740
577 Ga0501072_0036661 3300049588 Bacteria 3845
578 Ga0501073_0005794 3300049589 Bacteria 9230
579 Ga0501073_0848373 3300049589 Bacteria 629
580 Ga0501074_0009242 3300049590 Bacteria 7162
581 Ga0501074_0236391 3300049590 Bacteria 1300
582 Ga0501075_1313344 3300049591 Bacteria 548
583 Ga0501076_0076895 3300049592 Bacteria 2677
584 Ga0501076_0100058 3300049592 Bacteria 2336
585 Ga0501077_0176909 3300049593 Bacteria 1356
586 Ga0501077_0685708 3300049593 Bacteria 658
587 Ga0501079_0011312 3300049741 Bacteria 6808
588 Ga0501079_0421103 3300049741 Bacteria 1048
589 Ga0501080_0006188 3300049742 Bacteria 10739
590 Ga0501081_0053659 3300049743 Bacteria 2783
591 Ga0501081_0904448 3300049743 Bacteria 666
592 Ga0501035_0016634 3300049822 Bacteria 6782
593 Ga0501044_0057344 3300049823 Bacteria 3997
594 Ga0501044_0059044 3300049823 Bacteria 3931
595 Ga0501044_0164521 3300049823 Bacteria 2193
596 Ga0501044_0355563 3300049823 Bacteria 1383
597 Ga0501044_0606519 3300049823 Bacteria 987
598 Ga0501045_0018386 3300049824 Bacteria 4972
599 Ga0501045_0463722 3300049824 Bacteria 941
600 nmdc:mga03683_380645_c1 3300050489 Bacteria 672
601 nmdc:mga03683_508270_c1 3300050489 Bacteria 584
602 nmdc:mga03n38_139062_c1 3300050490 Bacteria 1211
603 nmdc:mga0yw44_137591_c1 3300050492 Bacteria 1585
604 nmdc:mga05p37_13288_c1 3300050507 Bacteria 9859
605 nmdc:mga05p37_1461_c1 3300050507 Bacteria 27452
606 nmdc:mga05p37_168622_c1 3300050507 Bacteria 2671
607 nmdc:mga05p37_2463_c1 3300050507 Bacteria 21532
608 nmdc:mga05p37_941134_c1 3300050507 Bacteria 926
609 nmdc:mga09592_50692_c1 3300050508 Bacteria 3501
610 nmdc:mga09592_7282_c1 3300050508 Bacteria 8990
611 nmdc:mga09592_8553_c1 3300050508 Bacteria 8325
612 nmdc:mga0qj67_16649_c1 3300050509 Bacteria 5579
613 nmdc:mga0qj67_170_c1 3300050509 Bacteria 43684
614 nmdc:mga0qj67_9055_c1 3300050509 Bacteria 7389
615 nmdc:mga06r32_2531_c1 3300050510 Bacteria 16356
616 nmdc:mga06r32_724_c1 3300050510 Bacteria 28932
617 nmdc:mga08y16_2434_c1 3300050511 Bacteria 19121
618 nmdc:mga08y16_709843_c1 3300050511 Bacteria 1005
619 nmdc:mga0n895_59194_c1 3300050512 Bacteria 3780
620 nmdc:mga0n895_608225_c1 3300050512 Bacteria 1095
621 nmdc:mga0rr50_10240_c1 3300050513 Bacteria 5939
622 nmdc:mga0rr50_1332_c1 3300050513 Bacteria 13470
623 nmdc:mga0rr50_221725_c1 3300050513 Bacteria 1562
624 nmdc:mga08x19_134106_c1 3300050514 Bacteria 1668
625 nmdc:mga08x19_633803_c1 3300050514 Bacteria 758
626 nmdc:mga0a205_2168_c1 3300050515 Bacteria 17263
627 nmdc:mga0a205_30759_c1 3300050515 Bacteria 5142
628 nmdc:mga0a205_71456_c1 3300050515 Bacteria 3351
629 Ga0495601_0000788 3300053077 Bacteria 17125
630 Ga0495601_0000993 3300053077 Bacteria 15524
631 Ga0495601_0063962 3300053077 Bacteria 2338
632 Ga0495612_0002372 3300053078 Bacteria 7760
633 Ga0495612_0004290 3300053078 Bacteria 5918
634 Ga0495612_0257587 3300053078 Bacteria 777
635 Ga0495595_0001232 3300053084 Bacteria 9952
636 Ga0495595_0002216 3300053084 Bacteria 7554
637 Ga0495595_0064703 3300053084 Bacteria 1719
638 Ga0495619_0013867 3300053085 Bacteria 5085
639 Ga0495619_0017925 3300053085 Bacteria 4488
640 Ga0495619_0091584 3300053085 Bacteria 2058
641 Ga0495619_0106586 3300053085 Bacteria 1911
642 Ga0495619_0266395 3300053085 Bacteria 1187
643 Ga0500566_0115858 3300053094 Bacteria 1451
644 Ga0500641_0134010 3300053096 Bacteria 1069
645 Ga0500641_0205451 3300053096 Bacteria 839
646 Ga0500556_0081920 3300053104 Bacteria 1221
647 Ga0500652_024985 3300053131 Bacteria 2285
648 Ga0500658_0090420 3300053134 Bacteria 1323
649 Ga0500588_0084819 3300053146 Bacteria 1067
650 Ga0500616_0009163 3300053153 Bacteria 6044
651 Ga0500616_0062803 3300053153 Bacteria 1917
652 Ga0500620_204835 3300053155 Bacteria 672
653 Ga0500627_0106149 3300053158 Bacteria 1263
654 Ga0500657_218971 3300053728 Unclassified 607
655 Ga0501084_0266209 3300054114 Bacteria 1447
656 Ga0501082_0017828 3300060353 Bacteria 6116
657 Ga0501082_0049411 3300060353 Bacteria 3627
658 Ga0530510_0183692 3300061734 Bacteria 1551

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021377 Ga0213874_10061480 Ga0213874_100614801 134
2 3300039450 Ga0436363_1459938 Ga0436363_1459938_546_953 134
3 3300005331 Ga0070670_100206397 Ga0070670_1002063972 140
4 3300005343 Ga0070687_100171875 Ga0070687_1001718752 140
5 3300005544 Ga0070686_100045805 Ga0070686_1000458052 140
6 3300005564 Ga0070664_100088118 Ga0070664_1000881182 140
7 3300005577 Ga0068857_100113880 Ga0068857_1001138802 140
8 3300005842 Ga0068858_100154141 Ga0068858_1001541412 140
9 3300025912 Ga0207707_10056212 Ga0207707_100562122 140
10 3300025914 Ga0207671_10235157 Ga0207671_102351572 140
11 3300025925 Ga0207650_10550419 Ga0207650_105504192 140
12 3300025926 Ga0207659_10523704 Ga0207659_105237042 140
13 3300025945 Ga0207679_10185108 Ga0207679_101851082 140
14 3300026116 Ga0207674_10132479 Ga0207674_101324792 140
15 3300027695 Ga0209966_1011053 Ga0209966_10110532 140
16 3300027717 Ga0209998_10011603 Ga0209998_100116032 140
17 3300005577 Ga0068857_102328770 Ga0068857_1023287701 143
18 3300047320 Ga0495672_0390470 Ga0495672_0390470_36_482 143
19 3300049571 Ga0501034_0096083 Ga0501034_0096083_270_758 143
20 3300049574 Ga0501038_0604407 Ga0501038_0604407_73_561 143
21 3300049589 Ga0501073_0848373 Ga0501073_0848373_17_505 143
22 3300050509 nmdc:mga0qj67_170_c1 nmdc:mga0qj67_170_c1_21180_21650 143
23 3300005364 Ga0070673_102052632 Ga0070673_1020526321 144
24 3300005435 Ga0070714_101927255 Ga0070714_1019272551 144
25 3300005437 Ga0070710_10225189 Ga0070710_102251892 144
26 3300005439 Ga0070711_100301869 Ga0070711_1003018692 144
27 3300005458 Ga0070681_10490479 Ga0070681_104904791 144
28 3300005539 Ga0068853_100333224 Ga0068853_1003332243 144
29 3300005547 Ga0070693_100275548 Ga0070693_1002755481 144
30 3300005563 Ga0068855_100588219 Ga0068855_1005882193 144
