F473153
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 352 | 658 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_101927255|Ga0070714_1019272551 |
| Length | 144 |
| Sequence | MPLHLIKLCVGCDSVADLEDWIQQKLREKKRRGQKPEHIHTTRMQPKRAEDLAGGSLYWVIRGQITCRERILALRSATGKDGIKRCQLVLDGKLVLVEPRPRSAFQGWRYLEGKDAPRDLARAAPGAFRMPEQMRRELRELGLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 215 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 216 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 217 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 218 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 219 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 220 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 221 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 222 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 343 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 348 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.19 |
| Nodule | 0 |
| Rhizoplane | 3.04 |
| Rhizosphere | 90.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10086473 | 3300003203 | Bacteria | 952 |
| 2 | JGI25405J52794_10039346 | 3300003911 | Unclassified | 997 |
| 3 | Ga0065704_10333562 | 3300005289 | Bacteria | 823 |
| 4 | Ga0065707_10122472 | 3300005295 | Bacteria | 2087 |
| 5 | Ga0070658_10137841 | 3300005327 | Bacteria | 2037 |
| 6 | Ga0070676_10672576 | 3300005328 | Bacteria | 753 |
| 7 | Ga0070683_100259155 | 3300005329 | Bacteria | 1654 |
| 8 | Ga0070690_100153982 | 3300005330 | Bacteria | 1570 |
| 9 | Ga0070670_100013182 | 3300005331 | Bacteria | 7080 |
| 10 | Ga0070670_100206397 | 3300005331 | Bacteria | 1708 |
| 11 | Ga0068869_100070724 | 3300005334 | Bacteria | 2582 |
| 12 | Ga0068869_100501342 | 3300005334 | Bacteria | 1014 |
| 13 | Ga0070666_10006300 | 3300005335 | Bacteria | 7298 |
| 14 | Ga0070666_10081831 | 3300005335 | Bacteria | 2208 |
| 15 | Ga0070682_100011027 | 3300005337 | Bacteria | 5153 |
| 16 | Ga0068868_100194630 | 3300005338 | Unclassified | 1687 |
| 17 | Ga0070660_100723766 | 3300005339 | Bacteria | 835 |
| 18 | Ga0070689_101050319 | 3300005340 | Bacteria | 726 |
| 19 | Ga0070689_101292477 | 3300005340 | Bacteria | 657 |
| 20 | Ga0070687_100124262 | 3300005343 | Bacteria | 1480 |
| 21 | Ga0070687_100171875 | 3300005343 | Bacteria | 1290 |
| 22 | Ga0070687_100253001 | 3300005343 | Bacteria | 1095 |
| 23 | Ga0070661_100047285 | 3300005344 | Bacteria | 3148 |
| 24 | Ga0070661_100398069 | 3300005344 | Bacteria | 1088 |
| 25 | Ga0070668_101180770 | 3300005347 | Unclassified | 693 |
| 26 | Ga0070669_100307605 | 3300005353 | Bacteria | 1276 |
| 27 | Ga0070675_100415291 | 3300005354 | Bacteria | 1202 |
| 28 | Ga0070671_100050140 | 3300005355 | Bacteria | 3472 |
| 29 | Ga0070671_100350017 | 3300005355 | Bacteria | 1261 |
| 30 | Ga0070674_100045236 | 3300005356 | Bacteria | 3007 |
| 31 | Ga0070674_100367218 | 3300005356 | Bacteria | 1167 |
| 32 | Ga0070673_100348700 | 3300005364 | Bacteria | 1313 |
| 33 | Ga0070673_102052632 | 3300005364 | Bacteria | 543 |
| 34 | Ga0070688_100336163 | 3300005365 | Bacteria | 1101 |
| 35 | Ga0070659_100310041 | 3300005366 | Unclassified | 1318 |
| 36 | Ga0070667_100970156 | 3300005367 | Bacteria | 792 |
| 37 | Ga0070709_10003768 | 3300005434 | Bacteria | 8153 |
| 38 | Ga0070709_10697926 | 3300005434 | Bacteria | 789 |
| 39 | Ga0070714_100019011 | 3300005435 | Bacteria | 5592 |
| 40 | Ga0070714_101927255 | 3300005435 | Bacteria | 576 |
| 41 | Ga0070713_100002318 | 3300005436 | Bacteria | 12400 |
| 42 | Ga0070713_100181181 | 3300005436 | Bacteria | 1893 |
| 43 | Ga0070710_10008161 | 3300005437 | Bacteria | 5091 |
| 44 | Ga0070710_10160535 | 3300005437 | Bacteria | 1393 |
| 45 | Ga0070710_10225189 | 3300005437 | Bacteria | 1195 |
| 46 | Ga0070710_10583110 | 3300005437 | Unclassified | 776 |
| 47 | Ga0070711_100092544 | 3300005439 | Bacteria | 2182 |
| 48 | Ga0070711_100142043 | 3300005439 | Bacteria | 1801 |
| 49 | Ga0070711_100301869 | 3300005439 | Bacteria | 1273 |
| 50 | Ga0070711_101131538 | 3300005439 | Archaea | 675 |
| 51 | Ga0070700_100148520 | 3300005441 | Bacteria | 1601 |
| 52 | Ga0070700_101774421 | 3300005441 | Bacteria | 531 |
| 53 | Ga0070663_100793675 | 3300005455 | Bacteria | 811 |
| 54 | Ga0070678_100175432 | 3300005456 | Bacteria | 1749 |
| 55 | Ga0070662_100600206 | 3300005457 | Bacteria | 926 |
| 56 | Ga0070681_10035305 | 3300005458 | Bacteria | 5023 |
| 57 | Ga0070681_10490479 | 3300005458 | Bacteria | 1141 |
| 58 | Ga0068867_100158894 | 3300005459 | Bacteria | 1781 |
| 59 | Ga0068867_101592018 | 3300005459 | Unclassified | 610 |
| 60 | Ga0070685_10023556 | 3300005466 | Bacteria | 3372 |
| 61 | Ga0070698_101264242 | 3300005471 | Bacteria | 688 |
| 62 | Ga0070679_100002402 | 3300005530 | Bacteria | 16981 |
| 63 | Ga0070684_100084206 | 3300005535 | Bacteria | 2818 |
| 64 | Ga0070684_100179541 | 3300005535 | Bacteria | 1924 |
| 65 | Ga0070684_100436862 | 3300005535 | Bacteria | 1209 |
| 66 | Ga0068853_100250317 | 3300005539 | Bacteria | 1625 |
| 67 | Ga0068853_100333224 | 3300005539 | Bacteria | 1409 |
| 68 | Ga0070686_100005122 | 3300005544 | Bacteria | 7234 |
| 69 | Ga0070686_100045805 | 3300005544 | Bacteria | 2756 |
| 70 | Ga0070686_100236217 | 3300005544 | Bacteria | 1328 |
| 71 | Ga0070693_100275548 | 3300005547 | Bacteria | 1125 |
| 72 | Ga0070693_100406140 | 3300005547 | Bacteria | 946 |
| 73 | Ga0070665_100054360 | 3300005548 | Bacteria | 4016 |
| 74 | Ga0068855_100588219 | 3300005563 | Bacteria | 1201 |
| 75 | Ga0070664_100082756 | 3300005564 | Bacteria | 2768 |
| 76 | Ga0070664_100088118 | 3300005564 | Bacteria | 2684 |
| 77 | Ga0068857_100113880 | 3300005577 | Bacteria | 2432 |
| 78 | Ga0068857_100345172 | 3300005577 | Bacteria | 1378 |
| 79 | Ga0068857_102328770 | 3300005577 | Bacteria | 526 |
| 80 | Ga0068854_101246359 | 3300005578 | Bacteria | 668 |
| 81 | Ga0068856_100304550 | 3300005614 | Bacteria | 1611 |
| 82 | Ga0068856_100372112 | 3300005614 | Bacteria | 1448 |
| 83 | Ga0070702_100092938 | 3300005615 | Bacteria | 1833 |
| 84 | Ga0068859_100504790 | 3300005617 | Bacteria | 1305 |
| 85 | Ga0068864_100096201 | 3300005618 | Bacteria | 2620 |
| 86 | Ga0068864_100181158 | 3300005618 | Bacteria | 1926 |
| 87 | Ga0068866_10114499 | 3300005718 | Unclassified | 1510 |
| 88 | Ga0068866_10420455 | 3300005718 | Bacteria | 867 |
| 89 | Ga0068861_100587785 | 3300005719 | Bacteria | 1020 |
| 90 | Ga0068861_100690806 | 3300005719 | Bacteria | 947 |
| 91 | Ga0068861_100698118 | 3300005719 | Bacteria | 942 |
| 92 | Ga0068851_10284088 | 3300005834 | Bacteria | 947 |
| 93 | Ga0068863_100265435 | 3300005841 | Bacteria | 1660 |
| 94 | Ga0068863_100776882 | 3300005841 | Bacteria | 954 |
| 95 | Ga0068858_100109723 | 3300005842 | Bacteria | 2576 |
| 96 | Ga0068858_100154141 | 3300005842 | Bacteria | 2161 |
| 97 | Ga0068860_100026842 | 3300005843 | Bacteria | 5549 |
| 98 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 99 | Ga0081539_10002225 | 3300005985 | Bacteria | 28285 |
| 100 | Ga0070717_10046865 | 3300006028 | Bacteria | 3538 |
| 101 | Ga0070717_10360066 | 3300006028 | Bacteria | 1302 |
| 102 | Ga0070717_10451238 | 3300006028 | Bacteria | 1159 |
| 103 | Ga0070717_11114502 | 3300006028 | Bacteria | 719 |
| 104 | Ga0075363_100162774 | 3300006048 | Bacteria | 1264 |
| 105 | Ga0075432_10001176 | 3300006058 | Bacteria | 8386 |
| 106 | Ga0070715_10000335 | 3300006163 | Bacteria | 11724 |
| 107 | Ga0070715_10036610 | 3300006163 | Bacteria | 2026 |
| 108 | Ga0070716_100021991 | 3300006173 | Bacteria | 3366 |
| 109 | Ga0070716_100180886 | 3300006173 | Bacteria | 1384 |
| 110 | Ga0070716_100679198 | 3300006173 | Bacteria | 784 |
| 111 | Ga0070716_101443632 | 3300006173 | Bacteria | 561 |
| 112 | Ga0070712_100002895 | 3300006175 | Bacteria | 10646 |
| 113 | Ga0070712_100011668 | 3300006175 | Bacteria | 5581 |
| 114 | Ga0070712_100072081 | 3300006175 | Bacteria | 2473 |
| 115 | Ga0070712_100248078 | 3300006175 | Bacteria | 1421 |
| 116 | Ga0070712_100258150 | 3300006175 | Bacteria | 1395 |
| 117 | Ga0070712_100398798 | 3300006175 | Bacteria | 1136 |
| 118 | Ga0070712_100931077 | 3300006175 | Bacteria | 750 |
| 119 | Ga0075362_10533837 | 3300006177 | Bacteria | 602 |
| 120 | Ga0075367_10236971 | 3300006178 | Bacteria | 1143 |
| 121 | Ga0075369_10093136 | 3300006186 | Bacteria | 1346 |
| 122 | Ga0075427_10000004 | 3300006194 | Bacteria | 15321 |
| 123 | Ga0097621_102180347 | 3300006237 | Bacteria | 530 |
| 124 | Ga0075370_10644727 | 3300006353 | Bacteria | 643 |
| 125 | Ga0068871_100050987 | 3300006358 | Bacteria | 3349 |
| 126 | Ga0068871_100234468 | 3300006358 | Bacteria | 1594 |
| 127 | Ga0075428_100008326 | 3300006844 | Bacteria | 11493 |
| 128 | Ga0075428_100067187 | 3300006844 | Bacteria | 3925 |
| 129 | Ga0075428_100765921 | 3300006844 | Bacteria | 1027 |
| 130 | Ga0075428_100793794 | 3300006844 | Bacteria | 1006 |
| 131 | Ga0075430_100001186 | 3300006846 | Bacteria | 20900 |
| 132 | Ga0075430_100024049 | 3300006846 | Bacteria | 5187 |
| 133 | Ga0075430_100355025 | 3300006846 | Bacteria | 1210 |
| 134 | Ga0075431_100000495 | 3300006847 | Bacteria | 32766 |
| 135 | Ga0075431_100001446 | 3300006847 | Bacteria | 21870 |
| 136 | Ga0075433_10000215 | 3300006852 | Bacteria | 32818 |
| 137 | Ga0075433_10104188 | 3300006852 | Bacteria | 2513 |
| 138 | Ga0075433_10873017 | 3300006852 | Bacteria | 785 |
| 139 | Ga0075433_11240700 | 3300006852 | Bacteria | 647 |
| 140 | Ga0075434_100003016 | 3300006871 | Bacteria | 14968 |
| 141 | Ga0075434_100025301 | 3300006871 | Bacteria | 5807 |
| 142 | Ga0075434_100125041 | 3300006871 | Bacteria | 2589 |
| 143 | Ga0075434_100359268 | 3300006871 | Bacteria | 1477 |
| 144 | Ga0075434_100759146 | 3300006871 | Bacteria | 987 |
| 145 | Ga0075429_100002098 | 3300006880 | Bacteria | 16630 |
| 146 | Ga0075429_100090214 | 3300006880 | Bacteria | 2673 |
| 147 | Ga0075436_100420179 | 3300006914 | Bacteria | 971 |
| 148 | Ga0097620_100504767 | 3300006931 | Bacteria | 1305 |
| 149 | Ga0075435_100009478 | 3300007076 | Bacteria | 7053 |
| 150 | Ga0075435_100141657 | 3300007076 | Bacteria | 2017 |
| 151 | Ga0075435_100527289 | 3300007076 | Bacteria | 1022 |
| 152 | Ga0105251_10043757 | 3300009011 | Bacteria | 2166 |
| 153 | Ga0105250_10170438 | 3300009092 | Bacteria | 911 |
| 154 | Ga0105240_10317677 | 3300009093 | Bacteria | 1776 |
| 155 | Ga0105240_10678991 | 3300009093 | Bacteria | 1126 |
| 156 | Ga0105240_11719008 | 3300009093 | Bacteria | 655 |
| 157 | Ga0111539_10002796 | 3300009094 | Bacteria | 23160 |
| 158 | Ga0111539_10008242 | 3300009094 | Bacteria | 13266 |
| 159 | Ga0111539_10251597 | 3300009094 | Bacteria | 2057 |
| 160 | Ga0111539_10406262 | 3300009094 | Bacteria | 1586 |
| 161 | Ga0105245_10115883 | 3300009098 | Bacteria | 2498 |
| 162 | Ga0105247_10028332 | 3300009101 | Bacteria | 3388 |
| 163 | Ga0105247_10100661 | 3300009101 | Bacteria | 1847 |
| 164 | Ga0114129_10001495 | 3300009147 | Bacteria | 31629 |
| 165 | Ga0114129_10007384 | 3300009147 | Bacteria | 15644 |
| 166 | Ga0114129_10019783 | 3300009147 | Bacteria | 9583 |
| 167 | Ga0114129_10133267 | 3300009147 | Bacteria | 3411 |
| 168 | Ga0114129_10177048 | 3300009147 | Bacteria | 2905 |
| 169 | Ga0105243_10104484 | 3300009148 | Bacteria | 2358 |
| 170 | Ga0105243_10341872 | 3300009148 | Bacteria | 1371 |
| 171 | Ga0105241_10061040 | 3300009174 | Bacteria | 2902 |