31 3300005577 Ga0068857_100345172 Ga0068857_1003451723 144
32 3300005578 Ga0068854_101246359 Ga0068854_1012463591 144
33 3300005614 Ga0068856_100304550 Ga0068856_1003045502 144
34 3300005719 Ga0068861_100587785 Ga0068861_1005877852 144
35 3300006175 Ga0070712_100258150 Ga0070712_1002581502 144
36 3300006871 Ga0075434_100359268 Ga0075434_1003592682 144
37 3300006871 Ga0075434_100759146 Ga0075434_1007591462 144
38 3300007076 Ga0075435_100141657 Ga0075435_1001416572 144
39 3300007076 Ga0075435_100527289 Ga0075435_1005272892 144
40 3300009093 Ga0105240_10678991 Ga0105240_106789913 144
41 3300009174 Ga0105241_10494820 Ga0105241_104948202 144
42 3300009545 Ga0105237_11146229 Ga0105237_111462291 144
43 3300009551 Ga0105238_10331509 Ga0105238_103315092 144
44 3300013100 Ga0157373_10555732 Ga0157373_105557322 144
45 3300013102 Ga0157371_10699397 Ga0157371_106993971 144
46 3300013104 Ga0157370_10310949 Ga0157370_103109492 144
47 3300013105 Ga0157369_11079552 Ga0157369_110795521 144
48 3300013307 Ga0157372_11079471 Ga0157372_110794711 144
49 3300014326 Ga0157380_10780205 Ga0157380_107802052 144
50 3300020070 Ga0206356_11108289 Ga0206356_111082891 144
51 3300025912 Ga0207707_10273042 Ga0207707_102730422 144
52 3300025913 Ga0207695_10864705 Ga0207695_108647052 144
53 3300025915 Ga0207693_10005443 Ga0207693_100054433 144
54 3300025949 Ga0207667_10592228 Ga0207667_105922282 144
55 3300026041 Ga0207639_10985650 Ga0207639_109856502 144
56 3300026116 Ga0207674_10312861 Ga0207674_103128613 144
57 3300049572 Ga0501036_0147305 Ga0501036_0147305_1153_1605 144
58 3300049575 Ga0501039_0073039 Ga0501039_0073039_540_992 144
59 3300049577 Ga0501041_0105902 Ga0501041_0105902_616_1068 144
60 3300049578 Ga0501042_0210813 Ga0501042_0210813_431_883 144
61 3300049585 Ga0501069_0339881 Ga0501069_0339881_114_566 144
62 3300049586 Ga0501070_0262070 Ga0501070_0262070_774_1226 144
63 3300049587 Ga0501071_0273103 Ga0501071_0273103_593_1045 144
64 3300049588 Ga0501072_0036661 Ga0501072_0036661_454_906 144
65 3300049590 Ga0501074_0236391 Ga0501074_0236391_145_597 144
66 3300049592 Ga0501076_0076895 Ga0501076_0076895_1241_1693 144
67 3300049593 Ga0501077_0176909 Ga0501077_0176909_529_981 144
68 3300049741 Ga0501079_0421103 Ga0501079_0421103_22_474 144
69 3300049743 Ga0501081_0053659 Ga0501081_0053659_370_822 144
70 3300049824 Ga0501045_0463722 Ga0501045_0463722_74_526 144
71 3300050514 nmdc:mga08x19_134106_c1 nmdc:mga08x19_134106_c1_97_531 144
72 3300054114 Ga0501084_0266209 Ga0501084_0266209_517_969 144
73 3300060353 Ga0501082_0049411 Ga0501082_0049411_2160_2612 144
74 3300061734 Ga0530510_0183692 Ga0530510_0183692_762_1214 144
75 3300003203 JGI25406J46586_10086473 JGI25406J46586_100864731 145
76 3300003911 JGI25405J52794_10039346 JGI25405J52794_100393462 145
77 3300005289 Ga0065704_10333562 Ga0065704_103335622 145
78 3300005295 Ga0065707_10122472 Ga0065707_101224723 145
79 3300005327 Ga0070658_10137841 Ga0070658_101378412 145
80 3300005328 Ga0070676_10672576 Ga0070676_106725762 145
81 3300005329 Ga0070683_100259155 Ga0070683_1002591553 145
82 3300005330 Ga0070690_100153982 Ga0070690_1001539822 145
83 3300005331 Ga0070670_100013182 Ga0070670_1000131823 145
84 3300005334 Ga0068869_100070724 Ga0068869_1000707242 145
85 3300005334 Ga0068869_100501342 Ga0068869_1005013422 145
86 3300005335 Ga0070666_10006300 Ga0070666_100063006 145
87 3300005335 Ga0070666_10081831 Ga0070666_100818312 145
88 3300005337 Ga0070682_100011027 Ga0070682_1000110272 145
89 3300005338 Ga0068868_100194630 Ga0068868_1001946303 145
90 3300005339 Ga0070660_100723766 Ga0070660_1007237662 145
91 3300005340 Ga0070689_101050319 Ga0070689_1010503191 145
92 3300005340 Ga0070689_101292477 Ga0070689_1012924771 145
93 3300005343 Ga0070687_100124262 Ga0070687_1001242622 145
94 3300005343 Ga0070687_100253001 Ga0070687_1002530012 145
95 3300005344 Ga0070661_100047285 Ga0070661_1000472853 145
96 3300005344 Ga0070661_100398069 Ga0070661_1003980692 145
97 3300005347 Ga0070668_101180770 Ga0070668_1011807702 145
98 3300005353 Ga0070669_100307605 Ga0070669_1003076051 145
99 3300005354 Ga0070675_100415291 Ga0070675_1004152912 145
100 3300005355 Ga0070671_100050140 Ga0070671_1000501403 145
101 3300005355 Ga0070671_100350017 Ga0070671_1003500172 145
102 3300005356 Ga0070674_100045236 Ga0070674_1000452362 145
103 3300005356 Ga0070674_100367218 Ga0070674_1003672182 145
104 3300005364 Ga0070673_100348700 Ga0070673_1003487002 145
105 3300005365 Ga0070688_100336163 Ga0070688_1003361632 145
106 3300005366 Ga0070659_100310041 Ga0070659_1003100412 145
107 3300005367 Ga0070667_100970156 Ga0070667_1009701561 145
108 3300005434 Ga0070709_10003768 Ga0070709_100037686 145
109 3300005434 Ga0070709_10697926 Ga0070709_106979262 145
110 3300005435 Ga0070714_100019011 Ga0070714_1000190112 145
111 3300005436 Ga0070713_100002318 Ga0070713_1000023188 145
112 3300005436 Ga0070713_100181181 Ga0070713_1001811812 145
113 3300005437 Ga0070710_10008161 Ga0070710_100081612 145
114 3300005437 Ga0070710_10160535 Ga0070710_101605352 145
115 3300005437 Ga0070710_10583110 Ga0070710_105831102 145
116 3300005439 Ga0070711_100092544 Ga0070711_1000925442 145
117 3300005439 Ga0070711_100142043 Ga0070711_1001420433 145
118 3300005439 Ga0070711_101131538 Ga0070711_1011315382 145
119 3300005441 Ga0070700_100148520 Ga0070700_1001485202 145
120 3300005441 Ga0070700_101774421 Ga0070700_1017744211 145
121 3300005455 Ga0070663_100793675 Ga0070663_1007936751 145
122 3300005456 Ga0070678_100175432 Ga0070678_1001754321 145
123 3300005457 Ga0070662_100600206 Ga0070662_1006002062 145
124 3300005458 Ga0070681_10035305 Ga0070681_100353055 145
125 3300005459 Ga0068867_100158894 Ga0068867_1001588942 145
126 3300005459 Ga0068867_101592018 Ga0068867_1015920181 145
127 3300005466 Ga0070685_10023556 Ga0070685_100235562 145