| 172 | Ga0105241_10284963 | 3300009174 | Bacteria | 1412 |
| 173 | Ga0105241_10494820 | 3300009174 | Bacteria | 1089 |
| 174 | Ga0105242_10049393 | 3300009176 | Bacteria | 3424 |
| 175 | Ga0105242_11839339 | 3300009176 | Bacteria | 645 |
| 176 | Ga0105237_10150790 | 3300009545 | Bacteria | 2321 |
| 177 | Ga0105237_10459736 | 3300009545 | Bacteria | 1279 |
| 178 | Ga0105237_11146229 | 3300009545 | Bacteria | 784 |
| 179 | Ga0105238_10135924 | 3300009551 | Bacteria | 2436 |
| 180 | Ga0105238_10331509 | 3300009551 | Bacteria | 1509 |
| 181 | Ga0105249_10540192 | 3300009553 | Bacteria | 1215 |
| 182 | Ga0105246_10053412 | 3300011119 | Bacteria | 2780 |
| 183 | Ga0105246_10208340 | 3300011119 | Bacteria | 1524 |
| 184 | Ga0157346_1009594 | 3300012480 | Bacteria | 688 |
| 185 | Ga0157373_10555732 | 3300013100 | Bacteria | 833 |
| 186 | Ga0157371_10699397 | 3300013102 | Bacteria | 759 |
| 187 | Ga0157370_10310949 | 3300013104 | Bacteria | 1454 |
| 188 | Ga0157370_10339456 | 3300013104 | Bacteria | 1385 |
| 189 | Ga0157369_11079552 | 3300013105 | Bacteria | 821 |
| 190 | Ga0157374_11649764 | 3300013296 | Bacteria | 666 |
| 191 | Ga0157378_10139807 | 3300013297 | Bacteria | 2248 |
| 192 | Ga0157378_10576564 | 3300013297 | Bacteria | 1134 |
| 193 | Ga0157378_12766164 | 3300013297 | Bacteria | 543 |
| 194 | Ga0163162_10165484 | 3300013306 | Bacteria | 2335 |
| 195 | Ga0163162_10923055 | 3300013306 | Bacteria | 985 |
| 196 | Ga0163162_11789809 | 3300013306 | Bacteria | 702 |
| 197 | Ga0157372_11079471 | 3300013307 | Bacteria | 929 |
| 198 | Ga0157375_10120161 | 3300013308 | Bacteria | 2736 |
| 199 | Ga0157375_10298887 | 3300013308 | Bacteria | 1773 |
| 200 | Ga0157375_13795309 | 3300013308 | Bacteria | 501 |
| 201 | Ga0163163_10469870 | 3300014325 | Unclassified | 1318 |
| 202 | Ga0163163_10473011 | 3300014325 | Bacteria | 1314 |
| 203 | Ga0157380_10597913 | 3300014326 | Bacteria | 1091 |
| 204 | Ga0157380_10780205 | 3300014326 | Bacteria | 970 |
| 205 | Ga0157380_10845584 | 3300014326 | Bacteria | 936 |
| 206 | Ga0157380_10911653 | 3300014326 | Bacteria | 906 |
| 207 | Ga0157380_12131205 | 3300014326 | Bacteria | 624 |
| 208 | Ga0182008_10275622 | 3300014497 | Unclassified | 874 |
| 209 | Ga0157377_10044078 | 3300014745 | Bacteria | 2486 |
| 210 | Ga0157377_10188715 | 3300014745 | Bacteria | 1301 |
| 211 | Ga0157379_10064249 | 3300014968 | Bacteria | 3280 |
| 212 | Ga0157379_10361684 | 3300014968 | Bacteria | 1330 |
| 213 | Ga0157376_10375267 | 3300014969 | Bacteria | 1368 |
| 214 | Ga0163161_10260409 | 3300017792 | Bacteria | 1355 |
| 215 | Ga0163161_11233541 | 3300017792 | Bacteria | 648 |
| 216 | Ga0163161_11340637 | 3300017792 | Bacteria | 623 |
| 217 | Ga0206356_11108289 | 3300020070 | Bacteria | 1119 |
| 218 | Ga0213874_10061480 | 3300021377 | Bacteria | 1177 |
| 219 | Ga0213874_10179409 | 3300021377 | Bacteria | 753 |
| 220 | Ga0213876_10073520 | 3300021384 | Bacteria | 1805 |
| 221 | Ga0213876_10146184 | 3300021384 | Bacteria | 1257 |
| 222 | Ga0213875_10199452 | 3300021388 | Bacteria | 941 |
| 223 | Ga0228598_1002219 | 3300024227 | Bacteria | 4247 |
| 224 | Ga0207697_10013424 | 3300025315 | Bacteria | 3418 |
| 225 | Ga0207682_10002089 | 3300025893 | Bacteria | 9046 |
| 226 | Ga0207692_10254017 | 3300025898 | Bacteria | 1054 |
| 227 | Ga0207692_10463361 | 3300025898 | Unclassified | 800 |
| 228 | Ga0207642_10038995 | 3300025899 | Bacteria | 2060 |
| 229 | Ga0207710_10028228 | 3300025900 | Bacteria | 2435 |
| 230 | Ga0207688_10014043 | 3300025901 | Bacteria | 4355 |
| 231 | Ga0207685_10088139 | 3300025905 | Bacteria | 1300 |
| 232 | Ga0207699_10352861 | 3300025906 | Bacteria | 1039 |
| 233 | Ga0207645_10031461 | 3300025907 | Bacteria | 3414 |
| 234 | Ga0207643_10027396 | 3300025908 | Bacteria | 3159 |
| 235 | Ga0207705_10143590 | 3300025909 | Bacteria | 1784 |
| 236 | Ga0207654_10166642 | 3300025911 | Bacteria | 1427 |
| 237 | Ga0207654_10181127 | 3300025911 | Bacteria | 1375 |
| 238 | Ga0207707_10056212 | 3300025912 | Bacteria | 3424 |
| 239 | Ga0207707_10273042 | 3300025912 | Bacteria | 1465 |
| 240 | Ga0207707_10318070 | 3300025912 | Bacteria | 1344 |
| 241 | Ga0207695_10205081 | 3300025913 | Bacteria | 1884 |
| 242 | Ga0207695_10864705 | 3300025913 | Bacteria | 784 |
| 243 | Ga0207671_10235157 | 3300025914 | Unclassified | 1438 |
| 244 | Ga0207671_10365813 | 3300025914 | Bacteria | 1145 |
| 245 | Ga0207693_10003273 | 3300025915 | Bacteria | 13868 |
| 246 | Ga0207693_10005443 | 3300025915 | Bacteria | 10616 |
| 247 | Ga0207693_10014672 | 3300025915 | Bacteria | 6295 |
| 248 | Ga0207693_10174965 | 3300025915 | Bacteria | 1689 |
| 249 | Ga0207663_10079122 | 3300025916 | Bacteria | 2146 |
| 250 | Ga0207663_10939683 | 3300025916 | Archaea | 692 |
| 251 | Ga0207660_10094398 | 3300025917 | Bacteria | 2223 |
| 252 | Ga0207662_10019411 | 3300025918 | Bacteria | 3868 |
| 253 | Ga0207657_10017549 | 3300025919 | Bacteria | 6858 |
| 254 | Ga0207681_10123224 | 3300025923 | Bacteria | 1904 |
| 255 | Ga0207681_10688715 | 3300025923 | Bacteria | 849 |
| 256 | Ga0207694_10114676 | 3300025924 | Bacteria | 2146 |
| 257 | Ga0207650_10550419 | 3300025925 | Bacteria | 967 |
| 258 | Ga0207659_10299907 | 3300025926 | Bacteria | 1319 |
| 259 | Ga0207659_10351761 | 3300025926 | Unclassified | 1223 |
| 260 | Ga0207659_10406867 | 3300025926 | Bacteria | 1139 |
| 261 | Ga0207659_10523704 | 3300025926 | Bacteria | 1005 |
| 262 | Ga0207700_10302824 | 3300025928 | Bacteria | 1381 |
| 263 | Ga0207700_10437230 | 3300025928 | Bacteria | 1151 |
| 264 | Ga0207664_10023134 | 3300025929 | Bacteria | 4652 |
| 265 | Ga0207706_10262066 | 3300025933 | Bacteria | 1509 |
| 266 | Ga0207709_10062004 | 3300025935 | Bacteria | 2339 |
| 267 | Ga0207669_10076635 | 3300025937 | Bacteria | 2123 |
| 268 | Ga0207669_10443128 | 3300025937 | Bacteria | 1027 |
| 269 | Ga0207665_10240069 | 3300025939 | Bacteria | 1335 |
| 270 | Ga0207665_10357104 | 3300025939 | Bacteria | 1104 |
| 271 | Ga0207665_10437298 | 3300025939 | Bacteria | 1002 |
| 272 | Ga0207691_10036320 | 3300025940 | Bacteria | 4565 |
| 273 | Ga0207689_10026402 | 3300025942 | Bacteria | 4862 |
| 274 | Ga0207689_10119517 | 3300025942 | Bacteria | 2168 |
| 275 | Ga0207661_10652341 | 3300025944 | Bacteria | 967 |
| 276 | Ga0207679_10185108 | 3300025945 | Bacteria | 1726 |
| 277 | Ga0207679_10508951 | 3300025945 | Unclassified | 1075 |
| 278 | Ga0207667_10592228 | 3300025949 | Bacteria | 1119 |
| 279 | Ga0207668_10144447 | 3300025972 | Bacteria | 1834 |
| 280 | Ga0207668_10985533 | 3300025972 | Bacteria | 753 |
| 281 | Ga0207658_11403338 | 3300025986 | Bacteria | 639 |
| 282 | Ga0207677_11013672 | 3300026023 | Bacteria | 753 |
| 283 | Ga0207703_10293550 | 3300026035 | Bacteria | 1480 |
| 284 | Ga0207639_10985650 | 3300026041 | Bacteria | 789 |
| 285 | Ga0207708_10282951 | 3300026075 | Bacteria | 1344 |
| 286 | Ga0207702_10151197 | 3300026078 | Bacteria | 2112 |
| 287 | Ga0207641_10823780 | 3300026088 | Bacteria | 919 |
| 288 | Ga0207641_11350220 | 3300026088 | Bacteria | 714 |
| 289 | Ga0207648_11410204 | 3300026089 | Unclassified | 655 |
| 290 | Ga0207676_10377832 | 3300026095 | Bacteria | 1318 |
| 291 | Ga0207674_10132479 | 3300026116 | Bacteria | 2455 |
| 292 | Ga0207674_10312861 | 3300026116 | Bacteria | 1520 |
| 293 | Ga0207675_100110657 | 3300026118 | Bacteria | 2592 |
| 294 | Ga0207675_100723876 | 3300026118 | Bacteria | 1005 |
| 295 | Ga0207683_10008669 | 3300026121 | Bacteria | 8695 |
| 296 | Ga0209966_1011053 | 3300027695 | Bacteria | 1639 |
| 297 | Ga0209998_10011603 | 3300027717 | Unclassified | 1825 |
| 298 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 299 | Ga0207428_10005674 | 3300027907 | Bacteria | 11593 |
| 300 | Ga0207428_10363745 | 3300027907 | Bacteria | 1063 |
| 301 | Ga0268265_10253148 | 3300028380 | Bacteria | 1561 |
| 302 | Ga0265337_1001192 | 3300028556 | Bacteria | 13219 |
| 303 | Ga0307517_10449559 | 3300028786 | Bacteria | 668 |
| 304 | Ga0265338_10315196 | 3300028800 | Bacteria | 1134 |
| 305 | Ga0265762_1110991 | 3300030760 | Bacteria | 618 |
| 306 | Ga0265760_10245209 | 3300031090 | Bacteria | 619 |
| 307 | Ga0265330_10043603 | 3300031235 | Bacteria | 1984 |
| 308 | Ga0265330_10044424 | 3300031235 | Bacteria | 1962 |
| 309 | Ga0265328_10100542 | 3300031239 | Bacteria | 1071 |
| 310 | Ga0265325_10336510 | 3300031241 | Bacteria | 668 |
| 311 | Ga0265325_10414322 | 3300031241 | Bacteria | 589 |
| 312 | Ga0265329_10054423 | 3300031242 | Bacteria | 1271 |
| 313 | Ga0265340_10021741 | 3300031247 | Bacteria | 3288 |
| 314 | Ga0265340_10360897 | 3300031247 | Bacteria | 642 |
| 315 | Ga0265339_10085982 | 3300031249 | Bacteria | 1655 |
| 316 | Ga0265316_10062118 | 3300031344 | Bacteria | 2899 |
| 317 | Ga0265316_10204847 | 3300031344 | Bacteria | 1461 |
| 318 | Ga0307513_10157895 | 3300031456 | Bacteria | 2165 |
| 319 | Ga0307513_10326947 | 3300031456 | Bacteria | 1289 |
| 320 | Ga0265313_10091912 | 3300031595 | Bacteria | 1361 |
| 321 | Ga0265313_10333797 | 3300031595 | Bacteria | 603 |
| 322 | Ga0265314_10098095 | 3300031711 | Bacteria | 1891 |
| 323 | Ga0265342_10132046 | 3300031712 | Bacteria | 1398 |
| 324 | Ga0307416_101871711 | 3300032002 | Bacteria | 703 |
| 325 | Ga0307416_102155928 | 3300032002 | Bacteria | 659 |
| 326 | Ga0373926_0027700 | 3300035083 | Unclassified | 1987 |
| 327 | Ga0373923_0207429 | 3300035111 | Unclassified | 907 |
| 328 | Ga0373936_0295959 | 3300035113 | Bacteria | 730 |
| 329 | Ga0373945_0002014 | 3300035116 | Bacteria | 6311 |
| 330 | Ga0373945_0002085 | 3300035116 | Bacteria | 6225 |
| 331 | Ga0373953_0054225 | 3300035117 | Bacteria | 1626 |
| 332 | Ga0373956_0015218 | 3300035119 | Bacteria | 3219 |
| 333 | Ga0373956_0041589 | 3300035119 | Bacteria | 2041 |
| 334 | Ga0373957_0033295 | 3300035120 | Bacteria | 1903 |
| 335 | Ga0373957_0112329 | 3300035120 | Bacteria | 1098 |
| 336 | Ga0373943_0013910 | 3300035170 | Bacteria | 3638 |
| 337 | Ga0373943_0024601 | 3300035170 | Bacteria | 2809 |
| 338 | Ga0373943_0078918 | 3300035170 | Bacteria | 1684 |
| 339 | Ga0373946_0001923 | 3300035171 | Bacteria | 7251 |
| 340 | Ga0373946_0031860 | 3300035171 | Unclassified | 2114 |
| 341 | Ga0373946_0037161 | 3300035171 | Bacteria | 1978 |
| 342 | Ga0373955_0095658 | 3300035172 | Bacteria | 1699 |
| 343 | Ga0373961_0003036 | 3300035241 | Bacteria | 4229 |
| 344 | Ga0373962_0196113 | 3300035242 | Bacteria | 681 |
| 345 | Ga0373924_0184637 | 3300035410 | Bacteria | 918 |
| 346 | Ga0373924_0242140 | 3300035410 | Bacteria | 798 |
| 347 | Ga0373924_0324726 | 3300035410 | Bacteria | 685 |
| 348 | Ga0373931_0027626 | 3300035691 | Bacteria | 2898 |
| 349 | Ga0373931_0133597 | 3300035691 | Bacteria | 1431 |
| 350 | Ga0373931_1233336 | 3300035691 | Bacteria | 513 |
| 351 | Ga0373935_0042243 | 3300035692 | Bacteria | 2866 |
| 352 | Ga0373935_0056027 | 3300035692 | Unclassified | 2512 |
| 353 | Ga0373935_0101292 | 3300035692 | Bacteria | 1899 |
| 354 | Ga0373935_0350398 | 3300035692 | Bacteria | 1052 |
| 355 | Ga0373927_0001051 | 3300035695 | Bacteria | 21045 |
| 356 | Ga0373927_0062052 | 3300035695 | Bacteria | 2417 |
| 357 | Ga0373927_0107975 | 3300035695 | Bacteria | 1813 |
| 358 | Ga0373927_0341711 | 3300035695 | Bacteria | 986 |
| 359 | Ga0373933_0025433 | 3300035724 | Bacteria | 3395 |
| 360 | Ga0373933_0100245 | 3300035724 | Bacteria | 1796 |