128 3300005471 Ga0070698_101264242 Ga0070698_1012642422 145
129 3300005530 Ga0070679_100002402 Ga0070679_1000024025 145
130 3300005535 Ga0070684_100084206 Ga0070684_1000842062 145
131 3300005535 Ga0070684_100179541 Ga0070684_1001795412 145
132 3300005535 Ga0070684_100436862 Ga0070684_1004368622 145
133 3300005539 Ga0068853_100250317 Ga0068853_1002503172 145
134 3300005544 Ga0070686_100005122 Ga0070686_1000051223 145
135 3300005544 Ga0070686_100236217 Ga0070686_1002362172 145
136 3300005547 Ga0070693_100406140 Ga0070693_1004061402 145
137 3300005548 Ga0070665_100054360 Ga0070665_1000543602 145
138 3300005564 Ga0070664_100082756 Ga0070664_1000827563 145
139 3300005614 Ga0068856_100372112 Ga0068856_1003721122 145
140 3300005615 Ga0070702_100092938 Ga0070702_1000929382 145
141 3300005617 Ga0068859_100504790 Ga0068859_1005047902 145
142 3300005618 Ga0068864_100096201 Ga0068864_1000962012 145
143 3300005618 Ga0068864_100181158 Ga0068864_1001811582 145
144 3300005718 Ga0068866_10114499 Ga0068866_101144992 145
145 3300005718 Ga0068866_10420455 Ga0068866_104204552 145
146 3300005719 Ga0068861_100690806 Ga0068861_1006908061 145
147 3300005719 Ga0068861_100698118 Ga0068861_1006981182 145
148 3300005834 Ga0068851_10284088 Ga0068851_102840882 145
149 3300005841 Ga0068863_100265435 Ga0068863_1002654352 145
150 3300005841 Ga0068863_100776882 Ga0068863_1007768821 145
151 3300005842 Ga0068858_100109723 Ga0068858_1001097232 145
152 3300005843 Ga0068860_100026842 Ga0068860_1000268426 145
153 3300005937 Ga0081455_10000009 Ga0081455_10000009207 145
154 3300005985 Ga0081539_10002225 Ga0081539_1000222523 145
155 3300006028 Ga0070717_10046865 Ga0070717_100468653 145
156 3300006028 Ga0070717_10360066 Ga0070717_103600661 145
157 3300006028 Ga0070717_10451238 Ga0070717_104512382 145
158 3300006028 Ga0070717_11114502 Ga0070717_111145021 145
159 3300006048 Ga0075363_100162774 Ga0075363_1001627742 145
160 3300006058 Ga0075432_10001176 Ga0075432_100011762 145
161 3300006163 Ga0070715_10000335 Ga0070715_100003356 145
162 3300006163 Ga0070715_10036610 Ga0070715_100366102 145
163 3300006173 Ga0070716_100021991 Ga0070716_1000219912 145
164 3300006173 Ga0070716_100180886 Ga0070716_1001808862 145
165 3300006173 Ga0070716_100679198 Ga0070716_1006791982 145
166 3300006173 Ga0070716_101443632 Ga0070716_1014436321 145
167 3300006175 Ga0070712_100002895 Ga0070712_1000028952 145
168 3300006175 Ga0070712_100011668 Ga0070712_1000116685 145
169 3300006175 Ga0070712_100072081 Ga0070712_1000720812 145
170 3300006175 Ga0070712_100248078 Ga0070712_1002480782 145
171 3300006175 Ga0070712_100398798 Ga0070712_1003987982 145
172 3300006175 Ga0070712_100931077 Ga0070712_1009310772 145
173 3300006177 Ga0075362_10533837 Ga0075362_105338371 145
174 3300006178 Ga0075367_10236971 Ga0075367_102369712 145
175 3300006186 Ga0075369_10093136 Ga0075369_100931361 145
176 3300006194 Ga0075427_10000004 Ga0075427_100000048 145
177 3300006237 Ga0097621_102180347 Ga0097621_1021803471 145
178 3300006353 Ga0075370_10644727 Ga0075370_106447272 145
179 3300006358 Ga0068871_100050987 Ga0068871_1000509873 145
180 3300006358 Ga0068871_100234468 Ga0068871_1002344682 145
181 3300006844 Ga0075428_100008326 Ga0075428_1000083268 145
182 3300006844 Ga0075428_100067187 Ga0075428_1000671875 145
183 3300006844 Ga0075428_100765921 Ga0075428_1007659212 145
184 3300006844 Ga0075428_100793794 Ga0075428_1007937941 145
185 3300006846 Ga0075430_100001186 Ga0075430_1000011869 145
186 3300006846 Ga0075430_100024049 Ga0075430_1000240495 145
187 3300006846 Ga0075430_100355025 Ga0075430_1003550252 145
188 3300006847 Ga0075431_100000495 Ga0075431_10000049521 145
189 3300006847 Ga0075431_100001446 Ga0075431_1000014468 145
190 3300006852 Ga0075433_10000215 Ga0075433_1000021535 145
191 3300006852 Ga0075433_10104188 Ga0075433_101041882 145
192 3300006852 Ga0075433_10873017 Ga0075433_108730171 145
193 3300006852 Ga0075433_11240700 Ga0075433_112407002 145
194 3300006871 Ga0075434_100003016 Ga0075434_10000301615 145
195 3300006871 Ga0075434_100025301 Ga0075434_1000253016 145
196 3300006871 Ga0075434_100125041 Ga0075434_1001250412 145
197 3300006880 Ga0075429_100002098 Ga0075429_10000209820 145
198 3300006880 Ga0075429_100090214 Ga0075429_1000902142 145
199 3300006914 Ga0075436_100420179 Ga0075436_1004201791 145
200 3300006931 Ga0097620_100504767 Ga0097620_1005047672 145
201 3300007076 Ga0075435_100009478 Ga0075435_1000094783 145
202 3300009011 Ga0105251_10043757 Ga0105251_100437573 145
203 3300009092 Ga0105250_10170438 Ga0105250_101704381 145
204 3300009093 Ga0105240_10317677 Ga0105240_103176772 145
205 3300009093 Ga0105240_11719008 Ga0105240_117190082 145
206 3300009094 Ga0111539_10002796 Ga0111539_1000279617 145
207 3300009094 Ga0111539_10008242 Ga0111539_1000824211 145
208 3300009094 Ga0111539_10251597 Ga0111539_102515972 145
209 3300009094 Ga0111539_10406262 Ga0111539_104062622 145
210 3300009098 Ga0105245_10115883 Ga0105245_101158833 145
211 3300009101 Ga0105247_10028332 Ga0105247_100283322 145
212 3300009101 Ga0105247_10100661 Ga0105247_101006612 145
213 3300009147 Ga0114129_10001495 Ga0114129_1000149521 145
214 3300009147 Ga0114129_10007384 Ga0114129_100073845 145
215 3300009147 Ga0114129_10019783 Ga0114129_1001978310 145
216 3300009147 Ga0114129_10133267 Ga0114129_101332674 145
217 3300009147 Ga0114129_10177048 Ga0114129_101770484 145
218 3300009148 Ga0105243_10104484 Ga0105243_101044842 145
219 3300009148 Ga0105243_10341872 Ga0105243_103418722 145
220 3300009174 Ga0105241_10061040 Ga0105241_100610403 145
221 3300009174 Ga0105241_10284963 Ga0105241_102849631 145
222 3300009176 Ga0105242_10049393 Ga0105242_100493932 145
223 3300009176 Ga0105242_11839339 Ga0105242_118393391 145
224 3300009545 Ga0105237_10150790 Ga0105237_101507902 145
225 3300009545 Ga0105237_10459736 Ga0105237_104597362 145
226 3300009551 Ga0105238_10135924 Ga0105238_101359242 145
227 3300009553 Ga0105249_10540192 Ga0105249_105401922 145
228 3300011119 Ga0105246_10053412 Ga0105246_100534122 145
229 3300011119 Ga0105246_10208340 Ga0105246_102083402 145
230 3300012480 Ga0157346_1009594 Ga0157346_10095942 145
231 3300013104 Ga0157370_10339456 Ga0157370_103394562 145
232 3300013296 Ga0157374_11649764 Ga0157374_116497641 145
233 3300013297 Ga0157378_10139807 Ga0157378_101398073 145
234 3300013297 Ga0157378_10576564 Ga0157378_105765642 145
235 3300013297 Ga0157378_12766164 Ga0157378_127661641 145
236 3300013306 Ga0163162_10165484 Ga0163162_101654843 145
237 3300013306 Ga0163162_10923055 Ga0163162_109230552 145
238 3300013306 Ga0163162_11789809 Ga0163162_117898091 145
239 3300013308 Ga0157375_10120161 Ga0157375_101201613 145
240 3300013308 Ga0157375_10298887 Ga0157375_102988872 145
241 3300013308 Ga0157375_13795309 Ga0157375_137953091 145
242 3300014325 Ga0163163_10469870 Ga0163163_104698702 145
243 3300014325 Ga0163163_10473011 Ga0163163_104730112 145
244 3300014326 Ga0157380_10597913 Ga0157380_105979131 145
245 3300014326 Ga0157380_10845584 Ga0157380_108455842 145
246 3300014326 Ga0157380_10911653 Ga0157380_109116532 145
247 3300014326 Ga0157380_12131205 Ga0157380_121312051 145
248 3300014497 Ga0182008_10275622 Ga0182008_102756222 145
249 3300014745 Ga0157377_10044078 Ga0157377_100440782 145
250 3300014745 Ga0157377_10188715 Ga0157377_101887152 145
251 3300014968 Ga0157379_10064249 Ga0157379_100642493 145
252 3300014968 Ga0157379_10361684 Ga0157379_103616842 145
253 3300014969 Ga0157376_10375267 Ga0157376_103752672 145
254 3300017792 Ga0163161_10260409 Ga0163161_102604092 145
255 3300017792 Ga0163161_11233541 Ga0163161_112335411 145
256 3300017792 Ga0163161_11340637 Ga0163161_113406371 145
257 3300021377 Ga0213874_10179409 Ga0213874_101794092 145
258 3300021384 Ga0213876_10073520 Ga0213876_100735202 145
259 3300021384 Ga0213876_10146184 Ga0213876_101461842 145
260 3300021388 Ga0213875_10199452 Ga0213875_101994521 145
261 3300024227 Ga0228598_1002219 Ga0228598_10022194 145
262 3300025315 Ga0207697_10013424 Ga0207697_100134244 145
263 3300025893 Ga0207682_10002089 Ga0207682_100020896 145
264 3300025898 Ga0207692_10254017 Ga0207692_102540172 145
265 3300025898 Ga0207692_10463361 Ga0207692_104633611 145
266 3300025899 Ga0207642_10038995 Ga0207642_100389952 145
267 3300025900 Ga0207710_10028228 Ga0207710_100282282 145
268 3300025901 Ga0207688_10014043 Ga0207688_100140434 145
269 3300025905 Ga0207685_10088139 Ga0207685_100881391 145
270 3300025906 Ga0207699_10352861 Ga0207699_103528612 145
271 3300025907 Ga0207645_10031461 Ga0207645_100314613 145
272 3300025908 Ga0207643_10027396 Ga0207643_100273963 145
273 3300025909 Ga0207705_10143590 Ga0207705_101435902 145
274 3300025911 Ga0207654_10166642 Ga0207654_101666421 145
275 3300025911 Ga0207654_10181127 Ga0207654_101811272 145
276 3300025912 Ga0207707_10318070 Ga0207707_103180702 145
277 3300025913 Ga0207695_10205081 Ga0207695_102050812 145
278 3300025914 Ga0207671_10365813 Ga0207671_103658132 145
279 3300025915 Ga0207693_10003273 Ga0207693_1000327310 145
280 3300025915 Ga0207693_10014672 Ga0207693_100146722 145
281 3300025915 Ga0207693_10174965 Ga0207693_101749651 145
282 3300025916 Ga0207663_10079122 Ga0207663_100791222 145
283 3300025916 Ga0207663_10939683 Ga0207663_109396832 145
284 3300025917 Ga0207660_10094398 Ga0207660_100943983 145
285 3300025918 Ga0207662_10019411 Ga0207662_100194112 145
286 3300025919 Ga0207657_10017549 Ga0207657_100175496 145
287 3300025923 Ga0207681_10123224 Ga0207681_101232243 145
288 3300025923 Ga0207681_10688715 Ga0207681_106887152 145
289 3300025924 Ga0207694_10114676 Ga0207694_101146762 145
290 3300025926 Ga0207659_10299907 Ga0207659_102999072 145
291 3300025926 Ga0207659_10351761 Ga0207659_103517612 145
292 3300025926 Ga0207659_10406867 Ga0207659_104068672 145
293 3300025928 Ga0207700_10302824 Ga0207700_103028242 145
294 3300025928 Ga0207700_10437230 Ga0207700_104372302 145
295 3300025929 Ga0207664_10023134 Ga0207664_100231343 145
296 3300025933 Ga0207706_10262066 Ga0207706_102620662 145
297 3300025935 Ga0207709_10062004 Ga0207709_100620042 145
298 3300025937 Ga0207669_10076635 Ga0207669_100766352 145
299 3300025937 Ga0207669_10443128 Ga0207669_104431281 145
300 3300025939 Ga0207665_10240069 Ga0207665_102400692 145
301 3300025939 Ga0207665_10357104 Ga0207665_103571042 145
302 3300025939 Ga0207665_10437298 Ga0207665_104372982 145
303 3300025940 Ga0207691_10036320 Ga0207691_100363205 145
304 3300025942 Ga0207689_10026402 Ga0207689_100264022 145
305 3300025942 Ga0207689_10119517 Ga0207689_101195172 145
306 3300025944 Ga0207661_10652341 Ga0207661_106523411 145
307 3300025945 Ga0207679_10508951 Ga0207679_105089512 145
308 3300025972 Ga0207668_10144447 Ga0207668_101444472 145
309 3300025972 Ga0207668_10985533 Ga0207668_109855332 145
310 3300025986 Ga0207658_11403338 Ga0207658_114033382 145
311 3300026023 Ga0207677_11013672 Ga0207677_110136722 145
312 3300026035 Ga0207703_10293550 Ga0207703_102935502 145
313 3300026075 Ga0207708_10282951 Ga0207708_102829511 145
314 3300026078 Ga0207702_10151197 Ga0207702_101511971 145
315 3300026088 Ga0207641_10823780 Ga0207641_108237802 145
316 3300026088 Ga0207641_11350220 Ga0207641_113502201 145
317 3300026089 Ga0207648_11410204 Ga0207648_114102041 145
318 3300026095 Ga0207676_10377832 Ga0207676_103778322 145
319 3300026118 Ga0207675_100110657 Ga0207675_1001106572 145
320 3300026118 Ga0207675_100723876 Ga0207675_1007238762 145
321 3300026121 Ga0207683_10008669 Ga0207683_100086694 145
322 3300027907 Ga0207428_10000216 Ga0207428_1000021649 145
323 3300027907 Ga0207428_10005674 Ga0207428_1000567410 145
324 3300027907 Ga0207428_10363745 Ga0207428_103637452 145