| 361 | Ga0373933_0144981 | 3300035724 | Bacteria | 1501 |
| 362 | Ga0373947_0014697 | 3300035725 | Bacteria | 4490 |
| 363 | Ga0373947_0061602 | 3300035725 | Bacteria | 2281 |
| 364 | Ga0373947_0169495 | 3300035725 | Bacteria | 1416 |
| 365 | Ga0373937_0003621 | 3300036401 | Bacteria | 13032 |
| 366 | Ga0373937_0250362 | 3300036401 | Bacteria | 1670 |
| 367 | Ga0373937_0485462 | 3300036401 | Bacteria | 1174 |
| 368 | Ga0373925_0001925 | 3300037068 | Bacteria | 17184 |
| 369 | Ga0373925_0277865 | 3300037068 | Bacteria | 1348 |
| 370 | Ga0436364_0172837 | 3300037853 | Bacteria | 944 |
| 371 | Ga0436364_0768079 | 3300037853 | Bacteria | 31728 |
| 372 | Ga0436365_0015204 | 3300039437 | Bacteria | 1784 |
| 373 | Ga0436365_0330093 | 3300039437 | Bacteria | 5700 |
| 374 | Ga0436365_0956437 | 3300039437 | Bacteria | 1500 |
| 375 | Ga0436365_1020485 | 3300039437 | Bacteria | 1119 |
| 376 | Ga0436365_1274046 | 3300039437 | Bacteria | 2308 |
| 377 | Ga0436360_0975963 | 3300039438 | Bacteria | 1281 |
| 378 | Ga0436360_1342663 | 3300039438 | Bacteria | 1462 |
| 379 | Ga0436363_1229486 | 3300039450 | Bacteria | 1508 |
| 380 | Ga0436363_1459938 | 3300039450 | Bacteria | 1627 |
| 381 | Ga0436362_0612627 | 3300039453 | Bacteria | 880 |
| 382 | Ga0439453_0000869 | 3300041408 | Bacteria | 3605 |
| 383 | Ga0439453_0001995 | 3300041408 | Bacteria | 2744 |
| 384 | Ga0451837_1680603 | 3300041494 | Unclassified | 626 |
| 385 | Ga0439441_007857 | 3300042001 | Bacteria | 1731 |
| 386 | Ga0439443_004727 | 3300042003 | Bacteria | 1791 |
| 387 | Ga0439446_0323384 | 3300042156 | Bacteria | 545 |
| 388 | Ga0439434_0029200 | 3300042435 | Bacteria | 1672 |
| 389 | Ga0439435_0004045 | 3300042436 | Bacteria | 3121 |
| 390 | Ga0439460_0012318 | 3300042461 | Bacteria | 2217 |
| 391 | Ga0439440_0149830 | 3300042993 | Bacteria | 667 |
| 392 | Ga0495592_0011867 | 3300046454 | Bacteria | 6602 |
| 393 | Ga0495592_0180366 | 3300046454 | Bacteria | 1439 |
| 394 | Ga0495603_0266359 | 3300046455 | Bacteria | 986 |
| 395 | Ga0495603_0530640 | 3300046455 | Bacteria | 674 |
| 396 | Ga0495629_0000409 | 3300046459 | Bacteria | 35959 |
| 397 | Ga0495629_0082303 | 3300046459 | Bacteria | 2247 |
| 398 | Ga0495629_0227625 | 3300046459 | Bacteria | 1285 |
| 399 | Ga0495638_0025735 | 3300046460 | Bacteria | 3820 |
| 400 | Ga0495651_0001051 | 3300046462 | Bacteria | 21350 |
| 401 | Ga0495653_0006259 | 3300046463 | Bacteria | 9767 |
| 402 | Ga0495653_0018050 | 3300046463 | Bacteria | 5737 |
| 403 | Ga0495653_0051356 | 3300046463 | Bacteria | 3166 |
| 404 | Ga0495580_0008552 | 3300046472 | Bacteria | 8125 |
| 405 | Ga0495582_0003989 | 3300046473 | Bacteria | 8293 |
| 406 | Ga0495582_0088007 | 3300046473 | Bacteria | 1730 |
| 407 | Ga0495605_0135393 | 3300046474 | Bacteria | 1108 |
| 408 | Ga0495639_0042949 | 3300046475 | Bacteria | 2040 |
| 409 | Ga0495639_0136735 | 3300046475 | Bacteria | 1176 |
| 410 | Ga0495639_0320789 | 3300046475 | Bacteria | 775 |
| 411 | Ga0495662_0016819 | 3300046476 | Bacteria | 3539 |
| 412 | Ga0495662_0056662 | 3300046476 | Bacteria | 1893 |
| 413 | Ga0495662_0130487 | 3300046476 | Bacteria | 1235 |
| 414 | Ga0495662_0169498 | 3300046476 | Bacteria | 1076 |
| 415 | Ga0495664_0005906 | 3300046477 | Bacteria | 6737 |
| 416 | Ga0495664_0030144 | 3300046477 | Bacteria | 3177 |
| 417 | Ga0495664_0072871 | 3300046477 | Bacteria | 2053 |
| 418 | Ga0495585_0003749 | 3300046492 | Bacteria | 10143 |
| 419 | Ga0495594_0015128 | 3300046499 | Bacteria | 4050 |
| 420 | Ga0495594_0396163 | 3300046499 | Bacteria | 786 |
| 421 | Ga0495607_0175372 | 3300046501 | Bacteria | 1079 |
| 422 | Ga0495608_0006648 | 3300046511 | Bacteria | 8205 |
| 423 | Ga0495618_0002201 | 3300046514 | Bacteria | 12750 |
| 424 | Ga0495618_0059037 | 3300046514 | Bacteria | 2430 |
| 425 | Ga0495618_0060883 | 3300046514 | Bacteria | 2394 |
| 426 | Ga0495628_0042060 | 3300046516 | Bacteria | 3646 |
| 427 | Ga0495628_0042157 | 3300046516 | Bacteria | 3641 |
| 428 | Ga0495628_0167358 | 3300046516 | Unclassified | 1668 |
| 429 | Ga0495630_0011056 | 3300046517 | Bacteria | 6530 |
| 430 | Ga0495630_0236109 | 3300046517 | Bacteria | 1397 |
| 431 | Ga0495630_0274270 | 3300046517 | Unclassified | 1288 |
| 432 | Ga0495630_1465810 | 3300046517 | Bacteria | 512 |
| 433 | Ga0495631_0266390 | 3300046518 | Unclassified | 730 |
| 434 | Ga0495644_0002002 | 3300046523 | Bacteria | 8189 |
| 435 | Ga0495666_0012241 | 3300046526 | Bacteria | 4278 |
| 436 | Ga0495666_0231010 | 3300046526 | Bacteria | 846 |
| 437 | Ga0495652_0049908 | 3300046529 | Bacteria | 3580 |
| 438 | Ga0495652_0126228 | 3300046529 | Bacteria | 2032 |
| 439 | Ga0495665_0066837 | 3300046531 | Bacteria | 1896 |
| 440 | Ga0495665_0079457 | 3300046531 | Bacteria | 1726 |
| 441 | Ga0495640_0007732 | 3300046533 | Bacteria | 8454 |
| 442 | Ga0495640_0017299 | 3300046533 | Bacteria | 5375 |
| 443 | Ga0495640_0088894 | 3300046533 | Bacteria | 2041 |
| 444 | Ga0495640_0426770 | 3300046533 | Bacteria | 812 |
| 445 | Ga0495640_0512432 | 3300046533 | Bacteria | 729 |
| 446 | Ga0495586_0115034 | 3300046535 | Bacteria | 1499 |
| 447 | Ga0495587_0005039 | 3300046536 | Bacteria | 8644 |
| 448 | Ga0495587_0025016 | 3300046536 | Bacteria | 3652 |
| 449 | Ga0495598_0029634 | 3300046537 | Bacteria | 1527 |
| 450 | Ga0495621_0031214 | 3300046539 | Bacteria | 1826 |
| 451 | Ga0495645_0054915 | 3300046543 | Bacteria | 2893 |
| 452 | Ga0495645_0083127 | 3300046543 | Bacteria | 2295 |
| 453 | Ga0495622_0005809 | 3300046557 | Bacteria | 5725 |
| 454 | Ga0495633_0062710 | 3300046558 | Bacteria | 1740 |
| 455 | Ga0495667_0007034 | 3300046559 | Bacteria | 7635 |
| 456 | Ga0495667_0025648 | 3300046559 | Bacteria | 3971 |
| 457 | Ga0495656_0004111 | 3300046615 | Bacteria | 4959 |
| 458 | Ga0495656_0472632 | 3300046615 | Bacteria | 662 |
| 459 | Ga0495634_0023235 | 3300046642 | Bacteria | 4360 |
| 460 | Ga0495634_0023747 | 3300046642 | Bacteria | 4308 |
| 461 | Ga0495634_0066626 | 3300046642 | Bacteria | 2383 |
| 462 | Ga0495635_0000123 | 3300046663 | Bacteria | 47100 |
| 463 | Ga0495635_0016669 | 3300046663 | Bacteria | 5132 |
| 464 | Ga0495635_0028200 | 3300046663 | Bacteria | 3902 |
| 465 | Ga0495635_0403273 | 3300046663 | Bacteria | 908 |
| 466 | Ga0495659_0005964 | 3300046664 | Bacteria | 3853 |
| 467 | Ga0495661_0450825 | 3300046665 | Unclassified | 619 |
| 468 | Ga0495657_0053038 | 3300046675 | Bacteria | 2715 |
| 469 | Ga0495657_0578651 | 3300046675 | Unclassified | 651 |
| 470 | Ga0495623_0027923 | 3300046679 | Bacteria | 3632 |
| 471 | Ga0495646_0394989 | 3300046680 | Bacteria | 719 |
| 472 | Ga0495646_0458610 | 3300046680 | Bacteria | 657 |
| 473 | Ga0495658_0028746 | 3300046683 | Bacteria | 3003 |
| 474 | Ga0495658_0070520 | 3300046683 | Bacteria | 2028 |
| 475 | Ga0495613_0011532 | 3300046689 | Bacteria | 6572 |
| 476 | Ga0495613_0075584 | 3300046689 | Bacteria | 2452 |
| 477 | Ga0495613_0581777 | 3300046689 | Bacteria | 746 |
| 478 | Ga0495624_0007113 | 3300046690 | Bacteria | 7874 |
| 479 | Ga0495624_0032056 | 3300046690 | Bacteria | 3410 |
| 480 | Ga0495624_0032178 | 3300046690 | Bacteria | 3402 |
| 481 | Ga0495670_0109158 | 3300046691 | Bacteria | 1430 |
| 482 | Ga0495589_0140097 | 3300046794 | Bacteria | 1159 |
| 483 | Ga0495600_0003659 | 3300046809 | Bacteria | 9072 |
| 484 | Ga0495600_0017154 | 3300046809 | Bacteria | 4603 |
| 485 | Ga0495581_0092475 | 3300047315 | Bacteria | 1756 |
| 486 | Ga0495581_0127145 | 3300047315 | Bacteria | 1484 |
| 487 | Ga0495581_0533863 | 3300047315 | Unclassified | 681 |
| 488 | Ga0495604_0001090 | 3300047317 | Bacteria | 22540 |
| 489 | Ga0495674_0003125 | 3300047319 | Bacteria | 16088 |
| 490 | Ga0495674_0003227 | 3300047319 | Bacteria | 15826 |
| 491 | Ga0495674_0051128 | 3300047319 | Bacteria | 3643 |
| 492 | Ga0495674_0674258 | 3300047319 | Bacteria | 813 |
| 493 | Ga0495672_0068914 | 3300047320 | Bacteria | 2009 |
| 494 | Ga0495672_0083535 | 3300047320 | Bacteria | 1773 |
| 495 | Ga0495672_0390470 | 3300047320 | Bacteria | 638 |
| 496 | Ga0495676_0048612 | 3300047321 | Bacteria | 3418 |
| 497 | Ga0495676_0169834 | 3300047321 | Bacteria | 1536 |
| 498 | Ga0495680_0000795 | 3300047322 | Bacteria | 35314 |
| 499 | Ga0495680_0034293 | 3300047322 | Bacteria | 4100 |
| 500 | Ga0495675_0012693 | 3300047444 | Bacteria | 5302 |
| 501 | Ga0495685_110080 | 3300047447 | Bacteria | 907 |
| 502 | Ga0495684_0000749 | 3300047471 | Bacteria | 26152 |
| 503 | Ga0495684_0005001 | 3300047471 | Bacteria | 10343 |
| 504 | Ga0495684_0045684 | 3300047471 | Bacteria | 3351 |
| 505 | Ga0495684_0241459 | 3300047471 | Unclassified | 1317 |
| 506 | Ga0495684_0386998 | 3300047471 | Bacteria | 985 |
| 507 | Ga0495593_0015854 | 3300047673 | Bacteria | 4258 |
| 508 | Ga0495593_0030374 | 3300047673 | Bacteria | 2957 |
| 509 | Ga0495593_0032696 | 3300047673 | Bacteria | 2834 |
| 510 | Ga0495602_0010500 | 3300048088 | Bacteria | 9612 |
| 511 | Ga0495614_0062147 | 3300048089 | Unclassified | 1605 |
| 512 | Ga0495615_0145978 | 3300048090 | Bacteria | 701 |
| 513 | Ga0496102_0917145 | 3300048905 | Bacteria | 797 |
| 514 | Ga0496102_1043177 | 3300048905 | Bacteria | 738 |
| 515 | Ga0496104_0024135 | 3300048907 | Bacteria | 5595 |
| 516 | Ga0496104_0053401 | 3300048907 | Bacteria | 3817 |
| 517 | Ga0496105_0101024 | 3300048908 | Bacteria | 2382 |
| 518 | Ga0496105_0491339 | 3300048908 | Unclassified | 964 |
| 519 | Ga0496108_0224829 | 3300048911 | Bacteria | 1631 |
| 520 | Ga0496109_0050071 | 3300048912 | Bacteria | 3804 |
| 521 | Ga0496109_0359865 | 3300048912 | Bacteria | 1375 |
| 522 | Ga0496109_0988760 | 3300048912 | Bacteria | 779 |
| 523 | Ga0496110_0877540 | 3300048913 | Bacteria | 803 |
| 524 | Ga0496110_0895654 | 3300048913 | Bacteria | 793 |
| 525 | Ga0496110_1014122 | 3300048913 | Bacteria | 737 |
| 526 | Ga0496112_0033592 | 3300048915 | Bacteria | 4988 |
| 527 | Ga0496112_0291937 | 3300048915 | Unclassified | 1576 |
| 528 | Ga0496112_0487143 | 3300048915 | Bacteria | 1169 |
| 529 | Ga0496113_0583455 | 3300048916 | Bacteria | 895 |
| 530 | Ga0496114_0546219 | 3300048917 | Bacteria | 1024 |
| 531 | Ga0496115_0101256 | 3300048918 | Bacteria | 2362 |
| 532 | Ga0496115_0215529 | 3300048918 | Bacteria | 1585 |
| 533 | Ga0496121_0851621 | 3300048924 | Bacteria | 530 |
| 534 | Ga0501031_0031022 | 3300049568 | Bacteria | 3487 |
| 535 | Ga0501032_0059539 | 3300049569 | Bacteria | 2563 |
| 536 | Ga0501032_0062470 | 3300049569 | Bacteria | 2495 |
| 537 | Ga0501033_0040248 | 3300049570 | Bacteria | 3489 |
| 538 | Ga0501033_0070880 | 3300049570 | Bacteria | 2560 |
| 539 | Ga0501033_0570069 | 3300049570 | Bacteria | 779 |
| 540 | Ga0501034_0013154 | 3300049571 | Bacteria | 8526 |
| 541 | Ga0501034_0096083 | 3300049571 | Bacteria | 2959 |
| 542 | Ga0501034_0146830 | 3300049571 | Bacteria | 2335 |
| 543 | Ga0501034_0294414 | 3300049571 | Bacteria | 1560 |
| 544 | Ga0501036_0044592 | 3300049572 | Bacteria | 3756 |
| 545 | Ga0501036_0113731 | 3300049572 | Bacteria | 2287 |
| 546 | Ga0501036_0114984 | 3300049572 | Bacteria | 2273 |
| 547 | Ga0501036_0147305 | 3300049572 | Bacteria | 1986 |
| 548 | Ga0501037_0042004 | 3300049573 | Bacteria | 3361 |
| 549 | Ga0501037_0060221 | 3300049573 | Bacteria | 2769 |
| 550 | Ga0501038_0011644 | 3300049574 | Bacteria | 8022 |
| 551 | Ga0501038_0069318 | 3300049574 | Bacteria | 2996 |