325 3300028380 Ga0268265_10253148 Ga0268265_102531482 145
326 3300028556 Ga0265337_1001192 Ga0265337_10011924 145
327 3300028786 Ga0307517_10449559 Ga0307517_104495592 145
328 3300028800 Ga0265338_10315196 Ga0265338_103151962 145
329 3300030760 Ga0265762_1110991 Ga0265762_11109912 145
330 3300031090 Ga0265760_10245209 Ga0265760_102452091 145
331 3300031235 Ga0265330_10043603 Ga0265330_100436032 145
332 3300031235 Ga0265330_10044424 Ga0265330_100444242 145
333 3300031239 Ga0265328_10100542 Ga0265328_101005421 145
334 3300031241 Ga0265325_10336510 Ga0265325_103365101 145
335 3300031241 Ga0265325_10414322 Ga0265325_104143222 145
336 3300031242 Ga0265329_10054423 Ga0265329_100544232 145
337 3300031247 Ga0265340_10021741 Ga0265340_100217413 145
338 3300031247 Ga0265340_10360897 Ga0265340_103608971 145
339 3300031249 Ga0265339_10085982 Ga0265339_100859822 145
340 3300031344 Ga0265316_10062118 Ga0265316_100621184 145
341 3300031344 Ga0265316_10204847 Ga0265316_102048472 145
342 3300031456 Ga0307513_10157895 Ga0307513_101578952 145
343 3300031456 Ga0307513_10326947 Ga0307513_103269472 145
344 3300031595 Ga0265313_10091912 Ga0265313_100919122 145
345 3300031595 Ga0265313_10333797 Ga0265313_103337972 145
346 3300031711 Ga0265314_10098095 Ga0265314_100980952 145
347 3300031712 Ga0265342_10132046 Ga0265342_101320461 145
348 3300032002 Ga0307416_101871711 Ga0307416_1018717111 145
349 3300032002 Ga0307416_102155928 Ga0307416_1021559281 145
350 3300035083 Ga0373926_0027700 Ga0373926_0027700_95_532 145
351 3300035111 Ga0373923_0207429 Ga0373923_0207429_139_576 145
352 3300035113 Ga0373936_0295959 Ga0373936_0295959_71_508 145
353 3300035116 Ga0373945_0002014 Ga0373945_0002014_1060_1497 145
354 3300035116 Ga0373945_0002085 Ga0373945_0002085_314_751 145
355 3300035117 Ga0373953_0054225 Ga0373953_0054225_543_980 145
356 3300035119 Ga0373956_0015218 Ga0373956_0015218_205_642 145
357 3300035119 Ga0373956_0041589 Ga0373956_0041589_174_611 145
358 3300035120 Ga0373957_0033295 Ga0373957_0033295_547_984 145
359 3300035120 Ga0373957_0112329 Ga0373957_0112329_549_986 145
360 3300035170 Ga0373943_0013910 Ga0373943_0013910_1201_1638 145
361 3300035170 Ga0373943_0024601 Ga0373943_0024601_1094_1531 145
362 3300035170 Ga0373943_0078918 Ga0373943_0078918_683_1120 145
363 3300035171 Ga0373946_0001923 Ga0373946_0001923_5247_5684 145
364 3300035171 Ga0373946_0031860 Ga0373946_0031860_1537_1974 145
365 3300035171 Ga0373946_0037161 Ga0373946_0037161_454_891 145
366 3300035172 Ga0373955_0095658 Ga0373955_0095658_1168_1605 145
367 3300035241 Ga0373961_0003036 Ga0373961_0003036_2728_3165 145
368 3300035242 Ga0373962_0196113 Ga0373962_0196113_183_620 145
369 3300035410 Ga0373924_0184637 Ga0373924_0184637_470_907 145
370 3300035410 Ga0373924_0242140 Ga0373924_0242140_116_553 145
371 3300035410 Ga0373924_0324726 Ga0373924_0324726_58_495 145
372 3300035691 Ga0373931_0027626 Ga0373931_0027626_541_978 145
373 3300035691 Ga0373931_0133597 Ga0373931_0133597_97_534 145
374 3300035691 Ga0373931_1233336 Ga0373931_1233336_30_467 145
375 3300035692 Ga0373935_0042243 Ga0373935_0042243_1772_2209 145
376 3300035692 Ga0373935_0056027 Ga0373935_0056027_18_455 145
377 3300035692 Ga0373935_0101292 Ga0373935_0101292_48_485 145
378 3300035692 Ga0373935_0350398 Ga0373935_0350398_140_577 145
379 3300035695 Ga0373927_0001051 Ga0373927_0001051_11294_11731 145
380 3300035695 Ga0373927_0062052 Ga0373927_0062052_1552_1989 145
381 3300035695 Ga0373927_0107975 Ga0373927_0107975_603_1040 145
382 3300035695 Ga0373927_0341711 Ga0373927_0341711_359_796 145
383 3300035724 Ga0373933_0025433 Ga0373933_0025433_547_984 145
384 3300035724 Ga0373933_0100245 Ga0373933_0100245_970_1407 145
385 3300035724 Ga0373933_0144981 Ga0373933_0144981_1021_1458 145
386 3300035725 Ga0373947_0014697 Ga0373947_0014697_1974_2411 145
387 3300035725 Ga0373947_0061602 Ga0373947_0061602_1688_2125 145
388 3300035725 Ga0373947_0169495 Ga0373947_0169495_250_687 145
389 3300036401 Ga0373937_0003621 Ga0373937_0003621_2404_2841 145
390 3300036401 Ga0373937_0250362 Ga0373937_0250362_263_700 145
391 3300036401 Ga0373937_0485462 Ga0373937_0485462_633_1070 145
392 3300037068 Ga0373925_0001925 Ga0373925_0001925_1935_2372 145
393 3300037068 Ga0373925_0277865 Ga0373925_0277865_338_775 145
394 3300037853 Ga0436364_0172837 Ga0436364_0172837_81_518 145
395 3300037853 Ga0436364_0768079 Ga0436364_0768079_31245_31682 145
396 3300039437 Ga0436365_0015204 Ga0436365_0015204_1294_1731 145
397 3300039437 Ga0436365_0330093 Ga0436365_0330093_3490_3927 145
398 3300039437 Ga0436365_0956437 Ga0436365_0956437_1018_1455 145
399 3300039437 Ga0436365_1020485 Ga0436365_1020485_512_949 145
400 3300039437 Ga0436365_1274046 Ga0436365_1274046_1723_2160 145
401 3300039438 Ga0436360_0975963 Ga0436360_0975963_779_1216 145
402 3300039438 Ga0436360_1342663 Ga0436360_1342663_64_501 145
403 3300039450 Ga0436363_1229486 Ga0436363_1229486_957_1421 145
404 3300039453 Ga0436362_0612627 Ga0436362_0612627_370_807 145
405 3300041408 Ga0439453_0000869 Ga0439453_0000869_2184_2630 145
406 3300041408 Ga0439453_0001995 Ga0439453_0001995_1934_2374 145
407 3300041494 Ga0451837_1680603 Ga0451837_1680603_21_494 145
408 3300042001 Ga0439441_007857 Ga0439441_007857_839_1285 145
409 3300042003 Ga0439443_004727 Ga0439443_004727_48_494 145
410 3300042156 Ga0439446_0323384 Ga0439446_0323384_35_472 145
411 3300042435 Ga0439434_0029200 Ga0439434_0029200_239_676 145
412 3300042436 Ga0439435_0004045 Ga0439435_0004045_984_1430 145
413 3300042461 Ga0439460_0012318 Ga0439460_0012318_269_715 145
414 3300042993 Ga0439440_0149830 Ga0439440_0149830_74_511 145
415 3300046454 Ga0495592_0011867 Ga0495592_0011867_1525_1962 145
416 3300046454 Ga0495592_0180366 Ga0495592_0180366_558_995 145
417 3300046455 Ga0495603_0266359 Ga0495603_0266359_116_553 145
418 3300046455 Ga0495603_0530640 Ga0495603_0530640_96_533 145
419 3300046459 Ga0495629_0000409 Ga0495629_0000409_3224_3661 145
420 3300046459 Ga0495629_0082303 Ga0495629_0082303_494_931 145
421 3300046459 Ga0495629_0227625 Ga0495629_0227625_89_526 145
422 3300046460 Ga0495638_0025735 Ga0495638_0025735_75_512 145
423 3300046462 Ga0495651_0001051 Ga0495651_0001051_3109_3546 145
424 3300046463 Ga0495653_0006259 Ga0495653_0006259_619_1056 145
425 3300046463 Ga0495653_0018050 Ga0495653_0018050_2085_2522 145
426 3300046463 Ga0495653_0051356 Ga0495653_0051356_1510_1947 145
427 3300046472 Ga0495580_0008552 Ga0495580_0008552_7116_7553 145
428 3300046473 Ga0495582_0003989 Ga0495582_0003989_6732_7169 145
429 3300046473 Ga0495582_0088007 Ga0495582_0088007_245_682 145
430 3300046474 Ga0495605_0135393 Ga0495605_0135393_654_1091 145
431 3300046475 Ga0495639_0042949 Ga0495639_0042949_1085_1522 145
432 3300046475 Ga0495639_0136735 Ga0495639_0136735_74_511 145
433 3300046475 Ga0495639_0320789 Ga0495639_0320789_237_674 145
434 3300046476 Ga0495662_0016819 Ga0495662_0016819_3009_3446 145
435 3300046476 Ga0495662_0056662 Ga0495662_0056662_1289_1726 145
436 3300046476 Ga0495662_0130487 Ga0495662_0130487_95_532 145
437 3300046476 Ga0495662_0169498 Ga0495662_0169498_429_866 145
438 3300046477 Ga0495664_0005906 Ga0495664_0005906_2220_2657 145
439 3300046477 Ga0495664_0030144 Ga0495664_0030144_1696_2133 145
440 3300046477 Ga0495664_0072871 Ga0495664_0072871_412_849 145
441 3300046492 Ga0495585_0003749 Ga0495585_0003749_7289_7726 145
442 3300046499 Ga0495594_0015128 Ga0495594_0015128_2794_3231 145
443 3300046499 Ga0495594_0396163 Ga0495594_0396163_26_463 145
444 3300046501 Ga0495607_0175372 Ga0495607_0175372_167_604 145
445 3300046511 Ga0495608_0006648 Ga0495608_0006648_6019_6456 145
446 3300046514 Ga0495618_0002201 Ga0495618_0002201_8377_8814 145
447 3300046514 Ga0495618_0059037 Ga0495618_0059037_1070_1507 145
448 3300046514 Ga0495618_0060883 Ga0495618_0060883_1356_1793 145
449 3300046516 Ga0495628_0042060 Ga0495628_0042060_3066_3503 145
450 3300046516 Ga0495628_0042157 Ga0495628_0042157_1963_2400 145
451 3300046516 Ga0495628_0167358 Ga0495628_0167358_686_1123 145
452 3300046517 Ga0495630_0011056 Ga0495630_0011056_2425_2862 145
453 3300046517 Ga0495630_0236109 Ga0495630_0236109_290_727 145
454 3300046517 Ga0495630_0274270 Ga0495630_0274270_65_502 145
455 3300046517 Ga0495630_1465810 Ga0495630_1465810_16_453 145
456 3300046518 Ga0495631_0266390 Ga0495631_0266390_77_514 145
457 3300046523 Ga0495644_0002002 Ga0495644_0002002_6499_6936 145
458 3300046526 Ga0495666_0012241 Ga0495666_0012241_981_1418 145
459 3300046526 Ga0495666_0231010 Ga0495666_0231010_37_474 145
460 3300046529 Ga0495652_0049908 Ga0495652_0049908_2639_3076 145
461 3300046529 Ga0495652_0126228 Ga0495652_0126228_1018_1455 145
462 3300046531 Ga0495665_0066837 Ga0495665_0066837_1114_1551 145
463 3300046531 Ga0495665_0079457 Ga0495665_0079457_481_918 145
464 3300046533 Ga0495640_0007732 Ga0495640_0007732_3953_4390 145
465 3300046533 Ga0495640_0017299 Ga0495640_0017299_601_1038 145
466 3300046533 Ga0495640_0088894 Ga0495640_0088894_934_1371 145
467 3300046533 Ga0495640_0426770 Ga0495640_0426770_90_527 145
468 3300046533 Ga0495640_0512432 Ga0495640_0512432_63_500 145
469 3300046535 Ga0495586_0115034 Ga0495586_0115034_170_607 145
470 3300046536 Ga0495587_0005039 Ga0495587_0005039_4530_4967 145
471 3300046536 Ga0495587_0025016 Ga0495587_0025016_3114_3551 145
472 3300046537 Ga0495598_0029634 Ga0495598_0029634_778_1215 145
473 3300046539 Ga0495621_0031214 Ga0495621_0031214_863_1309 145
474 3300046543 Ga0495645_0054915 Ga0495645_0054915_1763_2200 145
475 3300046543 Ga0495645_0083127 Ga0495645_0083127_1204_1641 145
476 3300046557 Ga0495622_0005809 Ga0495622_0005809_20_457 145
477 3300046558 Ga0495633_0062710 Ga0495633_0062710_875_1312 145
478 3300046559 Ga0495667_0007034 Ga0495667_0007034_5500_5937 145
479 3300046559 Ga0495667_0025648 Ga0495667_0025648_3118_3555 145
480 3300046615 Ga0495656_0004111 Ga0495656_0004111_793_1230 145
481 3300046615 Ga0495656_0472632 Ga0495656_0472632_91_528 145
482 3300046642 Ga0495634_0023235 Ga0495634_0023235_890_1327 145
483 3300046642 Ga0495634_0023747 Ga0495634_0023747_2237_2674 145
484 3300046642 Ga0495634_0066626 Ga0495634_0066626_794_1231 145
485 3300046663 Ga0495635_0000123 Ga0495635_0000123_34720_35157 145
486 3300046663 Ga0495635_0016669 Ga0495635_0016669_4026_4463 145
487 3300046663 Ga0495635_0028200 Ga0495635_0028200_3381_3818 145
488 3300046663 Ga0495635_0403273 Ga0495635_0403273_198_635 145
489 3300046664 Ga0495659_0005964 Ga0495659_0005964_3078_3515 145
490 3300046665 Ga0495661_0450825 Ga0495661_0450825_171_608 145
491 3300046675 Ga0495657_0053038 Ga0495657_0053038_429_866 145
492 3300046675 Ga0495657_0578651 Ga0495657_0578651_32_469 145
493 3300046679 Ga0495623_0027923 Ga0495623_0027923_908_1345 145
494 3300046680 Ga0495646_0394989 Ga0495646_0394989_119_556 145
495 3300046680 Ga0495646_0458610 Ga0495646_0458610_199_636 145
496 3300046683 Ga0495658_0028746 Ga0495658_0028746_836_1273 145
497 3300046683 Ga0495658_0070520 Ga0495658_0070520_1199_1636 145
498 3300046689 Ga0495613_0011532 Ga0495613_0011532_4951_5388 145
499 3300046689 Ga0495613_0075584 Ga0495613_0075584_605_1042 145
500 3300046689 Ga0495613_0581777 Ga0495613_0581777_154_591 145
501 3300046690 Ga0495624_0007113 Ga0495624_0007113_5966_6403 145
502 3300046690 Ga0495624_0032056 Ga0495624_0032056_1247_1684 145
503 3300046690 Ga0495624_0032178 Ga0495624_0032178_390_827 145
504 3300046691 Ga0495670_0109158 Ga0495670_0109158_957_1394 145
505 3300046794 Ga0495589_0140097 Ga0495589_0140097_576_1013 145
506 3300046809 Ga0495600_0003659 Ga0495600_0003659_2299_2736 145
507 3300046809 Ga0495600_0017154 Ga0495600_0017154_2600_3037 145