| 552 | Ga0501038_0604407 | 3300049574 | Bacteria | 829 |
| 553 | Ga0501039_0041347 | 3300049575 | Bacteria | 3560 |
| 554 | Ga0501039_0073039 | 3300049575 | Bacteria | 2666 |
| 555 | Ga0501039_0159357 | 3300049575 | Bacteria | 1773 |
| 556 | Ga0501041_0105902 | 3300049577 | Bacteria | 1743 |
| 557 | Ga0501042_0210813 | 3300049578 | Bacteria | 1401 |
| 558 | Ga0501043_0071642 | 3300049579 | Bacteria | 2721 |
| 559 | Ga0501043_0566252 | 3300049579 | Bacteria | 842 |
| 560 | Ga0501046_0007517 | 3300049580 | Bacteria | 9559 |
| 561 | Ga0501047_0017331 | 3300049581 | Bacteria | 6897 |
| 562 | Ga0501047_0034032 | 3300049581 | Bacteria | 4919 |
| 563 | Ga0501047_0309758 | 3300049581 | Bacteria | 1420 |
| 564 | Ga0501048_0069544 | 3300049582 | Bacteria | 2486 |
| 565 | Ga0501048_0954238 | 3300049582 | Bacteria | 617 |
| 566 | Ga0501068_0148428 | 3300049584 | Bacteria | 1472 |
| 567 | Ga0501069_0004867 | 3300049585 | Bacteria | 6952 |
| 568 | Ga0501069_0339881 | 3300049585 | Bacteria | 884 |
| 569 | Ga0501070_0081637 | 3300049586 | Bacteria | 2675 |
| 570 | Ga0501070_0180298 | 3300049586 | Bacteria | 1738 |
| 571 | Ga0501070_0262070 | 3300049586 | Bacteria | 1413 |
| 572 | Ga0501070_1013826 | 3300049586 | Bacteria | 643 |
| 573 | Ga0501071_0087604 | 3300049587 | Bacteria | 2284 |
| 574 | Ga0501071_0273103 | 3300049587 | Bacteria | 1278 |
| 575 | Ga0501071_0385727 | 3300049587 | Bacteria | 1069 |
| 576 | Ga0501071_0774074 | 3300049587 | Bacteria | 740 |
| 577 | Ga0501072_0036661 | 3300049588 | Bacteria | 3845 |
| 578 | Ga0501073_0005794 | 3300049589 | Bacteria | 9230 |
| 579 | Ga0501073_0848373 | 3300049589 | Bacteria | 629 |
| 580 | Ga0501074_0009242 | 3300049590 | Bacteria | 7162 |
| 581 | Ga0501074_0236391 | 3300049590 | Bacteria | 1300 |
| 582 | Ga0501075_1313344 | 3300049591 | Bacteria | 548 |
| 583 | Ga0501076_0076895 | 3300049592 | Bacteria | 2677 |
| 584 | Ga0501076_0100058 | 3300049592 | Bacteria | 2336 |
| 585 | Ga0501077_0176909 | 3300049593 | Bacteria | 1356 |
| 586 | Ga0501077_0685708 | 3300049593 | Bacteria | 658 |
| 587 | Ga0501079_0011312 | 3300049741 | Bacteria | 6808 |
| 588 | Ga0501079_0421103 | 3300049741 | Bacteria | 1048 |
| 589 | Ga0501080_0006188 | 3300049742 | Bacteria | 10739 |
| 590 | Ga0501081_0053659 | 3300049743 | Bacteria | 2783 |
| 591 | Ga0501081_0904448 | 3300049743 | Bacteria | 666 |
| 592 | Ga0501035_0016634 | 3300049822 | Bacteria | 6782 |
| 593 | Ga0501044_0057344 | 3300049823 | Bacteria | 3997 |
| 594 | Ga0501044_0059044 | 3300049823 | Bacteria | 3931 |
| 595 | Ga0501044_0164521 | 3300049823 | Bacteria | 2193 |
| 596 | Ga0501044_0355563 | 3300049823 | Bacteria | 1383 |
| 597 | Ga0501044_0606519 | 3300049823 | Bacteria | 987 |
| 598 | Ga0501045_0018386 | 3300049824 | Bacteria | 4972 |
| 599 | Ga0501045_0463722 | 3300049824 | Bacteria | 941 |
| 600 | nmdc:mga03683_380645_c1 | 3300050489 | Bacteria | 672 |
| 601 | nmdc:mga03683_508270_c1 | 3300050489 | Bacteria | 584 |
| 602 | nmdc:mga03n38_139062_c1 | 3300050490 | Bacteria | 1211 |
| 603 | nmdc:mga0yw44_137591_c1 | 3300050492 | Bacteria | 1585 |
| 604 | nmdc:mga05p37_13288_c1 | 3300050507 | Bacteria | 9859 |
| 605 | nmdc:mga05p37_1461_c1 | 3300050507 | Bacteria | 27452 |
| 606 | nmdc:mga05p37_168622_c1 | 3300050507 | Bacteria | 2671 |
| 607 | nmdc:mga05p37_2463_c1 | 3300050507 | Bacteria | 21532 |
| 608 | nmdc:mga05p37_941134_c1 | 3300050507 | Bacteria | 926 |
| 609 | nmdc:mga09592_50692_c1 | 3300050508 | Bacteria | 3501 |
| 610 | nmdc:mga09592_7282_c1 | 3300050508 | Bacteria | 8990 |
| 611 | nmdc:mga09592_8553_c1 | 3300050508 | Bacteria | 8325 |
| 612 | nmdc:mga0qj67_16649_c1 | 3300050509 | Bacteria | 5579 |
| 613 | nmdc:mga0qj67_170_c1 | 3300050509 | Bacteria | 43684 |
| 614 | nmdc:mga0qj67_9055_c1 | 3300050509 | Bacteria | 7389 |
| 615 | nmdc:mga06r32_2531_c1 | 3300050510 | Bacteria | 16356 |
| 616 | nmdc:mga06r32_724_c1 | 3300050510 | Bacteria | 28932 |
| 617 | nmdc:mga08y16_2434_c1 | 3300050511 | Bacteria | 19121 |
| 618 | nmdc:mga08y16_709843_c1 | 3300050511 | Bacteria | 1005 |
| 619 | nmdc:mga0n895_59194_c1 | 3300050512 | Bacteria | 3780 |
| 620 | nmdc:mga0n895_608225_c1 | 3300050512 | Bacteria | 1095 |
| 621 | nmdc:mga0rr50_10240_c1 | 3300050513 | Bacteria | 5939 |
| 622 | nmdc:mga0rr50_1332_c1 | 3300050513 | Bacteria | 13470 |
| 623 | nmdc:mga0rr50_221725_c1 | 3300050513 | Bacteria | 1562 |
| 624 | nmdc:mga08x19_134106_c1 | 3300050514 | Bacteria | 1668 |
| 625 | nmdc:mga08x19_633803_c1 | 3300050514 | Bacteria | 758 |
| 626 | nmdc:mga0a205_2168_c1 | 3300050515 | Bacteria | 17263 |
| 627 | nmdc:mga0a205_30759_c1 | 3300050515 | Bacteria | 5142 |
| 628 | nmdc:mga0a205_71456_c1 | 3300050515 | Bacteria | 3351 |
| 629 | Ga0495601_0000788 | 3300053077 | Bacteria | 17125 |
| 630 | Ga0495601_0000993 | 3300053077 | Bacteria | 15524 |
| 631 | Ga0495601_0063962 | 3300053077 | Bacteria | 2338 |
| 632 | Ga0495612_0002372 | 3300053078 | Bacteria | 7760 |
| 633 | Ga0495612_0004290 | 3300053078 | Bacteria | 5918 |
| 634 | Ga0495612_0257587 | 3300053078 | Bacteria | 777 |
| 635 | Ga0495595_0001232 | 3300053084 | Bacteria | 9952 |
| 636 | Ga0495595_0002216 | 3300053084 | Bacteria | 7554 |
| 637 | Ga0495595_0064703 | 3300053084 | Bacteria | 1719 |
| 638 | Ga0495619_0013867 | 3300053085 | Bacteria | 5085 |
| 639 | Ga0495619_0017925 | 3300053085 | Bacteria | 4488 |
| 640 | Ga0495619_0091584 | 3300053085 | Bacteria | 2058 |
| 641 | Ga0495619_0106586 | 3300053085 | Bacteria | 1911 |
| 642 | Ga0495619_0266395 | 3300053085 | Bacteria | 1187 |
| 643 | Ga0500566_0115858 | 3300053094 | Bacteria | 1451 |
| 644 | Ga0500641_0134010 | 3300053096 | Bacteria | 1069 |
| 645 | Ga0500641_0205451 | 3300053096 | Bacteria | 839 |
| 646 | Ga0500556_0081920 | 3300053104 | Bacteria | 1221 |
| 647 | Ga0500652_024985 | 3300053131 | Bacteria | 2285 |
| 648 | Ga0500658_0090420 | 3300053134 | Bacteria | 1323 |
| 649 | Ga0500588_0084819 | 3300053146 | Bacteria | 1067 |
| 650 | Ga0500616_0009163 | 3300053153 | Bacteria | 6044 |
| 651 | Ga0500616_0062803 | 3300053153 | Bacteria | 1917 |
| 652 | Ga0500620_204835 | 3300053155 | Bacteria | 672 |
| 653 | Ga0500627_0106149 | 3300053158 | Bacteria | 1263 |
| 654 | Ga0500657_218971 | 3300053728 | Unclassified | 607 |
| 655 | Ga0501084_0266209 | 3300054114 | Bacteria | 1447 |
| 656 | Ga0501082_0017828 | 3300060353 | Bacteria | 6116 |
| 657 | Ga0501082_0049411 | 3300060353 | Bacteria | 3627 |
| 658 | Ga0530510_0183692 | 3300061734 | Bacteria | 1551 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021377 | Ga0213874_10061480 | Ga0213874_100614801 | 134 |
| 2 | 3300039450 | Ga0436363_1459938 | Ga0436363_1459938_546_953 | 134 |
| 3 | 3300005331 | Ga0070670_100206397 | Ga0070670_1002063972 | 140 |
| 4 | 3300005343 | Ga0070687_100171875 | Ga0070687_1001718752 | 140 |
| 5 | 3300005544 | Ga0070686_100045805 | Ga0070686_1000458052 | 140 |
| 6 | 3300005564 | Ga0070664_100088118 | Ga0070664_1000881182 | 140 |
| 7 | 3300005577 | Ga0068857_100113880 | Ga0068857_1001138802 | 140 |
| 8 | 3300005842 | Ga0068858_100154141 | Ga0068858_1001541412 | 140 |
| 9 | 3300025912 | Ga0207707_10056212 | Ga0207707_100562122 | 140 |
| 10 | 3300025914 | Ga0207671_10235157 | Ga0207671_102351572 | 140 |
| 11 | 3300025925 | Ga0207650_10550419 | Ga0207650_105504192 | 140 |
| 12 | 3300025926 | Ga0207659_10523704 | Ga0207659_105237042 | 140 |
| 13 | 3300025945 | Ga0207679_10185108 | Ga0207679_101851082 | 140 |
| 14 | 3300026116 | Ga0207674_10132479 | Ga0207674_101324792 | 140 |
| 15 | 3300027695 | Ga0209966_1011053 | Ga0209966_10110532 | 140 |
| 16 | 3300027717 | Ga0209998_10011603 | Ga0209998_100116032 | 140 |
| 17 | 3300005577 | Ga0068857_102328770 | Ga0068857_1023287701 | 143 |
| 18 | 3300047320 | Ga0495672_0390470 | Ga0495672_0390470_36_482 | 143 |
| 19 | 3300049571 | Ga0501034_0096083 | Ga0501034_0096083_270_758 | 143 |
| 20 | 3300049574 | Ga0501038_0604407 | Ga0501038_0604407_73_561 | 143 |
| 21 | 3300049589 | Ga0501073_0848373 | Ga0501073_0848373_17_505 | 143 |
| 22 | 3300050509 | nmdc:mga0qj67_170_c1 | nmdc:mga0qj67_170_c1_21180_21650 | 143 |
| 23 | 3300005364 | Ga0070673_102052632 | Ga0070673_1020526321 | 144 |
| 24 | 3300005435 | Ga0070714_101927255 | Ga0070714_1019272551 | 144 |
| 25 | 3300005437 | Ga0070710_10225189 | Ga0070710_102251892 | 144 |
| 26 | 3300005439 | Ga0070711_100301869 | Ga0070711_1003018692 | 144 |
| 27 | 3300005458 | Ga0070681_10490479 | Ga0070681_104904791 | 144 |
| 28 | 3300005539 | Ga0068853_100333224 | Ga0068853_1003332243 | 144 |
| 29 | 3300005547 | Ga0070693_100275548 | Ga0070693_1002755481 | 144 |
| 30 | 3300005563 | Ga0068855_100588219 | Ga0068855_1005882193 | 144 |
| 31 | 3300005577 | Ga0068857_100345172 | Ga0068857_1003451723 | 144 |
| 32 | 3300005578 | Ga0068854_101246359 | Ga0068854_1012463591 | 144 |
| 33 | 3300005614 | Ga0068856_100304550 | Ga0068856_1003045502 | 144 |
| 34 | 3300005719 | Ga0068861_100587785 | Ga0068861_1005877852 | 144 |
| 35 | 3300006175 | Ga0070712_100258150 | Ga0070712_1002581502 | 144 |
| 36 | 3300006871 | Ga0075434_100359268 | Ga0075434_1003592682 | 144 |
| 37 | 3300006871 | Ga0075434_100759146 | Ga0075434_1007591462 | 144 |
| 38 | 3300007076 | Ga0075435_100141657 | Ga0075435_1001416572 | 144 |
| 39 | 3300007076 | Ga0075435_100527289 | Ga0075435_1005272892 | 144 |
| 40 | 3300009093 | Ga0105240_10678991 | Ga0105240_106789913 | 144 |
| 41 | 3300009174 | Ga0105241_10494820 | Ga0105241_104948202 | 144 |
| 42 | 3300009545 | Ga0105237_11146229 | Ga0105237_111462291 | 144 |
| 43 | 3300009551 | Ga0105238_10331509 | Ga0105238_103315092 | 144 |
| 44 | 3300013100 | Ga0157373_10555732 | Ga0157373_105557322 | 144 |
| 45 | 3300013102 | Ga0157371_10699397 | Ga0157371_106993971 | 144 |
| 46 | 3300013104 | Ga0157370_10310949 | Ga0157370_103109492 | 144 |
| 47 | 3300013105 | Ga0157369_11079552 | Ga0157369_110795521 | 144 |
| 48 | 3300013307 | Ga0157372_11079471 | Ga0157372_110794711 | 144 |
| 49 | 3300014326 | Ga0157380_10780205 | Ga0157380_107802052 | 144 |
| 50 | 3300020070 | Ga0206356_11108289 | Ga0206356_111082891 | 144 |
| 51 | 3300025912 | Ga0207707_10273042 | Ga0207707_102730422 | 144 |
| 52 | 3300025913 | Ga0207695_10864705 | Ga0207695_108647052 | 144 |
| 53 | 3300025915 | Ga0207693_10005443 | Ga0207693_100054433 | 144 |
| 54 | 3300025949 | Ga0207667_10592228 | Ga0207667_105922282 | 144 |
| 55 | 3300026041 | Ga0207639_10985650 | Ga0207639_109856502 | 144 |
| 56 | 3300026116 | Ga0207674_10312861 | Ga0207674_103128613 | 144 |
| 57 | 3300049572 | Ga0501036_0147305 | Ga0501036_0147305_1153_1605 | 144 |
| 58 | 3300049575 | Ga0501039_0073039 | Ga0501039_0073039_540_992 | 144 |
| 59 | 3300049577 | Ga0501041_0105902 | Ga0501041_0105902_616_1068 | 144 |
| 60 | 3300049578 | Ga0501042_0210813 | Ga0501042_0210813_431_883 | 144 |
| 61 | 3300049585 | Ga0501069_0339881 | Ga0501069_0339881_114_566 | 144 |
| 62 | 3300049586 | Ga0501070_0262070 | Ga0501070_0262070_774_1226 | 144 |
| 63 | 3300049587 | Ga0501071_0273103 | Ga0501071_0273103_593_1045 | 144 |
| 64 | 3300049588 | Ga0501072_0036661 | Ga0501072_0036661_454_906 | 144 |
| 65 | 3300049590 | Ga0501074_0236391 | Ga0501074_0236391_145_597 | 144 |
| 66 | 3300049592 | Ga0501076_0076895 | Ga0501076_0076895_1241_1693 | 144 |
| 67 | 3300049593 | Ga0501077_0176909 | Ga0501077_0176909_529_981 | 144 |
| 68 | 3300049741 | Ga0501079_0421103 | Ga0501079_0421103_22_474 | 144 |