508 3300047315 Ga0495581_0092475 Ga0495581_0092475_177_614 145
509 3300047315 Ga0495581_0127145 Ga0495581_0127145_198_635 145
510 3300047315 Ga0495581_0533863 Ga0495581_0533863_119_556 145
511 3300047317 Ga0495604_0001090 Ga0495604_0001090_12931_13368 145
512 3300047319 Ga0495674_0003125 Ga0495674_0003125_11262_11699 145
513 3300047319 Ga0495674_0003227 Ga0495674_0003227_3955_4392 145
514 3300047319 Ga0495674_0051128 Ga0495674_0051128_1859_2296 145
515 3300047319 Ga0495674_0674258 Ga0495674_0674258_196_633 145
516 3300047320 Ga0495672_0068914 Ga0495672_0068914_1445_1882 145
517 3300047320 Ga0495672_0083535 Ga0495672_0083535_464_901 145
518 3300047321 Ga0495676_0048612 Ga0495676_0048612_2902_3339 145
519 3300047321 Ga0495676_0169834 Ga0495676_0169834_787_1224 145
520 3300047322 Ga0495680_0000795 Ga0495680_0000795_25208_25645 145
521 3300047322 Ga0495680_0034293 Ga0495680_0034293_488_925 145
522 3300047444 Ga0495675_0012693 Ga0495675_0012693_604_1041 145
523 3300047447 Ga0495685_110080 Ga0495685_110080_324_761 145
524 3300047471 Ga0495684_0000749 Ga0495684_0000749_958_1395 145
525 3300047471 Ga0495684_0005001 Ga0495684_0005001_3249_3686 145
526 3300047471 Ga0495684_0045684 Ga0495684_0045684_1986_2423 145
527 3300047471 Ga0495684_0241459 Ga0495684_0241459_793_1230 145
528 3300047471 Ga0495684_0386998 Ga0495684_0386998_422_859 145
529 3300047673 Ga0495593_0015854 Ga0495593_0015854_413_850 145
530 3300047673 Ga0495593_0030374 Ga0495593_0030374_1891_2328 145
531 3300047673 Ga0495593_0032696 Ga0495593_0032696_1311_1748 145
532 3300048088 Ga0495602_0010500 Ga0495602_0010500_3844_4281 145
533 3300048089 Ga0495614_0062147 Ga0495614_0062147_1041_1478 145
534 3300048090 Ga0495615_0145978 Ga0495615_0145978_237_674 145
535 3300048905 Ga0496102_0917145 Ga0496102_0917145_328_765 145
536 3300048905 Ga0496102_1043177 Ga0496102_1043177_257_694 145
537 3300048907 Ga0496104_0024135 Ga0496104_0024135_2554_2991 145
538 3300048907 Ga0496104_0053401 Ga0496104_0053401_1451_1888 145
539 3300048908 Ga0496105_0101024 Ga0496105_0101024_666_1103 145
540 3300048908 Ga0496105_0491339 Ga0496105_0491339_438_875 145
541 3300048911 Ga0496108_0224829 Ga0496108_0224829_692_1129 145
542 3300048912 Ga0496109_0050071 Ga0496109_0050071_1413_1850 145
543 3300048912 Ga0496109_0359865 Ga0496109_0359865_421_858 145
544 3300048912 Ga0496109_0988760 Ga0496109_0988760_187_624 145
545 3300048913 Ga0496110_0877540 Ga0496110_0877540_44_484 145
546 3300048913 Ga0496110_0895654 Ga0496110_0895654_17_454 145
547 3300048913 Ga0496110_1014122 Ga0496110_1014122_247_684 145
548 3300048915 Ga0496112_0033592 Ga0496112_0033592_3723_4160 145
549 3300048915 Ga0496112_0291937 Ga0496112_0291937_233_670 145
550 3300048915 Ga0496112_0487143 Ga0496112_0487143_624_1064 145
551 3300048916 Ga0496113_0583455 Ga0496113_0583455_194_631 145
552 3300048917 Ga0496114_0546219 Ga0496114_0546219_25_462 145
553 3300048918 Ga0496115_0101256 Ga0496115_0101256_290_736 145
554 3300048918 Ga0496115_0215529 Ga0496115_0215529_809_1246 145
555 3300048924 Ga0496121_0851621 Ga0496121_0851621_59_499 145
556 3300049568 Ga0501031_0031022 Ga0501031_0031022_1555_1992 145
557 3300049569 Ga0501032_0059539 Ga0501032_0059539_452_889 145
558 3300049569 Ga0501032_0062470 Ga0501032_0062470_1332_1772 145
559 3300049570 Ga0501033_0040248 Ga0501033_0040248_937_1377 145
560 3300049570 Ga0501033_0070880 Ga0501033_0070880_1005_1442 145
561 3300049570 Ga0501033_0570069 Ga0501033_0570069_293_730 145
562 3300049571 Ga0501034_0013154 Ga0501034_0013154_2048_2488 145
563 3300049571 Ga0501034_0146830 Ga0501034_0146830_1211_1648 145
564 3300049571 Ga0501034_0294414 Ga0501034_0294414_689_1126 145
565 3300049572 Ga0501036_0044592 Ga0501036_0044592_2596_3036 145
566 3300049572 Ga0501036_0113731 Ga0501036_0113731_319_756 145
567 3300049572 Ga0501036_0114984 Ga0501036_0114984_897_1334 145
568 3300049573 Ga0501037_0042004 Ga0501037_0042004_809_1249 145
569 3300049573 Ga0501037_0060221 Ga0501037_0060221_1003_1440 145
570 3300049574 Ga0501038_0011644 Ga0501038_0011644_1344_1784 145
571 3300049574 Ga0501038_0069318 Ga0501038_0069318_1369_1806 145
572 3300049575 Ga0501039_0041347 Ga0501039_0041347_2700_3137 145
573 3300049575 Ga0501039_0159357 Ga0501039_0159357_748_1188 145
574 3300049579 Ga0501043_0071642 Ga0501043_0071642_1023_1463 145
575 3300049579 Ga0501043_0566252 Ga0501043_0566252_275_712 145
576 3300049580 Ga0501046_0007517 Ga0501046_0007517_1592_2032 145
577 3300049581 Ga0501047_0017331 Ga0501047_0017331_419_859 145
578 3300049581 Ga0501047_0034032 Ga0501047_0034032_908_1345 145
579 3300049581 Ga0501047_0309758 Ga0501047_0309758_736_1173 145
580 3300049582 Ga0501048_0069544 Ga0501048_0069544_1606_2046 145
581 3300049582 Ga0501048_0954238 Ga0501048_0954238_36_473 145
582 3300049584 Ga0501068_0148428 Ga0501068_0148428_830_1270 145
583 3300049585 Ga0501069_0004867 Ga0501069_0004867_6438_6878 145
584 3300049586 Ga0501070_0081637 Ga0501070_0081637_99_539 145
585 3300049586 Ga0501070_0180298 Ga0501070_0180298_473_910 145
586 3300049586 Ga0501070_1013826 Ga0501070_1013826_125_562 145
587 3300049587 Ga0501071_0087604 Ga0501071_0087604_1405_1845 145
588 3300049587 Ga0501071_0385727 Ga0501071_0385727_470_907 145
589 3300049587 Ga0501071_0774074 Ga0501071_0774074_50_487 145
590 3300049589 Ga0501073_0005794 Ga0501073_0005794_7102_7542 145
591 3300049590 Ga0501074_0009242 Ga0501074_0009242_5002_5442 145
592 3300049591 Ga0501075_1313344 Ga0501075_1313344_49_486 145
593 3300049592 Ga0501076_0100058 Ga0501076_0100058_825_1265 145
594 3300049593 Ga0501077_0685708 Ga0501077_0685708_182_622 145
595 3300049741 Ga0501079_0011312 Ga0501079_0011312_4721_5161 145
596 3300049742 Ga0501080_0006188 Ga0501080_0006188_2776_3216 145
597 3300049743 Ga0501081_0904448 Ga0501081_0904448_169_606 145
598 3300049822 Ga0501035_0016634 Ga0501035_0016634_5460_5897 145