| 69 | 3300049743 | Ga0501081_0053659 | Ga0501081_0053659_370_822 | 144 |
| 70 | 3300049824 | Ga0501045_0463722 | Ga0501045_0463722_74_526 | 144 |
| 71 | 3300050514 | nmdc:mga08x19_134106_c1 | nmdc:mga08x19_134106_c1_97_531 | 144 |
| 72 | 3300054114 | Ga0501084_0266209 | Ga0501084_0266209_517_969 | 144 |
| 73 | 3300060353 | Ga0501082_0049411 | Ga0501082_0049411_2160_2612 | 144 |
| 74 | 3300061734 | Ga0530510_0183692 | Ga0530510_0183692_762_1214 | 144 |
| 75 | 3300003203 | JGI25406J46586_10086473 | JGI25406J46586_100864731 | 145 |
| 76 | 3300003911 | JGI25405J52794_10039346 | JGI25405J52794_100393462 | 145 |
| 77 | 3300005289 | Ga0065704_10333562 | Ga0065704_103335622 | 145 |
| 78 | 3300005295 | Ga0065707_10122472 | Ga0065707_101224723 | 145 |
| 79 | 3300005327 | Ga0070658_10137841 | Ga0070658_101378412 | 145 |
| 80 | 3300005328 | Ga0070676_10672576 | Ga0070676_106725762 | 145 |
| 81 | 3300005329 | Ga0070683_100259155 | Ga0070683_1002591553 | 145 |
| 82 | 3300005330 | Ga0070690_100153982 | Ga0070690_1001539822 | 145 |
| 83 | 3300005331 | Ga0070670_100013182 | Ga0070670_1000131823 | 145 |
| 84 | 3300005334 | Ga0068869_100070724 | Ga0068869_1000707242 | 145 |
| 85 | 3300005334 | Ga0068869_100501342 | Ga0068869_1005013422 | 145 |
| 86 | 3300005335 | Ga0070666_10006300 | Ga0070666_100063006 | 145 |
| 87 | 3300005335 | Ga0070666_10081831 | Ga0070666_100818312 | 145 |
| 88 | 3300005337 | Ga0070682_100011027 | Ga0070682_1000110272 | 145 |
| 89 | 3300005338 | Ga0068868_100194630 | Ga0068868_1001946303 | 145 |
| 90 | 3300005339 | Ga0070660_100723766 | Ga0070660_1007237662 | 145 |
| 91 | 3300005340 | Ga0070689_101050319 | Ga0070689_1010503191 | 145 |
| 92 | 3300005340 | Ga0070689_101292477 | Ga0070689_1012924771 | 145 |
| 93 | 3300005343 | Ga0070687_100124262 | Ga0070687_1001242622 | 145 |
| 94 | 3300005343 | Ga0070687_100253001 | Ga0070687_1002530012 | 145 |
| 95 | 3300005344 | Ga0070661_100047285 | Ga0070661_1000472853 | 145 |
| 96 | 3300005344 | Ga0070661_100398069 | Ga0070661_1003980692 | 145 |
| 97 | 3300005347 | Ga0070668_101180770 | Ga0070668_1011807702 | 145 |
| 98 | 3300005353 | Ga0070669_100307605 | Ga0070669_1003076051 | 145 |
| 99 | 3300005354 | Ga0070675_100415291 | Ga0070675_1004152912 | 145 |
| 100 | 3300005355 | Ga0070671_100050140 | Ga0070671_1000501403 | 145 |
| 101 | 3300005355 | Ga0070671_100350017 | Ga0070671_1003500172 | 145 |
| 102 | 3300005356 | Ga0070674_100045236 | Ga0070674_1000452362 | 145 |
| 103 | 3300005356 | Ga0070674_100367218 | Ga0070674_1003672182 | 145 |
| 104 | 3300005364 | Ga0070673_100348700 | Ga0070673_1003487002 | 145 |
| 105 | 3300005365 | Ga0070688_100336163 | Ga0070688_1003361632 | 145 |
| 106 | 3300005366 | Ga0070659_100310041 | Ga0070659_1003100412 | 145 |
| 107 | 3300005367 | Ga0070667_100970156 | Ga0070667_1009701561 | 145 |
| 108 | 3300005434 | Ga0070709_10003768 | Ga0070709_100037686 | 145 |
| 109 | 3300005434 | Ga0070709_10697926 | Ga0070709_106979262 | 145 |
| 110 | 3300005435 | Ga0070714_100019011 | Ga0070714_1000190112 | 145 |
| 111 | 3300005436 | Ga0070713_100002318 | Ga0070713_1000023188 | 145 |
| 112 | 3300005436 | Ga0070713_100181181 | Ga0070713_1001811812 | 145 |
| 113 | 3300005437 | Ga0070710_10008161 | Ga0070710_100081612 | 145 |
| 114 | 3300005437 | Ga0070710_10160535 | Ga0070710_101605352 | 145 |
| 115 | 3300005437 | Ga0070710_10583110 | Ga0070710_105831102 | 145 |
| 116 | 3300005439 | Ga0070711_100092544 | Ga0070711_1000925442 | 145 |
| 117 | 3300005439 | Ga0070711_100142043 | Ga0070711_1001420433 | 145 |
| 118 | 3300005439 | Ga0070711_101131538 | Ga0070711_1011315382 | 145 |
| 119 | 3300005441 | Ga0070700_100148520 | Ga0070700_1001485202 | 145 |
| 120 | 3300005441 | Ga0070700_101774421 | Ga0070700_1017744211 | 145 |
| 121 | 3300005455 | Ga0070663_100793675 | Ga0070663_1007936751 | 145 |
| 122 | 3300005456 | Ga0070678_100175432 | Ga0070678_1001754321 | 145 |
| 123 | 3300005457 | Ga0070662_100600206 | Ga0070662_1006002062 | 145 |
| 124 | 3300005458 | Ga0070681_10035305 | Ga0070681_100353055 | 145 |
| 125 | 3300005459 | Ga0068867_100158894 | Ga0068867_1001588942 | 145 |
| 126 | 3300005459 | Ga0068867_101592018 | Ga0068867_1015920181 | 145 |
| 127 | 3300005466 | Ga0070685_10023556 | Ga0070685_100235562 | 145 |
| 128 | 3300005471 | Ga0070698_101264242 | Ga0070698_1012642422 | 145 |
| 129 | 3300005530 | Ga0070679_100002402 | Ga0070679_1000024025 | 145 |
| 130 | 3300005535 | Ga0070684_100084206 | Ga0070684_1000842062 | 145 |
| 131 | 3300005535 | Ga0070684_100179541 | Ga0070684_1001795412 | 145 |
| 132 | 3300005535 | Ga0070684_100436862 | Ga0070684_1004368622 | 145 |
| 133 | 3300005539 | Ga0068853_100250317 | Ga0068853_1002503172 | 145 |
| 134 | 3300005544 | Ga0070686_100005122 | Ga0070686_1000051223 | 145 |
| 135 | 3300005544 | Ga0070686_100236217 | Ga0070686_1002362172 | 145 |
| 136 | 3300005547 | Ga0070693_100406140 | Ga0070693_1004061402 | 145 |
| 137 | 3300005548 | Ga0070665_100054360 | Ga0070665_1000543602 | 145 |
| 138 | 3300005564 | Ga0070664_100082756 | Ga0070664_1000827563 | 145 |
| 139 | 3300005614 | Ga0068856_100372112 | Ga0068856_1003721122 | 145 |
| 140 | 3300005615 | Ga0070702_100092938 | Ga0070702_1000929382 | 145 |
| 141 | 3300005617 | Ga0068859_100504790 | Ga0068859_1005047902 | 145 |
| 142 | 3300005618 | Ga0068864_100096201 | Ga0068864_1000962012 | 145 |
| 143 | 3300005618 | Ga0068864_100181158 | Ga0068864_1001811582 | 145 |
| 144 | 3300005718 | Ga0068866_10114499 | Ga0068866_101144992 | 145 |
| 145 | 3300005718 | Ga0068866_10420455 | Ga0068866_104204552 | 145 |
| 146 | 3300005719 | Ga0068861_100690806 | Ga0068861_1006908061 | 145 |
| 147 | 3300005719 | Ga0068861_100698118 | Ga0068861_1006981182 | 145 |
| 148 | 3300005834 | Ga0068851_10284088 | Ga0068851_102840882 | 145 |
| 149 | 3300005841 | Ga0068863_100265435 | Ga0068863_1002654352 | 145 |
| 150 | 3300005841 | Ga0068863_100776882 | Ga0068863_1007768821 | 145 |
| 151 | 3300005842 | Ga0068858_100109723 | Ga0068858_1001097232 | 145 |
| 152 | 3300005843 | Ga0068860_100026842 | Ga0068860_1000268426 | 145 |
| 153 | 3300005937 | Ga0081455_10000009 | Ga0081455_10000009207 | 145 |
| 154 | 3300005985 | Ga0081539_10002225 | Ga0081539_1000222523 | 145 |
| 155 | 3300006028 | Ga0070717_10046865 | Ga0070717_100468653 | 145 |
| 156 | 3300006028 | Ga0070717_10360066 | Ga0070717_103600661 | 145 |
| 157 | 3300006028 | Ga0070717_10451238 | Ga0070717_104512382 | 145 |
| 158 | 3300006028 | Ga0070717_11114502 | Ga0070717_111145021 | 145 |
| 159 | 3300006048 | Ga0075363_100162774 | Ga0075363_1001627742 | 145 |
| 160 | 3300006058 | Ga0075432_10001176 | Ga0075432_100011762 | 145 |
| 161 | 3300006163 | Ga0070715_10000335 | Ga0070715_100003356 | 145 |
| 162 | 3300006163 | Ga0070715_10036610 | Ga0070715_100366102 | 145 |
| 163 | 3300006173 | Ga0070716_100021991 | Ga0070716_1000219912 | 145 |
| 164 | 3300006173 | Ga0070716_100180886 | Ga0070716_1001808862 | 145 |
| 165 | 3300006173 | Ga0070716_100679198 | Ga0070716_1006791982 | 145 |
| 166 | 3300006173 | Ga0070716_101443632 | Ga0070716_1014436321 | 145 |
| 167 | 3300006175 | Ga0070712_100002895 | Ga0070712_1000028952 | 145 |
| 168 | 3300006175 | Ga0070712_100011668 | Ga0070712_1000116685 | 145 |
| 169 | 3300006175 | Ga0070712_100072081 | Ga0070712_1000720812 | 145 |
| 170 | 3300006175 | Ga0070712_100248078 | Ga0070712_1002480782 | 145 |
| 171 | 3300006175 | Ga0070712_100398798 | Ga0070712_1003987982 | 145 |
| 172 | 3300006175 | Ga0070712_100931077 | Ga0070712_1009310772 | 145 |
| 173 | 3300006177 | Ga0075362_10533837 | Ga0075362_105338371 | 145 |
| 174 | 3300006178 | Ga0075367_10236971 | Ga0075367_102369712 | 145 |
| 175 | 3300006186 | Ga0075369_10093136 | Ga0075369_100931361 | 145 |
| 176 | 3300006194 | Ga0075427_10000004 | Ga0075427_100000048 | 145 |
| 177 | 3300006237 | Ga0097621_102180347 | Ga0097621_1021803471 | 145 |
| 178 | 3300006353 | Ga0075370_10644727 | Ga0075370_106447272 | 145 |
| 179 | 3300006358 | Ga0068871_100050987 | Ga0068871_1000509873 | 145 |
| 180 | 3300006358 | Ga0068871_100234468 | Ga0068871_1002344682 | 145 |
| 181 | 3300006844 | Ga0075428_100008326 | Ga0075428_1000083268 | 145 |
| 182 | 3300006844 | Ga0075428_100067187 | Ga0075428_1000671875 | 145 |
| 183 | 3300006844 | Ga0075428_100765921 | Ga0075428_1007659212 | 145 |
| 184 | 3300006844 | Ga0075428_100793794 | Ga0075428_1007937941 | 145 |
| 185 | 3300006846 | Ga0075430_100001186 | Ga0075430_1000011869 | 145 |
| 186 | 3300006846 | Ga0075430_100024049 | Ga0075430_1000240495 | 145 |
| 187 | 3300006846 | Ga0075430_100355025 | Ga0075430_1003550252 | 145 |
| 188 | 3300006847 | Ga0075431_100000495 | Ga0075431_10000049521 | 145 |
| 189 | 3300006847 | Ga0075431_100001446 | Ga0075431_1000014468 | 145 |
| 190 | 3300006852 | Ga0075433_10000215 | Ga0075433_1000021535 | 145 |
| 191 | 3300006852 | Ga0075433_10104188 | Ga0075433_101041882 | 145 |
| 192 | 3300006852 | Ga0075433_10873017 | Ga0075433_108730171 | 145 |
| 193 | 3300006852 | Ga0075433_11240700 | Ga0075433_112407002 | 145 |
| 194 | 3300006871 | Ga0075434_100003016 | Ga0075434_10000301615 | 145 |
| 195 | 3300006871 | Ga0075434_100025301 | Ga0075434_1000253016 | 145 |
| 196 | 3300006871 | Ga0075434_100125041 | Ga0075434_1001250412 | 145 |
| 197 | 3300006880 | Ga0075429_100002098 | Ga0075429_10000209820 | 145 |
| 198 | 3300006880 | Ga0075429_100090214 | Ga0075429_1000902142 | 145 |
| 199 | 3300006914 | Ga0075436_100420179 | Ga0075436_1004201791 | 145 |
| 200 | 3300006931 | Ga0097620_100504767 | Ga0097620_1005047672 | 145 |
| 201 | 3300007076 | Ga0075435_100009478 | Ga0075435_1000094783 | 145 |
| 202 | 3300009011 | Ga0105251_10043757 | Ga0105251_100437573 | 145 |
| 203 | 3300009092 | Ga0105250_10170438 | Ga0105250_101704381 | 145 |
| 204 | 3300009093 | Ga0105240_10317677 | Ga0105240_103176772 | 145 |
| 205 | 3300009093 | Ga0105240_11719008 | Ga0105240_117190082 | 145 |
| 206 | 3300009094 | Ga0111539_10002796 | Ga0111539_1000279617 | 145 |
| 207 | 3300009094 | Ga0111539_10008242 | Ga0111539_1000824211 | 145 |
| 208 | 3300009094 | Ga0111539_10251597 | Ga0111539_102515972 | 145 |
| 209 | 3300009094 | Ga0111539_10406262 | Ga0111539_104062622 | 145 |
| 210 | 3300009098 | Ga0105245_10115883 | Ga0105245_101158833 | 145 |
| 211 | 3300009101 | Ga0105247_10028332 | Ga0105247_100283322 | 145 |
| 212 | 3300009101 | Ga0105247_10100661 | Ga0105247_101006612 | 145 |
| 213 | 3300009147 | Ga0114129_10001495 | Ga0114129_1000149521 | 145 |
| 214 | 3300009147 | Ga0114129_10007384 | Ga0114129_100073845 | 145 |
| 215 | 3300009147 | Ga0114129_10019783 | Ga0114129_1001978310 | 145 |
| 216 | 3300009147 | Ga0114129_10133267 | Ga0114129_101332674 | 145 |
| 217 | 3300009147 | Ga0114129_10177048 | Ga0114129_101770484 | 145 |
| 218 | 3300009148 | Ga0105243_10104484 | Ga0105243_101044842 | 145 |
| 219 | 3300009148 | Ga0105243_10341872 | Ga0105243_103418722 | 145 |
| 220 | 3300009174 | Ga0105241_10061040 | Ga0105241_100610403 | 145 |
| 221 | 3300009174 | Ga0105241_10284963 | Ga0105241_102849631 | 145 |
| 222 | 3300009176 | Ga0105242_10049393 | Ga0105242_100493932 | 145 |
| 223 | 3300009176 | Ga0105242_11839339 | Ga0105242_118393391 | 145 |
| 224 | 3300009545 | Ga0105237_10150790 | Ga0105237_101507902 | 145 |
| 225 | 3300009545 | Ga0105237_10459736 | Ga0105237_104597362 | 145 |
| 226 | 3300009551 | Ga0105238_10135924 | Ga0105238_101359242 | 145 |
| 227 | 3300009553 | Ga0105249_10540192 | Ga0105249_105401922 | 145 |
| 228 | 3300011119 | Ga0105246_10053412 | Ga0105246_100534122 | 145 |
| 229 | 3300011119 | Ga0105246_10208340 | Ga0105246_102083402 | 145 |
| 230 | 3300012480 | Ga0157346_1009594 | Ga0157346_10095942 | 145 |
| 231 | 3300013104 | Ga0157370_10339456 | Ga0157370_103394562 | 145 |
| 232 | 3300013296 | Ga0157374_11649764 | Ga0157374_116497641 | 145 |
| 233 | 3300013297 | Ga0157378_10139807 | Ga0157378_101398073 | 145 |
| 234 | 3300013297 | Ga0157378_10576564 | Ga0157378_105765642 | 145 |
| 235 | 3300013297 | Ga0157378_12766164 | Ga0157378_127661641 | 145 |
| 236 | 3300013306 | Ga0163162_10165484 | Ga0163162_101654843 | 145 |
| 237 | 3300013306 | Ga0163162_10923055 | Ga0163162_109230552 | 145 |
| 238 | 3300013306 | Ga0163162_11789809 | Ga0163162_117898091 | 145 |
| 239 | 3300013308 | Ga0157375_10120161 | Ga0157375_101201613 | 145 |
| 240 | 3300013308 | Ga0157375_10298887 | Ga0157375_102988872 | 145 |
| 241 | 3300013308 | Ga0157375_13795309 | Ga0157375_137953091 | 145 |
| 242 | 3300014325 | Ga0163163_10469870 | Ga0163163_104698702 | 145 |
| 243 | 3300014325 | Ga0163163_10473011 | Ga0163163_104730112 | 145 |
| 244 | 3300014326 | Ga0157380_10597913 | Ga0157380_105979131 | 145 |
| 245 | 3300014326 | Ga0157380_10845584 | Ga0157380_108455842 | 145 |
| 246 | 3300014326 | Ga0157380_10911653 | Ga0157380_109116532 | 145 |
| 247 | 3300014326 | Ga0157380_12131205 | Ga0157380_121312051 | 145 |
| 248 | 3300014497 | Ga0182008_10275622 | Ga0182008_102756222 | 145 |
| 249 | 3300014745 | Ga0157377_10044078 | Ga0157377_100440782 | 145 |
| 250 | 3300014745 | Ga0157377_10188715 | Ga0157377_101887152 | 145 |
| 251 | 3300014968 | Ga0157379_10064249 | Ga0157379_100642493 | 145 |
| 252 | 3300014968 | Ga0157379_10361684 | Ga0157379_103616842 | 145 |
| 253 | 3300014969 | Ga0157376_10375267 | Ga0157376_103752672 | 145 |
| 254 | 3300017792 | Ga0163161_10260409 | Ga0163161_102604092 | 145 |
| 255 | 3300017792 | Ga0163161_11233541 | Ga0163161_112335411 | 145 |
| 256 | 3300017792 | Ga0163161_11340637 | Ga0163161_113406371 | 145 |
| 257 | 3300021377 | Ga0213874_10179409 | Ga0213874_101794092 | 145 |
| 258 | 3300021384 | Ga0213876_10073520 | Ga0213876_100735202 | 145 |
| 259 | 3300021384 | Ga0213876_10146184 | Ga0213876_101461842 | 145 |
| 260 | 3300021388 | Ga0213875_10199452 | Ga0213875_101994521 | 145 |
| 261 | 3300024227 | Ga0228598_1002219 | Ga0228598_10022194 | 145 |
| 262 | 3300025315 | Ga0207697_10013424 | Ga0207697_100134244 | 145 |
| 263 | 3300025893 | Ga0207682_10002089 | Ga0207682_100020896 | 145 |
| 264 | 3300025898 | Ga0207692_10254017 | Ga0207692_102540172 | 145 |
| 265 | 3300025898 | Ga0207692_10463361 | Ga0207692_104633611 | 145 |
| 266 | 3300025899 | Ga0207642_10038995 | Ga0207642_100389952 | 145 |
| 267 | 3300025900 | Ga0207710_10028228 | Ga0207710_100282282 | 145 |
| 268 | 3300025901 | Ga0207688_10014043 | Ga0207688_100140434 | 145 |
| 269 | 3300025905 | Ga0207685_10088139 | Ga0207685_100881391 | 145 |
| 270 | 3300025906 | Ga0207699_10352861 | Ga0207699_103528612 | 145 |
| 271 | 3300025907 | Ga0207645_10031461 | Ga0207645_100314613 | 145 |
| 272 | 3300025908 | Ga0207643_10027396 | Ga0207643_100273963 | 145 |
| 273 | 3300025909 | Ga0207705_10143590 | Ga0207705_101435902 | 145 |
| 274 | 3300025911 | Ga0207654_10166642 | Ga0207654_101666421 | 145 |
| 275 | 3300025911 | Ga0207654_10181127 | Ga0207654_101811272 | 145 |
| 276 | 3300025912 | Ga0207707_10318070 | Ga0207707_103180702 | 145 |
| 277 | 3300025913 | Ga0207695_10205081 | Ga0207695_102050812 | 145 |
| 278 | 3300025914 | Ga0207671_10365813 | Ga0207671_103658132 | 145 |
| 279 | 3300025915 | Ga0207693_10003273 | Ga0207693_1000327310 | 145 |
| 280 | 3300025915 | Ga0207693_10014672 | Ga0207693_100146722 | 145 |
| 281 | 3300025915 | Ga0207693_10174965 | Ga0207693_101749651 | 145 |
| 282 | 3300025916 | Ga0207663_10079122 | Ga0207663_100791222 | 145 |
| 283 | 3300025916 | Ga0207663_10939683 | Ga0207663_109396832 | 145 |
| 284 | 3300025917 | Ga0207660_10094398 | Ga0207660_100943983 | 145 |
| 285 | 3300025918 | Ga0207662_10019411 | Ga0207662_100194112 | 145 |
| 286 | 3300025919 | Ga0207657_10017549 | Ga0207657_100175496 | 145 |
| 287 | 3300025923 | Ga0207681_10123224 | Ga0207681_101232243 | 145 |
| 288 | 3300025923 | Ga0207681_10688715 | Ga0207681_106887152 | 145 |
| 289 | 3300025924 | Ga0207694_10114676 | Ga0207694_101146762 | 145 |
| 290 | 3300025926 | Ga0207659_10299907 | Ga0207659_102999072 | 145 |
| 291 | 3300025926 | Ga0207659_10351761 | Ga0207659_103517612 | 145 |
| 292 | 3300025926 | Ga0207659_10406867 | Ga0207659_104068672 | 145 |
| 293 | 3300025928 | Ga0207700_10302824 | Ga0207700_103028242 | 145 |
| 294 | 3300025928 | Ga0207700_10437230 | Ga0207700_104372302 | 145 |
| 295 | 3300025929 | Ga0207664_10023134 | Ga0207664_100231343 | 145 |
| 296 | 3300025933 | Ga0207706_10262066 | Ga0207706_102620662 | 145 |
| 297 | 3300025935 | Ga0207709_10062004 | Ga0207709_100620042 | 145 |
| 298 | 3300025937 | Ga0207669_10076635 | Ga0207669_100766352 | 145 |
| 299 | 3300025937 | Ga0207669_10443128 | Ga0207669_104431281 | 145 |
| 300 | 3300025939 | Ga0207665_10240069 | Ga0207665_102400692 | 145 |
| 301 | 3300025939 | Ga0207665_10357104 | Ga0207665_103571042 | 145 |
| 302 | 3300025939 | Ga0207665_10437298 | Ga0207665_104372982 | 145 |
| 303 | 3300025940 | Ga0207691_10036320 | Ga0207691_100363205 | 145 |
| 304 | 3300025942 | Ga0207689_10026402 | Ga0207689_100264022 | 145 |
| 305 | 3300025942 | Ga0207689_10119517 | Ga0207689_101195172 | 145 |
| 306 | 3300025944 | Ga0207661_10652341 | Ga0207661_106523411 | 145 |
| 307 | 3300025945 | Ga0207679_10508951 | Ga0207679_105089512 | 145 |
| 308 | 3300025972 | Ga0207668_10144447 | Ga0207668_101444472 | 145 |
| 309 | 3300025972 | Ga0207668_10985533 | Ga0207668_109855332 | 145 |
| 310 | 3300025986 | Ga0207658_11403338 | Ga0207658_114033382 | 145 |
| 311 | 3300026023 | Ga0207677_11013672 | Ga0207677_110136722 | 145 |
| 312 | 3300026035 | Ga0207703_10293550 | Ga0207703_102935502 | 145 |
| 313 | 3300026075 | Ga0207708_10282951 | Ga0207708_102829511 | 145 |
| 314 | 3300026078 | Ga0207702_10151197 | Ga0207702_101511971 | 145 |
| 315 | 3300026088 | Ga0207641_10823780 | Ga0207641_108237802 | 145 |
| 316 | 3300026088 | Ga0207641_11350220 | Ga0207641_113502201 | 145 |
| 317 | 3300026089 | Ga0207648_11410204 | Ga0207648_114102041 | 145 |
| 318 | 3300026095 | Ga0207676_10377832 | Ga0207676_103778322 | 145 |
| 319 | 3300026118 | Ga0207675_100110657 | Ga0207675_1001106572 | 145 |
| 320 | 3300026118 | Ga0207675_100723876 | Ga0207675_1007238762 | 145 |
| 321 | 3300026121 | Ga0207683_10008669 | Ga0207683_100086694 | 145 |
| 322 | 3300027907 | Ga0207428_10000216 | Ga0207428_1000021649 | 145 |
| 323 | 3300027907 | Ga0207428_10005674 | Ga0207428_1000567410 | 145 |
| 324 | 3300027907 | Ga0207428_10363745 | Ga0207428_103637452 | 145 |
| 325 | 3300028380 | Ga0268265_10253148 | Ga0268265_102531482 | 145 |
| 326 | 3300028556 | Ga0265337_1001192 | Ga0265337_10011924 | 145 |
| 327 | 3300028786 | Ga0307517_10449559 | Ga0307517_104495592 | 145 |
| 328 | 3300028800 | Ga0265338_10315196 | Ga0265338_103151962 | 145 |
| 329 | 3300030760 | Ga0265762_1110991 | Ga0265762_11109912 | 145 |
| 330 | 3300031090 | Ga0265760_10245209 | Ga0265760_102452091 | 145 |
| 331 | 3300031235 | Ga0265330_10043603 | Ga0265330_100436032 | 145 |
| 332 | 3300031235 | Ga0265330_10044424 | Ga0265330_100444242 | 145 |
| 333 | 3300031239 | Ga0265328_10100542 | Ga0265328_101005421 | 145 |
| 334 | 3300031241 | Ga0265325_10336510 | Ga0265325_103365101 | 145 |
| 335 | 3300031241 | Ga0265325_10414322 | Ga0265325_104143222 | 145 |
| 336 | 3300031242 | Ga0265329_10054423 | Ga0265329_100544232 | 145 |
| 337 | 3300031247 | Ga0265340_10021741 | Ga0265340_100217413 | 145 |
| 338 | 3300031247 | Ga0265340_10360897 | Ga0265340_103608971 | 145 |
| 339 | 3300031249 | Ga0265339_10085982 | Ga0265339_100859822 | 145 |
| 340 | 3300031344 | Ga0265316_10062118 | Ga0265316_100621184 | 145 |
| 341 | 3300031344 | Ga0265316_10204847 | Ga0265316_102048472 | 145 |
| 342 | 3300031456 | Ga0307513_10157895 | Ga0307513_101578952 | 145 |
| 343 | 3300031456 | Ga0307513_10326947 | Ga0307513_103269472 | 145 |
| 344 | 3300031595 | Ga0265313_10091912 | Ga0265313_100919122 | 145 |
| 345 | 3300031595 | Ga0265313_10333797 | Ga0265313_103337972 | 145 |
| 346 | 3300031711 | Ga0265314_10098095 | Ga0265314_100980952 | 145 |
| 347 | 3300031712 | Ga0265342_10132046 | Ga0265342_101320461 | 145 |
| 348 | 3300032002 | Ga0307416_101871711 | Ga0307416_1018717111 | 145 |
| 349 | 3300032002 | Ga0307416_102155928 | Ga0307416_1021559281 | 145 |
| 350 | 3300035083 | Ga0373926_0027700 | Ga0373926_0027700_95_532 | 145 |
| 351 | 3300035111 | Ga0373923_0207429 | Ga0373923_0207429_139_576 | 145 |
| 352 | 3300035113 | Ga0373936_0295959 | Ga0373936_0295959_71_508 | 145 |
| 353 | 3300035116 | Ga0373945_0002014 | Ga0373945_0002014_1060_1497 | 145 |
| 354 | 3300035116 | Ga0373945_0002085 | Ga0373945_0002085_314_751 | 145 |
| 355 | 3300035117 | Ga0373953_0054225 | Ga0373953_0054225_543_980 | 145 |
| 356 | 3300035119 | Ga0373956_0015218 | Ga0373956_0015218_205_642 | 145 |
| 357 | 3300035119 | Ga0373956_0041589 | Ga0373956_0041589_174_611 | 145 |
| 358 | 3300035120 | Ga0373957_0033295 | Ga0373957_0033295_547_984 | 145 |
| 359 | 3300035120 | Ga0373957_0112329 | Ga0373957_0112329_549_986 | 145 |
| 360 | 3300035170 | Ga0373943_0013910 | Ga0373943_0013910_1201_1638 | 145 |
| 361 | 3300035170 | Ga0373943_0024601 | Ga0373943_0024601_1094_1531 | 145 |
| 362 | 3300035170 | Ga0373943_0078918 | Ga0373943_0078918_683_1120 | 145 |
| 363 | 3300035171 | Ga0373946_0001923 | Ga0373946_0001923_5247_5684 | 145 |
| 364 | 3300035171 | Ga0373946_0031860 | Ga0373946_0031860_1537_1974 | 145 |
| 365 | 3300035171 | Ga0373946_0037161 | Ga0373946_0037161_454_891 | 145 |
| 366 | 3300035172 | Ga0373955_0095658 | Ga0373955_0095658_1168_1605 | 145 |
| 367 | 3300035241 | Ga0373961_0003036 | Ga0373961_0003036_2728_3165 | 145 |
| 368 | 3300035242 | Ga0373962_0196113 | Ga0373962_0196113_183_620 | 145 |
| 369 | 3300035410 | Ga0373924_0184637 | Ga0373924_0184637_470_907 | 145 |
| 370 | 3300035410 | Ga0373924_0242140 | Ga0373924_0242140_116_553 | 145 |
| 371 | 3300035410 | Ga0373924_0324726 | Ga0373924_0324726_58_495 | 145 |
| 372 | 3300035691 | Ga0373931_0027626 | Ga0373931_0027626_541_978 | 145 |
| 373 | 3300035691 | Ga0373931_0133597 | Ga0373931_0133597_97_534 | 145 |
| 374 | 3300035691 | Ga0373931_1233336 | Ga0373931_1233336_30_467 | 145 |
| 375 | 3300035692 | Ga0373935_0042243 | Ga0373935_0042243_1772_2209 | 145 |
| 376 | 3300035692 | Ga0373935_0056027 | Ga0373935_0056027_18_455 | 145 |
| 377 | 3300035692 | Ga0373935_0101292 | Ga0373935_0101292_48_485 | 145 |
| 378 | 3300035692 | Ga0373935_0350398 | Ga0373935_0350398_140_577 | 145 |
| 379 | 3300035695 | Ga0373927_0001051 | Ga0373927_0001051_11294_11731 | 145 |
| 380 | 3300035695 | Ga0373927_0062052 | Ga0373927_0062052_1552_1989 | 145 |
| 381 | 3300035695 | Ga0373927_0107975 | Ga0373927_0107975_603_1040 | 145 |
| 382 | 3300035695 | Ga0373927_0341711 | Ga0373927_0341711_359_796 | 145 |
| 383 | 3300035724 | Ga0373933_0025433 | Ga0373933_0025433_547_984 | 145 |
| 384 | 3300035724 | Ga0373933_0100245 | Ga0373933_0100245_970_1407 | 145 |
| 385 | 3300035724 | Ga0373933_0144981 | Ga0373933_0144981_1021_1458 | 145 |
| 386 | 3300035725 | Ga0373947_0014697 | Ga0373947_0014697_1974_2411 | 145 |