599 3300049823 Ga0501044_0057344 Ga0501044_0057344_1764_2201 145
600 3300049823 Ga0501044_0059044 Ga0501044_0059044_563_1000 145
601 3300049823 Ga0501044_0164521 Ga0501044_0164521_1051_1491 145
602 3300049823 Ga0501044_0355563 Ga0501044_0355563_419_859 145
603 3300049823 Ga0501044_0606519 Ga0501044_0606519_210_647 145
604 3300049824 Ga0501045_0018386 Ga0501045_0018386_3570_4010 145
605 3300050489 nmdc:mga03683_380645_c1 nmdc:mga03683_380645_c1_142_582 145
606 3300050489 nmdc:mga03683_508270_c1 nmdc:mga03683_508270_c1_51_488 145
607 3300050490 nmdc:mga03n38_139062_c1 nmdc:mga03n38_139062_c1_424_864 145
608 3300050492 nmdc:mga0yw44_137591_c1 nmdc:mga0yw44_137591_c1_1006_1443 145
609 3300050507 nmdc:mga05p37_13288_c1 nmdc:mga05p37_13288_c1_3966_4403 145
610 3300050507 nmdc:mga05p37_1461_c1 nmdc:mga05p37_1461_c1_17884_18321 145
611 3300050507 nmdc:mga05p37_168622_c1 nmdc:mga05p37_168622_c1_2036_2506 145
612 3300050507 nmdc:mga05p37_2463_c1 nmdc:mga05p37_2463_c1_14149_14586 145
613 3300050507 nmdc:mga05p37_941134_c1 nmdc:mga05p37_941134_c1_428_865 145
614 3300050508 nmdc:mga09592_50692_c1 nmdc:mga09592_50692_c1_298_768 145
615 3300050508 nmdc:mga09592_7282_c1 nmdc:mga09592_7282_c1_8147_8584 145
616 3300050508 nmdc:mga09592_8553_c1 nmdc:mga09592_8553_c1_4812_5249 145
617 3300050509 nmdc:mga0qj67_16649_c1 nmdc:mga0qj67_16649_c1_3663_4100 145
618 3300050509 nmdc:mga0qj67_9055_c1 nmdc:mga0qj67_9055_c1_5017_5454 145
619 3300050510 nmdc:mga06r32_2531_c1 nmdc:mga06r32_2531_c1_7976_8413 145
620 3300050510 nmdc:mga06r32_724_c1 nmdc:mga06r32_724_c1_17890_18327 145
621 3300050511 nmdc:mga08y16_2434_c1 nmdc:mga08y16_2434_c1_17901_18338 145
622 3300050511 nmdc:mga08y16_709843_c1 nmdc:mga08y16_709843_c1_369_815 145
623 3300050512 nmdc:mga0n895_59194_c1 nmdc:mga0n895_59194_c1_1791_2228 145
624 3300050512 nmdc:mga0n895_608225_c1 nmdc:mga0n895_608225_c1_516_953 145
625 3300050513 nmdc:mga0rr50_10240_c1 nmdc:mga0rr50_10240_c1_594_1031 145
626 3300050513 nmdc:mga0rr50_1332_c1 nmdc:mga0rr50_1332_c1_946_1383 145
627 3300050513 nmdc:mga0rr50_221725_c1 nmdc:mga0rr50_221725_c1_933_1370 145
628 3300050514 nmdc:mga08x19_633803_c1 nmdc:mga08x19_633803_c1_281_718 145
629 3300050515 nmdc:mga0a205_2168_c1 nmdc:mga0a205_2168_c1_11682_12119 145
630 3300050515 nmdc:mga0a205_30759_c1 nmdc:mga0a205_30759_c1_4567_5004 145
631 3300050515 nmdc:mga0a205_71456_c1 nmdc:mga0a205_71456_c1_2762_3199 145
632 3300053077 Ga0495601_0000788 Ga0495601_0000788_11475_11912 145
633 3300053077 Ga0495601_0000993 Ga0495601_0000993_10862_11299 145
634 3300053077 Ga0495601_0063962 Ga0495601_0063962_1185_1622 145
635 3300053078 Ga0495612_0002372 Ga0495612_0002372_924_1361 145
636 3300053078 Ga0495612_0004290 Ga0495612_0004290_3724_4161 145
637 3300053078 Ga0495612_0257587 Ga0495612_0257587_70_507 145
638 3300053084 Ga0495595_0001232 Ga0495595_0001232_4303_4740 145
639 3300053084 Ga0495595_0002216 Ga0495595_0002216_388_825 145
640 3300053084 Ga0495595_0064703 Ga0495595_0064703_991_1428 145
641 3300053085 Ga0495619_0013867 Ga0495619_0013867_2640_3077 145
642 3300053085 Ga0495619_0017925 Ga0495619_0017925_2440_2877 145
643 3300053085 Ga0495619_0091584 Ga0495619_0091584_1326_1763 145
644 3300053085 Ga0495619_0106586 Ga0495619_0106586_454_891 145
645 3300053085 Ga0495619_0266395 Ga0495619_0266395_228_665 145
646 3300053094 Ga0500566_0115858 Ga0500566_0115858_60_497 145
647 3300053096 Ga0500641_0134010 Ga0500641_0134010_354_791 145
648 3300053096 Ga0500641_0205451 Ga0500641_0205451_362_799 145
649 3300053104 Ga0500556_0081920 Ga0500556_0081920_209_649 145
650 3300053131 Ga0500652_024985 Ga0500652_024985_1735_2175 145
651 3300053134 Ga0500658_0090420 Ga0500658_0090420_531_968 145
652 3300053146 Ga0500588_0084819 Ga0500588_0084819_612_1049 145
653 3300053153 Ga0500616_0009163 Ga0500616_0009163_4137_4574 145
654 3300053153 Ga0500616_0062803 Ga0500616_0062803_586_1107 145
655 3300053155 Ga0500620_204835 Ga0500620_204835_159_599 145
656 3300053158 Ga0500627_0106149 Ga0500627_0106149_438_875 145
657 3300053728 Ga0500657_218971 Ga0500657_218971_33_470 145
658 3300060353 Ga0501082_0017828 Ga0501082_0017828_323_763 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07370

DUF1489

Protein of unknown function (DUF1489)

5

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6unp-assembly1.cif.gz_A crystal structure of the kinase domain of bmpr2-d485g 0.7685 70 91
6unp-assembly2.cif.gz_B crystal structure of the kinase domain of bmpr2-d485g 0.745 70 91
7aw3-assembly1.cif.gz_A mertk kinase domain with type 1 inhibitor from a dna-encoded library 0.7301 70 91
7ab2-assembly1.cif.gz_A crystal structure of mertk kinase domain in complex with unc2025 0.7301 70 91
3g2f-assembly2.cif.gz_B crystal structure of the kinase domain of bone morphogenetic protein receptor type ii (bmpr2) at 2.35 a resolution 0.7276 70 91
ID Description Score Start End Superfamily
af_Q59SK8_134_235_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.772 74 92 3.30.780.10
af_Q4DA00_7_80_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7691 70 92 3.30.70.330
af_H2KYF8_56_139_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7431 71 92 3.30.200.20
af_B0V0H4_197_291_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7412 70 91 3.30.200.20
af_I1KDW8_1_247_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7376 70 91 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A527A188-F1-model_v4 DUF1489 family protein 0.9907 1 121
AF-A0A1Q7BFD3-F1-model_v4 Lysophospholipase 0.9897 1 145
AF-A0A537N8T8-F1-model_v4 DUF1489 family protein 0.9861 1 145
AF-A0A527VSX3-F1-model_v4 DUF1489 family protein 0.9791 1 70
AF-A0A527A188-F1-model_v4 DUF1489 family protein 0.9747 1 121

Feature Viewer

pLDDT pTM Quality
93.56 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map