| 387 | 3300035725 | Ga0373947_0061602 | Ga0373947_0061602_1688_2125 | 145 |
| 388 | 3300035725 | Ga0373947_0169495 | Ga0373947_0169495_250_687 | 145 |
| 389 | 3300036401 | Ga0373937_0003621 | Ga0373937_0003621_2404_2841 | 145 |
| 390 | 3300036401 | Ga0373937_0250362 | Ga0373937_0250362_263_700 | 145 |
| 391 | 3300036401 | Ga0373937_0485462 | Ga0373937_0485462_633_1070 | 145 |
| 392 | 3300037068 | Ga0373925_0001925 | Ga0373925_0001925_1935_2372 | 145 |
| 393 | 3300037068 | Ga0373925_0277865 | Ga0373925_0277865_338_775 | 145 |
| 394 | 3300037853 | Ga0436364_0172837 | Ga0436364_0172837_81_518 | 145 |
| 395 | 3300037853 | Ga0436364_0768079 | Ga0436364_0768079_31245_31682 | 145 |
| 396 | 3300039437 | Ga0436365_0015204 | Ga0436365_0015204_1294_1731 | 145 |
| 397 | 3300039437 | Ga0436365_0330093 | Ga0436365_0330093_3490_3927 | 145 |
| 398 | 3300039437 | Ga0436365_0956437 | Ga0436365_0956437_1018_1455 | 145 |
| 399 | 3300039437 | Ga0436365_1020485 | Ga0436365_1020485_512_949 | 145 |
| 400 | 3300039437 | Ga0436365_1274046 | Ga0436365_1274046_1723_2160 | 145 |
| 401 | 3300039438 | Ga0436360_0975963 | Ga0436360_0975963_779_1216 | 145 |
| 402 | 3300039438 | Ga0436360_1342663 | Ga0436360_1342663_64_501 | 145 |
| 403 | 3300039450 | Ga0436363_1229486 | Ga0436363_1229486_957_1421 | 145 |
| 404 | 3300039453 | Ga0436362_0612627 | Ga0436362_0612627_370_807 | 145 |
| 405 | 3300041408 | Ga0439453_0000869 | Ga0439453_0000869_2184_2630 | 145 |
| 406 | 3300041408 | Ga0439453_0001995 | Ga0439453_0001995_1934_2374 | 145 |
| 407 | 3300041494 | Ga0451837_1680603 | Ga0451837_1680603_21_494 | 145 |
| 408 | 3300042001 | Ga0439441_007857 | Ga0439441_007857_839_1285 | 145 |
| 409 | 3300042003 | Ga0439443_004727 | Ga0439443_004727_48_494 | 145 |
| 410 | 3300042156 | Ga0439446_0323384 | Ga0439446_0323384_35_472 | 145 |
| 411 | 3300042435 | Ga0439434_0029200 | Ga0439434_0029200_239_676 | 145 |
| 412 | 3300042436 | Ga0439435_0004045 | Ga0439435_0004045_984_1430 | 145 |
| 413 | 3300042461 | Ga0439460_0012318 | Ga0439460_0012318_269_715 | 145 |
| 414 | 3300042993 | Ga0439440_0149830 | Ga0439440_0149830_74_511 | 145 |
| 415 | 3300046454 | Ga0495592_0011867 | Ga0495592_0011867_1525_1962 | 145 |
| 416 | 3300046454 | Ga0495592_0180366 | Ga0495592_0180366_558_995 | 145 |
| 417 | 3300046455 | Ga0495603_0266359 | Ga0495603_0266359_116_553 | 145 |
| 418 | 3300046455 | Ga0495603_0530640 | Ga0495603_0530640_96_533 | 145 |
| 419 | 3300046459 | Ga0495629_0000409 | Ga0495629_0000409_3224_3661 | 145 |
| 420 | 3300046459 | Ga0495629_0082303 | Ga0495629_0082303_494_931 | 145 |
| 421 | 3300046459 | Ga0495629_0227625 | Ga0495629_0227625_89_526 | 145 |
| 422 | 3300046460 | Ga0495638_0025735 | Ga0495638_0025735_75_512 | 145 |
| 423 | 3300046462 | Ga0495651_0001051 | Ga0495651_0001051_3109_3546 | 145 |
| 424 | 3300046463 | Ga0495653_0006259 | Ga0495653_0006259_619_1056 | 145 |
| 425 | 3300046463 | Ga0495653_0018050 | Ga0495653_0018050_2085_2522 | 145 |
| 426 | 3300046463 | Ga0495653_0051356 | Ga0495653_0051356_1510_1947 | 145 |
| 427 | 3300046472 | Ga0495580_0008552 | Ga0495580_0008552_7116_7553 | 145 |
| 428 | 3300046473 | Ga0495582_0003989 | Ga0495582_0003989_6732_7169 | 145 |
| 429 | 3300046473 | Ga0495582_0088007 | Ga0495582_0088007_245_682 | 145 |
| 430 | 3300046474 | Ga0495605_0135393 | Ga0495605_0135393_654_1091 | 145 |
| 431 | 3300046475 | Ga0495639_0042949 | Ga0495639_0042949_1085_1522 | 145 |
| 432 | 3300046475 | Ga0495639_0136735 | Ga0495639_0136735_74_511 | 145 |
| 433 | 3300046475 | Ga0495639_0320789 | Ga0495639_0320789_237_674 | 145 |
| 434 | 3300046476 | Ga0495662_0016819 | Ga0495662_0016819_3009_3446 | 145 |
| 435 | 3300046476 | Ga0495662_0056662 | Ga0495662_0056662_1289_1726 | 145 |
| 436 | 3300046476 | Ga0495662_0130487 | Ga0495662_0130487_95_532 | 145 |
| 437 | 3300046476 | Ga0495662_0169498 | Ga0495662_0169498_429_866 | 145 |
| 438 | 3300046477 | Ga0495664_0005906 | Ga0495664_0005906_2220_2657 | 145 |
| 439 | 3300046477 | Ga0495664_0030144 | Ga0495664_0030144_1696_2133 | 145 |
| 440 | 3300046477 | Ga0495664_0072871 | Ga0495664_0072871_412_849 | 145 |
| 441 | 3300046492 | Ga0495585_0003749 | Ga0495585_0003749_7289_7726 | 145 |
| 442 | 3300046499 | Ga0495594_0015128 | Ga0495594_0015128_2794_3231 | 145 |
| 443 | 3300046499 | Ga0495594_0396163 | Ga0495594_0396163_26_463 | 145 |
| 444 | 3300046501 | Ga0495607_0175372 | Ga0495607_0175372_167_604 | 145 |
| 445 | 3300046511 | Ga0495608_0006648 | Ga0495608_0006648_6019_6456 | 145 |
| 446 | 3300046514 | Ga0495618_0002201 | Ga0495618_0002201_8377_8814 | 145 |
| 447 | 3300046514 | Ga0495618_0059037 | Ga0495618_0059037_1070_1507 | 145 |
| 448 | 3300046514 | Ga0495618_0060883 | Ga0495618_0060883_1356_1793 | 145 |
| 449 | 3300046516 | Ga0495628_0042060 | Ga0495628_0042060_3066_3503 | 145 |
| 450 | 3300046516 | Ga0495628_0042157 | Ga0495628_0042157_1963_2400 | 145 |
| 451 | 3300046516 | Ga0495628_0167358 | Ga0495628_0167358_686_1123 | 145 |
| 452 | 3300046517 | Ga0495630_0011056 | Ga0495630_0011056_2425_2862 | 145 |
| 453 | 3300046517 | Ga0495630_0236109 | Ga0495630_0236109_290_727 | 145 |
| 454 | 3300046517 | Ga0495630_0274270 | Ga0495630_0274270_65_502 | 145 |
| 455 | 3300046517 | Ga0495630_1465810 | Ga0495630_1465810_16_453 | 145 |
| 456 | 3300046518 | Ga0495631_0266390 | Ga0495631_0266390_77_514 | 145 |
| 457 | 3300046523 | Ga0495644_0002002 | Ga0495644_0002002_6499_6936 | 145 |
| 458 | 3300046526 | Ga0495666_0012241 | Ga0495666_0012241_981_1418 | 145 |
| 459 | 3300046526 | Ga0495666_0231010 | Ga0495666_0231010_37_474 | 145 |
| 460 | 3300046529 | Ga0495652_0049908 | Ga0495652_0049908_2639_3076 | 145 |
| 461 | 3300046529 | Ga0495652_0126228 | Ga0495652_0126228_1018_1455 | 145 |
| 462 | 3300046531 | Ga0495665_0066837 | Ga0495665_0066837_1114_1551 | 145 |
| 463 | 3300046531 | Ga0495665_0079457 | Ga0495665_0079457_481_918 | 145 |
| 464 | 3300046533 | Ga0495640_0007732 | Ga0495640_0007732_3953_4390 | 145 |
| 465 | 3300046533 | Ga0495640_0017299 | Ga0495640_0017299_601_1038 | 145 |
| 466 | 3300046533 | Ga0495640_0088894 | Ga0495640_0088894_934_1371 | 145 |
| 467 | 3300046533 | Ga0495640_0426770 | Ga0495640_0426770_90_527 | 145 |
| 468 | 3300046533 | Ga0495640_0512432 | Ga0495640_0512432_63_500 | 145 |
| 469 | 3300046535 | Ga0495586_0115034 | Ga0495586_0115034_170_607 | 145 |
| 470 | 3300046536 | Ga0495587_0005039 | Ga0495587_0005039_4530_4967 | 145 |
| 471 | 3300046536 | Ga0495587_0025016 | Ga0495587_0025016_3114_3551 | 145 |
| 472 | 3300046537 | Ga0495598_0029634 | Ga0495598_0029634_778_1215 | 145 |
| 473 | 3300046539 | Ga0495621_0031214 | Ga0495621_0031214_863_1309 | 145 |
| 474 | 3300046543 | Ga0495645_0054915 | Ga0495645_0054915_1763_2200 | 145 |
| 475 | 3300046543 | Ga0495645_0083127 | Ga0495645_0083127_1204_1641 | 145 |
| 476 | 3300046557 | Ga0495622_0005809 | Ga0495622_0005809_20_457 | 145 |
| 477 | 3300046558 | Ga0495633_0062710 | Ga0495633_0062710_875_1312 | 145 |
| 478 | 3300046559 | Ga0495667_0007034 | Ga0495667_0007034_5500_5937 | 145 |
| 479 | 3300046559 | Ga0495667_0025648 | Ga0495667_0025648_3118_3555 | 145 |
| 480 | 3300046615 | Ga0495656_0004111 | Ga0495656_0004111_793_1230 | 145 |
| 481 | 3300046615 | Ga0495656_0472632 | Ga0495656_0472632_91_528 | 145 |
| 482 | 3300046642 | Ga0495634_0023235 | Ga0495634_0023235_890_1327 | 145 |
| 483 | 3300046642 | Ga0495634_0023747 | Ga0495634_0023747_2237_2674 | 145 |
| 484 | 3300046642 | Ga0495634_0066626 | Ga0495634_0066626_794_1231 | 145 |
| 485 | 3300046663 | Ga0495635_0000123 | Ga0495635_0000123_34720_35157 | 145 |
| 486 | 3300046663 | Ga0495635_0016669 | Ga0495635_0016669_4026_4463 | 145 |
| 487 | 3300046663 | Ga0495635_0028200 | Ga0495635_0028200_3381_3818 | 145 |
| 488 | 3300046663 | Ga0495635_0403273 | Ga0495635_0403273_198_635 | 145 |
| 489 | 3300046664 | Ga0495659_0005964 | Ga0495659_0005964_3078_3515 | 145 |
| 490 | 3300046665 | Ga0495661_0450825 | Ga0495661_0450825_171_608 | 145 |
| 491 | 3300046675 | Ga0495657_0053038 | Ga0495657_0053038_429_866 | 145 |
| 492 | 3300046675 | Ga0495657_0578651 | Ga0495657_0578651_32_469 | 145 |
| 493 | 3300046679 | Ga0495623_0027923 | Ga0495623_0027923_908_1345 | 145 |
| 494 | 3300046680 | Ga0495646_0394989 | Ga0495646_0394989_119_556 | 145 |
| 495 | 3300046680 | Ga0495646_0458610 | Ga0495646_0458610_199_636 | 145 |
| 496 | 3300046683 | Ga0495658_0028746 | Ga0495658_0028746_836_1273 | 145 |
| 497 | 3300046683 | Ga0495658_0070520 | Ga0495658_0070520_1199_1636 | 145 |
| 498 | 3300046689 | Ga0495613_0011532 | Ga0495613_0011532_4951_5388 | 145 |
| 499 | 3300046689 | Ga0495613_0075584 | Ga0495613_0075584_605_1042 | 145 |
| 500 | 3300046689 | Ga0495613_0581777 | Ga0495613_0581777_154_591 | 145 |
| 501 | 3300046690 | Ga0495624_0007113 | Ga0495624_0007113_5966_6403 | 145 |
| 502 | 3300046690 | Ga0495624_0032056 | Ga0495624_0032056_1247_1684 | 145 |
| 503 | 3300046690 | Ga0495624_0032178 | Ga0495624_0032178_390_827 | 145 |
| 504 | 3300046691 | Ga0495670_0109158 | Ga0495670_0109158_957_1394 | 145 |
| 505 | 3300046794 | Ga0495589_0140097 | Ga0495589_0140097_576_1013 | 145 |
| 506 | 3300046809 | Ga0495600_0003659 | Ga0495600_0003659_2299_2736 | 145 |
| 507 | 3300046809 | Ga0495600_0017154 | Ga0495600_0017154_2600_3037 | 145 |
| 508 | 3300047315 | Ga0495581_0092475 | Ga0495581_0092475_177_614 | 145 |
| 509 | 3300047315 | Ga0495581_0127145 | Ga0495581_0127145_198_635 | 145 |
| 510 | 3300047315 | Ga0495581_0533863 | Ga0495581_0533863_119_556 | 145 |
| 511 | 3300047317 | Ga0495604_0001090 | Ga0495604_0001090_12931_13368 | 145 |
| 512 | 3300047319 | Ga0495674_0003125 | Ga0495674_0003125_11262_11699 | 145 |
| 513 | 3300047319 | Ga0495674_0003227 | Ga0495674_0003227_3955_4392 | 145 |
| 514 | 3300047319 | Ga0495674_0051128 | Ga0495674_0051128_1859_2296 | 145 |
| 515 | 3300047319 | Ga0495674_0674258 | Ga0495674_0674258_196_633 | 145 |
| 516 | 3300047320 | Ga0495672_0068914 | Ga0495672_0068914_1445_1882 | 145 |
| 517 | 3300047320 | Ga0495672_0083535 | Ga0495672_0083535_464_901 | 145 |
| 518 | 3300047321 | Ga0495676_0048612 | Ga0495676_0048612_2902_3339 | 145 |
| 519 | 3300047321 | Ga0495676_0169834 | Ga0495676_0169834_787_1224 | 145 |
| 520 | 3300047322 | Ga0495680_0000795 | Ga0495680_0000795_25208_25645 | 145 |
| 521 | 3300047322 | Ga0495680_0034293 | Ga0495680_0034293_488_925 | 145 |
| 522 | 3300047444 | Ga0495675_0012693 | Ga0495675_0012693_604_1041 | 145 |
| 523 | 3300047447 | Ga0495685_110080 | Ga0495685_110080_324_761 | 145 |
| 524 | 3300047471 | Ga0495684_0000749 | Ga0495684_0000749_958_1395 | 145 |
| 525 | 3300047471 | Ga0495684_0005001 | Ga0495684_0005001_3249_3686 | 145 |
| 526 | 3300047471 | Ga0495684_0045684 | Ga0495684_0045684_1986_2423 | 145 |
| 527 | 3300047471 | Ga0495684_0241459 | Ga0495684_0241459_793_1230 | 145 |
| 528 | 3300047471 | Ga0495684_0386998 | Ga0495684_0386998_422_859 | 145 |
| 529 | 3300047673 | Ga0495593_0015854 | Ga0495593_0015854_413_850 | 145 |
| 530 | 3300047673 | Ga0495593_0030374 | Ga0495593_0030374_1891_2328 | 145 |
| 531 | 3300047673 | Ga0495593_0032696 | Ga0495593_0032696_1311_1748 | 145 |
| 532 | 3300048088 | Ga0495602_0010500 | Ga0495602_0010500_3844_4281 | 145 |
| 533 | 3300048089 | Ga0495614_0062147 | Ga0495614_0062147_1041_1478 | 145 |
| 534 | 3300048090 | Ga0495615_0145978 | Ga0495615_0145978_237_674 | 145 |
| 535 | 3300048905 | Ga0496102_0917145 | Ga0496102_0917145_328_765 | 145 |
| 536 | 3300048905 | Ga0496102_1043177 | Ga0496102_1043177_257_694 | 145 |
| 537 | 3300048907 | Ga0496104_0024135 | Ga0496104_0024135_2554_2991 | 145 |
| 538 | 3300048907 | Ga0496104_0053401 | Ga0496104_0053401_1451_1888 | 145 |
| 539 | 3300048908 | Ga0496105_0101024 | Ga0496105_0101024_666_1103 | 145 |
| 540 | 3300048908 | Ga0496105_0491339 | Ga0496105_0491339_438_875 | 145 |
| 541 | 3300048911 | Ga0496108_0224829 | Ga0496108_0224829_692_1129 | 145 |
| 542 | 3300048912 | Ga0496109_0050071 | Ga0496109_0050071_1413_1850 | 145 |
| 543 | 3300048912 | Ga0496109_0359865 | Ga0496109_0359865_421_858 | 145 |
| 544 | 3300048912 | Ga0496109_0988760 | Ga0496109_0988760_187_624 | 145 |
| 545 | 3300048913 | Ga0496110_0877540 | Ga0496110_0877540_44_484 | 145 |
| 546 | 3300048913 | Ga0496110_0895654 | Ga0496110_0895654_17_454 | 145 |
| 547 | 3300048913 | Ga0496110_1014122 | Ga0496110_1014122_247_684 | 145 |
| 548 | 3300048915 | Ga0496112_0033592 | Ga0496112_0033592_3723_4160 | 145 |
| 549 | 3300048915 | Ga0496112_0291937 | Ga0496112_0291937_233_670 | 145 |
| 550 | 3300048915 | Ga0496112_0487143 | Ga0496112_0487143_624_1064 | 145 |
| 551 | 3300048916 | Ga0496113_0583455 | Ga0496113_0583455_194_631 | 145 |
| 552 | 3300048917 | Ga0496114_0546219 | Ga0496114_0546219_25_462 | 145 |
| 553 | 3300048918 | Ga0496115_0101256 | Ga0496115_0101256_290_736 | 145 |
| 554 | 3300048918 | Ga0496115_0215529 | Ga0496115_0215529_809_1246 | 145 |
| 555 | 3300048924 | Ga0496121_0851621 | Ga0496121_0851621_59_499 | 145 |
| 556 | 3300049568 | Ga0501031_0031022 | Ga0501031_0031022_1555_1992 | 145 |
| 557 | 3300049569 | Ga0501032_0059539 | Ga0501032_0059539_452_889 | 145 |
| 558 | 3300049569 | Ga0501032_0062470 | Ga0501032_0062470_1332_1772 | 145 |
| 559 | 3300049570 | Ga0501033_0040248 | Ga0501033_0040248_937_1377 | 145 |
| 560 | 3300049570 | Ga0501033_0070880 | Ga0501033_0070880_1005_1442 | 145 |
| 561 | 3300049570 | Ga0501033_0570069 | Ga0501033_0570069_293_730 | 145 |
| 562 | 3300049571 | Ga0501034_0013154 | Ga0501034_0013154_2048_2488 | 145 |
| 563 | 3300049571 | Ga0501034_0146830 | Ga0501034_0146830_1211_1648 | 145 |
| 564 | 3300049571 | Ga0501034_0294414 | Ga0501034_0294414_689_1126 | 145 |
| 565 | 3300049572 | Ga0501036_0044592 | Ga0501036_0044592_2596_3036 | 145 |
| 566 | 3300049572 | Ga0501036_0113731 | Ga0501036_0113731_319_756 | 145 |
| 567 | 3300049572 | Ga0501036_0114984 | Ga0501036_0114984_897_1334 | 145 |
| 568 | 3300049573 | Ga0501037_0042004 | Ga0501037_0042004_809_1249 | 145 |
| 569 | 3300049573 | Ga0501037_0060221 | Ga0501037_0060221_1003_1440 | 145 |
| 570 | 3300049574 | Ga0501038_0011644 | Ga0501038_0011644_1344_1784 | 145 |
| 571 | 3300049574 | Ga0501038_0069318 | Ga0501038_0069318_1369_1806 | 145 |
| 572 | 3300049575 | Ga0501039_0041347 | Ga0501039_0041347_2700_3137 | 145 |
| 573 | 3300049575 | Ga0501039_0159357 | Ga0501039_0159357_748_1188 | 145 |
| 574 | 3300049579 | Ga0501043_0071642 | Ga0501043_0071642_1023_1463 | 145 |
| 575 | 3300049579 | Ga0501043_0566252 | Ga0501043_0566252_275_712 | 145 |
| 576 | 3300049580 | Ga0501046_0007517 | Ga0501046_0007517_1592_2032 | 145 |
| 577 | 3300049581 | Ga0501047_0017331 | Ga0501047_0017331_419_859 | 145 |
| 578 | 3300049581 | Ga0501047_0034032 | Ga0501047_0034032_908_1345 | 145 |
| 579 | 3300049581 | Ga0501047_0309758 | Ga0501047_0309758_736_1173 | 145 |
| 580 | 3300049582 | Ga0501048_0069544 | Ga0501048_0069544_1606_2046 | 145 |
| 581 | 3300049582 | Ga0501048_0954238 | Ga0501048_0954238_36_473 | 145 |
| 582 | 3300049584 | Ga0501068_0148428 | Ga0501068_0148428_830_1270 | 145 |
| 583 | 3300049585 | Ga0501069_0004867 | Ga0501069_0004867_6438_6878 | 145 |
| 584 | 3300049586 | Ga0501070_0081637 | Ga0501070_0081637_99_539 | 145 |
| 585 | 3300049586 | Ga0501070_0180298 | Ga0501070_0180298_473_910 | 145 |
| 586 | 3300049586 | Ga0501070_1013826 | Ga0501070_1013826_125_562 | 145 |
| 587 | 3300049587 | Ga0501071_0087604 | Ga0501071_0087604_1405_1845 | 145 |
| 588 | 3300049587 | Ga0501071_0385727 | Ga0501071_0385727_470_907 | 145 |
| 589 | 3300049587 | Ga0501071_0774074 | Ga0501071_0774074_50_487 | 145 |
| 590 | 3300049589 | Ga0501073_0005794 | Ga0501073_0005794_7102_7542 | 145 |
| 591 | 3300049590 | Ga0501074_0009242 | Ga0501074_0009242_5002_5442 | 145 |
| 592 | 3300049591 | Ga0501075_1313344 | Ga0501075_1313344_49_486 | 145 |
| 593 | 3300049592 | Ga0501076_0100058 | Ga0501076_0100058_825_1265 | 145 |
| 594 | 3300049593 | Ga0501077_0685708 | Ga0501077_0685708_182_622 | 145 |
| 595 | 3300049741 | Ga0501079_0011312 | Ga0501079_0011312_4721_5161 | 145 |
| 596 | 3300049742 | Ga0501080_0006188 | Ga0501080_0006188_2776_3216 | 145 |
| 597 | 3300049743 | Ga0501081_0904448 | Ga0501081_0904448_169_606 | 145 |
| 598 | 3300049822 | Ga0501035_0016634 | Ga0501035_0016634_5460_5897 | 145 |
| 599 | 3300049823 | Ga0501044_0057344 | Ga0501044_0057344_1764_2201 | 145 |
| 600 | 3300049823 | Ga0501044_0059044 | Ga0501044_0059044_563_1000 | 145 |
| 601 | 3300049823 | Ga0501044_0164521 | Ga0501044_0164521_1051_1491 | 145 |
| 602 | 3300049823 | Ga0501044_0355563 | Ga0501044_0355563_419_859 | 145 |
| 603 | 3300049823 | Ga0501044_0606519 | Ga0501044_0606519_210_647 | 145 |
| 604 | 3300049824 | Ga0501045_0018386 | Ga0501045_0018386_3570_4010 | 145 |
| 605 | 3300050489 | nmdc:mga03683_380645_c1 | nmdc:mga03683_380645_c1_142_582 | 145 |
| 606 | 3300050489 | nmdc:mga03683_508270_c1 | nmdc:mga03683_508270_c1_51_488 | 145 |
| 607 | 3300050490 | nmdc:mga03n38_139062_c1 | nmdc:mga03n38_139062_c1_424_864 | 145 |
| 608 | 3300050492 | nmdc:mga0yw44_137591_c1 | nmdc:mga0yw44_137591_c1_1006_1443 | 145 |
| 609 | 3300050507 | nmdc:mga05p37_13288_c1 | nmdc:mga05p37_13288_c1_3966_4403 | 145 |
| 610 | 3300050507 | nmdc:mga05p37_1461_c1 | nmdc:mga05p37_1461_c1_17884_18321 | 145 |
| 611 | 3300050507 | nmdc:mga05p37_168622_c1 | nmdc:mga05p37_168622_c1_2036_2506 | 145 |
| 612 | 3300050507 | nmdc:mga05p37_2463_c1 | nmdc:mga05p37_2463_c1_14149_14586 | 145 |
| 613 | 3300050507 | nmdc:mga05p37_941134_c1 | nmdc:mga05p37_941134_c1_428_865 | 145 |
| 614 | 3300050508 | nmdc:mga09592_50692_c1 | nmdc:mga09592_50692_c1_298_768 | 145 |
| 615 | 3300050508 | nmdc:mga09592_7282_c1 | nmdc:mga09592_7282_c1_8147_8584 | 145 |
| 616 | 3300050508 | nmdc:mga09592_8553_c1 | nmdc:mga09592_8553_c1_4812_5249 | 145 |
| 617 | 3300050509 | nmdc:mga0qj67_16649_c1 | nmdc:mga0qj67_16649_c1_3663_4100 | 145 |
| 618 | 3300050509 | nmdc:mga0qj67_9055_c1 | nmdc:mga0qj67_9055_c1_5017_5454 | 145 |
| 619 | 3300050510 | nmdc:mga06r32_2531_c1 | nmdc:mga06r32_2531_c1_7976_8413 | 145 |
| 620 | 3300050510 | nmdc:mga06r32_724_c1 | nmdc:mga06r32_724_c1_17890_18327 | 145 |
| 621 | 3300050511 | nmdc:mga08y16_2434_c1 | nmdc:mga08y16_2434_c1_17901_18338 | 145 |
| 622 | 3300050511 | nmdc:mga08y16_709843_c1 | nmdc:mga08y16_709843_c1_369_815 | 145 |
| 623 | 3300050512 | nmdc:mga0n895_59194_c1 | nmdc:mga0n895_59194_c1_1791_2228 | 145 |
| 624 | 3300050512 | nmdc:mga0n895_608225_c1 | nmdc:mga0n895_608225_c1_516_953 | 145 |
| 625 | 3300050513 | nmdc:mga0rr50_10240_c1 | nmdc:mga0rr50_10240_c1_594_1031 | 145 |
| 626 | 3300050513 | nmdc:mga0rr50_1332_c1 | nmdc:mga0rr50_1332_c1_946_1383 | 145 |
| 627 | 3300050513 | nmdc:mga0rr50_221725_c1 | nmdc:mga0rr50_221725_c1_933_1370 | 145 |
| 628 | 3300050514 | nmdc:mga08x19_633803_c1 | nmdc:mga08x19_633803_c1_281_718 | 145 |
| 629 | 3300050515 | nmdc:mga0a205_2168_c1 | nmdc:mga0a205_2168_c1_11682_12119 | 145 |
| 630 | 3300050515 | nmdc:mga0a205_30759_c1 | nmdc:mga0a205_30759_c1_4567_5004 | 145 |
| 631 | 3300050515 | nmdc:mga0a205_71456_c1 | nmdc:mga0a205_71456_c1_2762_3199 | 145 |
| 632 | 3300053077 | Ga0495601_0000788 | Ga0495601_0000788_11475_11912 | 145 |
| 633 | 3300053077 | Ga0495601_0000993 | Ga0495601_0000993_10862_11299 | 145 |
| 634 | 3300053077 | Ga0495601_0063962 | Ga0495601_0063962_1185_1622 | 145 |
| 635 | 3300053078 | Ga0495612_0002372 | Ga0495612_0002372_924_1361 | 145 |
| 636 | 3300053078 | Ga0495612_0004290 | Ga0495612_0004290_3724_4161 | 145 |
| 637 | 3300053078 | Ga0495612_0257587 | Ga0495612_0257587_70_507 | 145 |
| 638 | 3300053084 | Ga0495595_0001232 | Ga0495595_0001232_4303_4740 | 145 |
| 639 | 3300053084 | Ga0495595_0002216 | Ga0495595_0002216_388_825 | 145 |
| 640 | 3300053084 | Ga0495595_0064703 | Ga0495595_0064703_991_1428 | 145 |
| 641 | 3300053085 | Ga0495619_0013867 | Ga0495619_0013867_2640_3077 | 145 |
| 642 | 3300053085 | Ga0495619_0017925 | Ga0495619_0017925_2440_2877 | 145 |
| 643 | 3300053085 | Ga0495619_0091584 | Ga0495619_0091584_1326_1763 | 145 |
| 644 | 3300053085 | Ga0495619_0106586 | Ga0495619_0106586_454_891 | 145 |
| 645 | 3300053085 | Ga0495619_0266395 | Ga0495619_0266395_228_665 | 145 |
| 646 | 3300053094 | Ga0500566_0115858 | Ga0500566_0115858_60_497 | 145 |
| 647 | 3300053096 | Ga0500641_0134010 | Ga0500641_0134010_354_791 | 145 |
| 648 | 3300053096 | Ga0500641_0205451 | Ga0500641_0205451_362_799 | 145 |
| 649 | 3300053104 | Ga0500556_0081920 | Ga0500556_0081920_209_649 | 145 |
| 650 | 3300053131 | Ga0500652_024985 | Ga0500652_024985_1735_2175 | 145 |
| 651 | 3300053134 | Ga0500658_0090420 | Ga0500658_0090420_531_968 | 145 |
| 652 | 3300053146 | Ga0500588_0084819 | Ga0500588_0084819_612_1049 | 145 |
| 653 | 3300053153 | Ga0500616_0009163 | Ga0500616_0009163_4137_4574 | 145 |
| 654 | 3300053153 | Ga0500616_0062803 | Ga0500616_0062803_586_1107 | 145 |
| 655 | 3300053155 | Ga0500620_204835 | Ga0500620_204835_159_599 | 145 |
| 656 | 3300053158 | Ga0500627_0106149 | Ga0500627_0106149_438_875 | 145 |
| 657 | 3300053728 | Ga0500657_218971 | Ga0500657_218971_33_470 | 145 |
| 658 | 3300060353 | Ga0501082_0017828 | Ga0501082_0017828_323_763 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6unp-assembly1.cif.gz_A | crystal structure of the kinase domain of bmpr2-d485g | 0.7685 | 70 | 91 |
| 6unp-assembly2.cif.gz_B | crystal structure of the kinase domain of bmpr2-d485g | 0.745 | 70 | 91 |
| 7aw3-assembly1.cif.gz_A | mertk kinase domain with type 1 inhibitor from a dna-encoded library | 0.7301 | 70 | 91 |
| 7ab2-assembly1.cif.gz_A | crystal structure of mertk kinase domain in complex with unc2025 | 0.7301 | 70 | 91 |
| 3g2f-assembly2.cif.gz_B | crystal structure of the kinase domain of bone morphogenetic protein receptor type ii (bmpr2) at 2.35 a resolution | 0.7276 | 70 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q59SK8_134_235_3.30.780.10 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain | 0.772 | 74 | 92 | 3.30.780.10 |
| af_Q4DA00_7_80_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7691 | 70 | 92 | 3.30.70.330 |
| af_H2KYF8_56_139_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7431 | 71 | 92 | 3.30.200.20 |
| af_B0V0H4_197_291_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7412 | 70 | 91 | 3.30.200.20 |
| af_I1KDW8_1_247_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.7376 | 70 | 91 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527A188-F1-model_v4 | DUF1489 family protein | 0.9907 | 1 | 121 |
|
| AF-A0A1Q7BFD3-F1-model_v4 | Lysophospholipase | 0.9897 | 1 | 145 |
|
| AF-A0A537N8T8-F1-model_v4 | DUF1489 family protein | 0.9861 | 1 | 145 |
|
| AF-A0A527VSX3-F1-model_v4 | DUF1489 family protein | 0.9791 | 1 | 70 |
|
| AF-A0A527A188-F1-model_v4 | DUF1489 family protein | 0.9747 | 1 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar