F473100

General Info

Members Datasets Scaffolds Average Seq Length
657 227 1314 256

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10004867|Ga0207684_100048673
Length 291
Sequence VFYSGGERSVESRDSMPPTTQQTATTIFYRNIRWLKFVDRLGKKGAGILEYMGGIGTMVIQTAHAAVTRPFYGSQVLAQMDELGVKSLSITGITAFSVGMVLALQTAYSLAAFGGKMFTGRVVAISLVRELGPVLTALMVGGRVGSGITAELGSMTVTEQVDALRSMAISPIRRLVLPRVLAVVIMLPILTAIADVLGIIGGLLIAVTELGITPQDYLNSIWNYLAIQDITSGIAKTFFFGLEVALFGCYNGLQVEGGATSVGQATTRTVVFASISILISDFFLTKLFLAI

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.59
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10004867 3300025910 Bacteria 12559
2 rootH1_10151800 3300003323 Bacteria 3794
3 Ga0065707_10009275 3300005295 Bacteria 2289
4 Ga0065707_10151908 3300005295 Bacteria 1649
5 Ga0065707_10276294 3300005295 Bacteria 1059
6 Ga0070658_10030152 3300005327 Bacteria 4359
7 Ga0070658_10334853 3300005327 Bacteria 1294
8 Ga0070676_10004718 3300005328 Bacteria 7207
9 Ga0070676_10022882 3300005328 Bacteria 3508
10 Ga0070690_100010773 3300005330 Bacteria 5332
11 Ga0070690_100326095 3300005330 Unclassified 1108
12 Ga0070670_100018757 3300005331 Bacteria 5932
13 Ga0070670_100269116 3300005331 Bacteria 1486
14 Ga0070677_10005091 3300005333 Bacteria 4318
15 Ga0068869_100083841 3300005334 Bacteria 2385
16 Ga0070666_10000280 3300005335 Bacteria 33790
17 Ga0070666_10001119 3300005335 Bacteria 16328
18 Ga0070666_10021487 3300005335 Bacteria 4184
19 Ga0070666_10109301 3300005335 Bacteria 1911
20 Ga0068868_100004592 3300005338 Bacteria 9693
21 Ga0068868_100192873 3300005338 Bacteria 1695
22 Ga0070689_100136638 3300005340 Bacteria 1969
23 Ga0070661_100058464 3300005344 Bacteria 2825
24 Ga0070692_10013488 3300005345 Bacteria 3811
25 Ga0070668_100112281 3300005347 Bacteria 2170
26 Ga0070669_100000067 3300005353 Bacteria 104253
27 Ga0070669_100046382 3300005353 Bacteria 3169
28 Ga0070669_100394983 3300005353 Bacteria 1130
29 Ga0070675_100002914 3300005354 Bacteria 12900
30 Ga0070675_100016893 3300005354 Bacteria 5795
31 Ga0070674_100003909 3300005356 Bacteria 8437
32 Ga0070673_100275144 3300005364 Bacteria 1475
33 Ga0070673_100421776 3300005364 Bacteria 1196
34 Ga0070688_100027161 3300005365 Bacteria 3408
35 Ga0070667_100002369 3300005367 Bacteria 16507
36 Ga0070667_100072409 3300005367 Bacteria 2937
37 Ga0070667_100104351 3300005367 Bacteria 2452
38 Ga0070709_10000061 3300005434 Bacteria 83673
39 Ga0070709_10000188 3300005434 Bacteria 39098
40 Ga0070710_10148530 3300005437 Bacteria 1444
41 Ga0070701_10103679 3300005438 Bacteria 1579
42 Ga0070711_100130040 3300005439 Bacteria 1874
43 Ga0070705_100021357 3300005440 Bacteria 3443
44 Ga0070705_100052202 3300005440 Bacteria 2388
45 Ga0070705_100201897 3300005440 Bacteria 1364
46 Ga0070700_100251462 3300005441 Bacteria 1268
47 Ga0070708_100005913 3300005445 Bacteria 9723
48 Ga0070708_100111503 3300005445 Bacteria 2515
49 Ga0070708_100186276 3300005445 Bacteria 1941
50 Ga0070708_100251707 3300005445 Bacteria 1659
51 Ga0070708_100253921 3300005445 Bacteria 1652
52 Ga0070708_100328566 3300005445 Bacteria 1441
53 Ga0070708_100353427 3300005445 Bacteria 1385
54 Ga0070708_100605856 3300005445 Bacteria 1033
55 Ga0070708_100763678 3300005445 Bacteria 909
56 Ga0070678_100022905 3300005456 Bacteria 4151
57 Ga0070678_100026481 3300005456 Bacteria 3921
58 Ga0068867_100002678 3300005459 Bacteria 12565
59 Ga0070685_10006671 3300005466 Bacteria 5894
60 Ga0070685_10417634 3300005466 Bacteria 933
61 Ga0070706_100000695 3300005467 Bacteria 38132
62 Ga0070706_100001793 3300005467 Bacteria 22237
63 Ga0070706_100009584 3300005467 Bacteria 9006
64 Ga0070706_100040209 3300005467 Bacteria 4316
65 Ga0070706_100108132 3300005467 Unclassified 2587
66 Ga0070706_100174677 3300005467 Bacteria 2006
67 Ga0070706_100207906 3300005467 Bacteria 1827
68 Ga0070707_100001621 3300005468 Bacteria 21819
69 Ga0070707_100119218 3300005468 Bacteria 2561
70 Ga0070707_100144417 3300005468 Bacteria 2316
71 Ga0070707_100475616 3300005468 Bacteria 1211
72 Ga0070698_100000039 3300005471 Bacteria 91348
73 Ga0070698_100009834 3300005471 Bacteria 10222
74 Ga0070698_100045109 3300005471 Bacteria 4512
75 Ga0070698_100127769 3300005471 Bacteria 2499
76 Ga0070698_100440554 3300005471 Bacteria 1238
77 Ga0070699_100000001 3300005518 Bacteria 910751
78 Ga0070699_100000487 3300005518 Bacteria 37722
79 Ga0070699_100001436 3300005518 Bacteria 21885
80 Ga0070699_100077225 3300005518 Bacteria 2899
81 Ga0070699_100309026 3300005518 Bacteria 1419
82 Ga0070699_100375385 3300005518 Bacteria 1283
83 Ga0070699_100412263 3300005518 Bacteria 1222
84 Ga0070697_100001957 3300005536 Bacteria 15775
85 Ga0070697_100004765 3300005536 Bacteria 10397
86 Ga0070697_100050257 3300005536 Bacteria 3384
87 Ga0070697_100059657 3300005536 Bacteria 3107
88 Ga0070697_100110725 3300005536 Bacteria 2288
89 Ga0070697_100148370 3300005536 Bacteria 1976
90 Ga0070697_100208302 3300005536 Bacteria 1664
91 Ga0070697_100263452 3300005536 Bacteria 1476
92 Ga0070672_100006171 3300005543 Bacteria 8021
93 Ga0070672_100009561 3300005543 Bacteria 6690
94 Ga0070672_100048438 3300005543 Bacteria 3302
95 Ga0070672_100245420 3300005543 Bacteria 1507
96 Ga0070695_100159070 3300005545 Bacteria 1584
97 Ga0070695_100416807 3300005545 Unclassified 1022
98 Ga0070665_100000192 3300005548 Bacteria 108722
99 Ga0070665_100005709 3300005548 Bacteria 12777
100 Ga0070665_100042241 3300005548 Bacteria 4583
101 Ga0070704_100018735 3300005549 Bacteria 4434
102 Ga0070704_100077805 3300005549 Bacteria 2431
103 Ga0070704_100149051 3300005549 Bacteria 1837
104 Ga0070704_100317455 3300005549 Bacteria 1304
105 Ga0070664_100009024 3300005564 Bacteria 8089
106 Ga0070664_100029797 3300005564 Bacteria 4551
107 Ga0068856_100005623 3300005614 Bacteria 12332
108 Ga0070702_100019049 3300005615 Bacteria 3571
109 Ga0068859_100000011 3300005617 Bacteria 309687
110 Ga0068859_100031529 3300005617 Bacteria 5323
111 Ga0068859_100087740 3300005617 Bacteria 3159
112 Ga0068859_100365914 3300005617 Bacteria 1537
113 Ga0068859_100401798 3300005617 Bacteria 1466
114 Ga0068864_100004914 3300005618 Bacteria 10949
115 Ga0068864_100118245 3300005618 Bacteria 2367
116 Ga0068866_10008283 3300005718 Bacteria 4375
117 Ga0068863_100015039 3300005841 Bacteria 7435
118 Ga0068863_100044719 3300005841 Bacteria 4202
119 Ga0068863_100085759 3300005841 Bacteria 2983
120 Ga0068858_100000696 3300005842 Bacteria 35129
121 Ga0068858_100029375 3300005842 Bacteria 5104
122 Ga0068858_100135556 3300005842 Bacteria 2310
123 Ga0068858_100153908 3300005842 Unclassified 2163
124 Ga0068860_100001744 3300005843 Bacteria 23192
125 Ga0068860_100037879 3300005843 Bacteria 4615
126 Ga0068860_100041504 3300005843 Bacteria 4394
127 Ga0068860_100042864 3300005843 Bacteria 4318
128 Ga0068860_100414861 3300005843 Unclassified 1334
129 Ga0068862_100003946 3300005844 Bacteria 12611
130 Ga0068862_100109481 3300005844 Bacteria 2423
131 Ga0068862_100156142 3300005844 Bacteria 2034
132 Ga0081455_10054893 3300005937 Bacteria 3392
133 Ga0081455_10106497 3300005937 Bacteria 2237
134 Ga0081540_1063724 3300005983 Bacteria 1743
135 Ga0081539_10000069 3300005985 Bacteria 236854
136 Ga0081539_10012083 3300005985 Bacteria 6710
137 Ga0081539_10089988 3300005985 Bacteria 1588
138 Ga0075432_10124832 3300006058 Bacteria 970
139 Ga0070715_10039185 3300006163 Bacteria 1972
140 Ga0070716_100004444 3300006173 Bacteria 6704
141 Ga0070716_100029845 3300006173 Bacteria 2953
142 Ga0070716_100055209 3300006173 Bacteria 2272
143 Ga0070716_100058039 3300006173 Bacteria 2226
144 Ga0070712_100188782 3300006175 Bacteria 1611
145 Ga0070712_100510981 3300006175 Bacteria 1008
146 Ga0097621_100030848 3300006237 Bacteria 4247
147 Ga0097621_100053386 3300006237 Bacteria 3295
148 Ga0068871_100048937 3300006358 Bacteria 3414
149 Ga0068871_100112804 3300006358 Bacteria 2288
150 Ga0075428_100003389 3300006844 Bacteria 17427
151 Ga0075428_100024055 3300006844 Bacteria 6742
152 Ga0075428_100054477 3300006844 Bacteria 4383
153 Ga0075428_100346784 3300006844 Bacteria 1594
154 Ga0075430_100155640 3300006846 Bacteria 1903
155 Ga0075431_100006312 3300006847 Bacteria 11776
156 Ga0075431_100040527 3300006847 Bacteria 4800
157 Ga0075431_100040902 3300006847 Bacteria 4779
158 Ga0075431_100136854 3300006847 Bacteria 2525
159 Ga0075431_100141324 3300006847 Unclassified 2481
160 Ga0075431_100319918 3300006847 Bacteria 1565
161 Ga0075433_10000635 3300006852 Bacteria 23492
162 Ga0075433_10001574 3300006852 Bacteria 16891
163 Ga0075433_10006071 3300006852 Bacteria 9520
164 Ga0075433_10009002 3300006852 Bacteria 7971
165 Ga0075433_10011625 3300006852 Bacteria 7090
166 Ga0075433_10021047 3300006852 Bacteria 5464
167 Ga0075433_10058731 3300006852 Bacteria 3365
168 Ga0075433_10064484 3300006852 Bacteria 3211
169 Ga0075433_10087136 3300006852 Bacteria 2757
170 Ga0075433_10105082 3300006852 Bacteria 2502
171 Ga0075433_10156734 3300006852 Bacteria 2026
172 Ga0075433_10198091 3300006852 Bacteria 1786
173 Ga0075433_10214395 3300006852 Bacteria 1711
174 Ga0075434_100000231 3300006871 Bacteria 38474
175 Ga0075434_100007808 3300006871 Bacteria 9910
176 Ga0075434_100011373 3300006871 Bacteria 8393
177 Ga0075434_100011826 3300006871 Bacteria 8247
178 Ga0075434_100033216 3300006871 Bacteria 5091
179 Ga0075434_100045959 3300006871 Bacteria 4333
180 Ga0075434_100069633 3300006871 Unclassified 3508
181 Ga0075434_100080717 3300006871 Bacteria 3250
182 Ga0075434_100320816 3300006871 Bacteria 1570
183 Ga0075434_100334462 3300006871 Bacteria 1535
184 Ga0075434_100414367 3300006871 Bacteria 1368
185 Ga0075434_100515701 3300006871 Bacteria 1216
186 Ga0075434_100570879 3300006871 Unclassified 1151
187 Ga0075429_100003245 3300006880 Bacteria 13844
188 Ga0075429_100003386 3300006880 Bacteria 13594
189 Ga0075429_100017506 3300006880 Bacteria 6196
190 Ga0075429_100064709 3300006880 Bacteria 3185
191 Ga0075429_100090931 3300006880 Bacteria 2662
192 Ga0075429_100095909 3300006880 Bacteria 2587
193 Ga0075429_100753932 3300006880 Bacteria 853
194 Ga0075436_100002298 3300006914 Bacteria 13187
195 Ga0075436_100003283 3300006914 Bacteria 11073
196 Ga0075436_100010775 3300006914 Bacteria 6271
197 Ga0075436_100045766 3300006914 Bacteria 3018
198 Ga0075436_100090388 3300006914 Bacteria 2128
199 Ga0075436_100114495 3300006914 Bacteria 1883
200 Ga0097620_100000011 3300006931 Bacteria 309687
201 Ga0097620_100031529 3300006931 Bacteria 5323
202 Ga0097620_100087731 3300006931 Bacteria 3159
203 Ga0097620_100365945 3300006931 Bacteria 1537
204 Ga0097620_100401838 3300006931 Bacteria 1466
205 Ga0075435_100002183 3300007076 Bacteria 12914
206 Ga0075435_100020268 3300007076 Bacteria 5091
207 Ga0075435_100022879 3300007076 Bacteria 4825
208 Ga0075435_100032963 3300007076 Unclassified 4093
209 Ga0075435_100075766 3300007076 Bacteria 2756
210 Ga0075435_100181431 3300007076 Unclassified 1779
211 Ga0075435_100224616 3300007076 Bacteria 1595
212 Ga0099794_10002270 3300007265 Bacteria 7057
213 Ga0111539_10056326 3300009094 Bacteria 4672
214 Ga0111539_10110067 3300009094 Bacteria 3232
215 Ga0111539_10128580 3300009094 Bacteria 2967
216 Ga0111539_10886708 3300009094 Bacteria 1038
217 Ga0105245_10053841 3300009098 Bacteria 3613
218 Ga0105245_10074684 3300009098 Bacteria 3085
219 Ga0114129_10000480 3300009147 Bacteria 48275
220 Ga0114129_10000481 3300009147 Bacteria 48108
221 Ga0114129_10001262 3300009147 Bacteria 33771
222 Ga0114129_10003062 3300009147 Bacteria 23443
223 Ga0114129_10005162 3300009147 Bacteria 18375
224 Ga0114129_10006637 3300009147 Bacteria 16431
225 Ga0114129_10011313 3300009147 Bacteria 12713
226 Ga0114129_10024047 3300009147 Bacteria 8633
227 Ga0114129_10025268 3300009147 Bacteria 8416
228 Ga0114129_10031674 3300009147 Bacteria 7475
229 Ga0114129_10039241 3300009147 Bacteria 6675
230 Ga0114129_10141430 3300009147 Bacteria 3298
231 Ga0114129_10300334 3300009147 Bacteria 2140
232 Ga0114129_10334787 3300009147 Bacteria 2009
233 Ga0114129_10392016 3300009147 Bacteria 1831
234 Ga0114129_10547196 3300009147 Bacteria 1506
235 Ga0114129_10631846 3300009147 Bacteria 1384
236 Ga0114129_10775099 3300009147 Bacteria 1226
237 Ga0105243_10671561 3300009148 Bacteria 1006
238 Ga0105248_10000542 3300009177 Bacteria 43053
239 Ga0105248_10060397 3300009177 Bacteria 4255
240 Ga0105249_10026901 3300009553 Bacteria 5187
241 Ga0105249_10051320 3300009553 Bacteria 3762
242 Ga0105249_10258946 3300009553 Bacteria 1728
243 Ga0105249_10303578 3300009553 Bacteria 1602
244 Ga0105249_10432737 3300009553 Bacteria 1352
245 Ga0157374_10005043 3300013296 Bacteria 11075
246 Ga0157378_10029667 3300013297 Bacteria 4830
247 Ga0157378_10128484 3300013297 Bacteria 2343
248 Ga0163162_10070000 3300013306 Bacteria 3560
249 Ga0163162_10118778 3300013306 Bacteria 2746
250 Ga0163162_10808300 3300013306 Bacteria 1055
251 Ga0157375_10000977 3300013308 Bacteria 24754
252 Ga0157375_10052639 3300013308 Bacteria 4003
253 Ga0157375_10077281 3300013308 Bacteria 3358
254 Ga0157375_10114176 3300013308 Bacteria 2802
255 Ga0157375_10204167 3300013308 Bacteria 2132
256 Ga0163163_10038227 3300014325 Bacteria 4676
257 Ga0163163_10053332 3300014325 Bacteria 3991
258 Ga0163163_10391352 3300014325 Bacteria 1448
259 Ga0157380_10013063 3300014326 Bacteria 6042
260 Ga0157380_10182138 3300014326 Bacteria 1847
261 Ga0157377_10186817 3300014745 Bacteria 1307
262 Ga0157379_10002140 3300014968 Bacteria 16387
263 Ga0157379_10439569 3300014968 Bacteria 1203
264 Ga0157376_10004116 3300014969 Bacteria 10075
265 Ga0157376_10030301 3300014969 Bacteria 4319
266 Ga0157376_10670686 3300014969 Bacteria 1039
267 Ga0228598_1004429 3300024227 Bacteria 2975
268 Ga0207697_10010731 3300025315 Bacteria 3904
269 Ga0207682_10003551 3300025893 Bacteria 6745
270 Ga0207692_10099129 3300025898 Bacteria 1596
271 Ga0207642_10027039 3300025899 Bacteria 2344
272 Ga0207710_10097927 3300025900 Bacteria 1380
273 Ga0207688_10085441 3300025901 Bacteria 1807
274 Ga0207680_10000698 3300025903 Bacteria 15773
275 Ga0207680_10001569 3300025903 Bacteria 10777
276 Ga0207680_10092585 3300025903 Bacteria 1926
277 Ga0207680_10116773 3300025903 Bacteria 1739
278 Ga0207680_10187028 3300025903 Bacteria 1404
279 Ga0207699_10000061 3300025906 Bacteria 89493
280 Ga0207699_10000173 3300025906 Bacteria 39126
281 Ga0207645_10026035 3300025907 Bacteria 3782
282 Ga0207643_10001965 3300025908 Bacteria 11342
283 Ga0207684_10000422 3300025910 Bacteria 56225
284 Ga0207684_10000457 3300025910 Bacteria 53335
285 Ga0207684_10005654 3300025910 Bacteria 11485
286 Ga0207684_10280362 3300025910 Unclassified 1437
287 Ga0207663_10049184 3300025916 Bacteria 2614
288 Ga0207649_10017363 3300025920 Bacteria 4078
289 Ga0207646_10003551 3300025922 Bacteria 17516
290 Ga0207646_10008658 3300025922 Bacteria 10159
291 Ga0207646_10025277 3300025922 Bacteria 5433
292 Ga0207646_10205896 3300025922 Bacteria 1777
293 Ga0207681_10000018 3300025923 Bacteria 278874
294 Ga0207681_10053238 3300025923 Bacteria 2748
295 Ga0207650_10026582 3300025925 Bacteria 4130
296 Ga0207659_10028207 3300025926 Bacteria 3812
297 Ga0207659_10083398 3300025926 Bacteria 2369
298 Ga0207700_10152642 3300025928 Bacteria 1910
299 Ga0207644_10068829 3300025931 Bacteria 2583
300 Ga0207706_10563706 3300025933 Unclassified 980
301 Ga0207709_10245213 3300025935 Bacteria 1305
302 Ga0207670_10170945 3300025936 Bacteria 1630
303 Ga0207665_10030787 3300025939 Bacteria 3548
304 Ga0207665_10030895 3300025939 Bacteria 3542
305 Ga0207665_10045308 3300025939 Bacteria 2945
306 Ga0207665_10149468 3300025939 Bacteria 1672
307 Ga0207665_10256428 3300025939 Unclassified 1294
308 Ga0207691_10000236 3300025940 Bacteria 53970
309 Ga0207691_10030887 3300025940 Bacteria 5002
310 Ga0207691_10051283 3300025940 Bacteria 3773
311 Ga0207711_10000463 3300025941 Bacteria 42240
312 Ga0207711_10107912 3300025941 Bacteria 2472
313 Ga0207711_10186038 3300025941 Bacteria 1891
314 Ga0207689_10014810 3300025942 Bacteria 6620
315 Ga0207689_10015205 3300025942 Bacteria 6518
316 Ga0207689_10461004 3300025942 Unclassified 1063
317 Ga0207679_10360672 3300025945 Bacteria 1269
318 Ga0207667_10201947 3300025949 Bacteria 2039
319 Ga0207651_10004483 3300025960 Bacteria 7045
320 Ga0207651_10206081 3300025960 Bacteria 1580
321 Ga0207712_10044866 3300025961 Bacteria 3058
322 Ga0207712_10057065 3300025961 Bacteria 2753
323 Ga0207712_10211081 3300025961 Bacteria 1546
324 Ga0207668_10287349 3300025972 Bacteria 1351
325 Ga0207658_10037902 3300025986 Bacteria 3468
326 Ga0207658_10062494 3300025986 Bacteria 2787
327 Ga0207658_10081654 3300025986 Bacteria 2480
328 Ga0207677_10009384 3300026023 Bacteria 5506
329 Ga0207703_10002265 3300026035 Bacteria 16817
330 Ga0207703_10088002 3300026035 Bacteria 2606
331 Ga0207703_10129945 3300026035 Unclassified 2174
332 Ga0207703_10232574 3300026035 Bacteria 1653
333 Ga0207678_10009963 3300026067 Bacteria 8338
334 Ga0207678_10039644 3300026067 Bacteria 4087
335 Ga0207708_10089114 3300026075 Bacteria 2377
336 Ga0207702_10007527 3300026078 Bacteria 9285
337 Ga0207641_10146658 3300026088 Bacteria 2134
338 Ga0207648_10009120 3300026089 Bacteria 9534
339 Ga0207648_10345434 3300026089 Bacteria 1341
340 Ga0207676_10053472 3300026095 Bacteria 3161
341 Ga0207676_10069766 3300026095 Bacteria 2815
342 Ga0207675_100008654 3300026118 Bacteria 9569
343 Ga0207675_100026392 3300026118 Bacteria 5407
344 Ga0207683_10005485 3300026121 Bacteria 10869
345 Ga0207683_10046165 3300026121 Bacteria 3811
346 Ga0210000_1002050 3300027462 Bacteria 2849
347 Ga0209995_1003044 3300027471 Bacteria 2660
348 Ga0209982_1015914 3300027552 Bacteria 1143
349 Ga0209970_1002078 3300027614 Bacteria 3438
350 Ga0210002_1005132 3300027617 Bacteria 1962
351 Ga0209971_1002070 3300027682 Bacteria 4886
352 Ga0209974_10000984 3300027876 Bacteria 10000
353 Ga0207428_10044025 3300027907 Bacteria 3602
354 Ga0207428_10194909 3300027907 Bacteria 1526
355 Ga0268266_10000298 3300028379 Bacteria 79989
356 Ga0268266_10010268 3300028379 Bacteria 8197
357 Ga0268266_10018541 3300028379 Bacteria 5931
358 Ga0268265_10001599 3300028380 Bacteria 18717
359 Ga0268265_10103601 3300028380 Bacteria 2304
360 Ga0268265_10172816 3300028380 Bacteria 1848
361 Ga0268265_10177983 3300028380 Bacteria 1825
362 Ga0268265_10183342 3300028380 Bacteria 1801
363 Ga0268264_10005948 3300028381 Bacteria 10323
364 Ga0268264_10009784 3300028381 Bacteria 7936
365 Ga0268264_10080567 3300028381 Bacteria 2780
366 Ga0268264_10148883 3300028381 Bacteria 2096
367 Ga0268264_10287953 3300028381 Bacteria 1542
368 Ga0268264_10384635 3300028381 Bacteria 1344
369 Ga0268264_10645512 3300028381 Bacteria 1047
370 Ga0307408_100008647 3300031548 Bacteria 6723
371 Ga0307508_10013230 3300031616 Bacteria 7550
372 Ga0265342_10065362 3300031712 Bacteria 2132
373 Ga0307410_10028940 3300031852 Bacteria 3521
374 Ga0307412_10110483 3300031911 Bacteria 1962
375 Ga0307409_100136065 3300031995 Bacteria 2109
376 Ga0307416_100009346 3300032002 Bacteria 6413
377 Ga0307411_10039141 3300032005 Bacteria 2997
378 Ga0316583_10063543 3300032133 Bacteria 1293
379 Ga0373948_0031993 3300034817 Unclassified 1065
380 Ga0373926_0059126 3300035083 Bacteria 1395
381 Ga0373929_0000012 3300035085 Bacteria 169316
382 Ga0373943_0177903 3300035170 Bacteria 1168
383 Ga0373955_0100006 3300035172 Bacteria 1663
384 Ga0373931_0030558 3300035691 Bacteria 2774
385 Ga0373935_0004442 3300035692 Bacteria 8233
386 Ga0373935_0184257 3300035692 Bacteria 1435
387 Ga0373937_0030783 3300036401 Bacteria 4861
388 Ga0373937_0034088 3300036401 Bacteria 4629
389 Ga0373937_0124693 3300036401 Bacteria 2402
390 Ga0373937_0972703 3300036401 Bacteria 797
391 Ga0373925_0009142 3300037068 Bacteria 7211
392 Ga0373925_0039376 3300037068 Bacteria 3497
393 Ga0395899_0020904 3300037312 Bacteria 4964
394 Ga0395900_0045416 3300037418 Bacteria 4525
395 Ga0395898_0010580 3300037466 Bacteria 9636
396 Ga0395901_0001137 3300038443 Bacteria 28208
397 Ga0395901_0373412 3300038443 Bacteria 1469
398 Ga0451793_0951705 3300041452 Bacteria 1044
399 Ga0451807_1052407 3300041486 Bacteria 989
400 Ga0451807_2162117 3300041486 Bacteria 2642
401 Ga0451577_0462485 3300042876 Bacteria 1152
402 Ga0451577_0481671 3300042876 Bacteria 1126
403 Ga0453683_0000574 3300044673 Bacteria 40638
404 Ga0453683_0098828 3300044673 Bacteria 1832
405 Ga0466963_0109396 3300044694 Bacteria 1896
406 Ga0453684_0137947 3300044712 Bacteria 2917
407 Ga0451576_0044738 3300045051 Bacteria 4664
408 Ga0466967_0200977 3300045976 Bacteria 1888
409 Ga0495629_0048854 3300046459 Bacteria 2966
410 Ga0495580_0000625 3300046472 Bacteria 29936
411 Ga0495580_0000901 3300046472 Bacteria 25876
412 Ga0495580_0003086 3300046472 Bacteria 14271
413 Ga0495580_0080129 3300046472 Bacteria 2277
414 Ga0495662_0046608 3300046476 Bacteria 2093
415 Ga0495662_0050074 3300046476 Bacteria 2016
416 Ga0495633_0061602 3300046558 Bacteria 1757
417 Ga0495656_0299666 3300046615 Bacteria 824
418 Ga0495657_0207285 3300046675 Unclassified 1192
419 Ga0495647_0023255 3300046681 Bacteria 2246
420 Ga0495647_0099155 3300046681 Bacteria 1204
421 Ga0495658_0013300 3300046683 Bacteria 4187
422 Ga0495670_0282607 3300046691 Bacteria 888
423 Ga0495636_0070618 3300047318 Bacteria 1490
424 Ga0495684_0013908 3300047471 Bacteria 6190
425 Ga0495684_0111972 3300047471 Bacteria 2059
426 Ga0495602_0133989 3300048088 Bacteria 1971
427 Ga0495602_0189033 3300048088 Bacteria 1581
428 Ga0496100_0018468 3300048903 Bacteria 4137
429 Ga0496101_0147863 3300048904 Bacteria 1795
430 Ga0496102_0001398 3300048905 Bacteria 21440
431 Ga0496102_0056079 3300048905 Bacteria 3594
432 Ga0496102_0187518 3300048905 Bacteria 1949
433 Ga0496104_0111526 3300048907 Bacteria 2622
434 Ga0496104_0332651 3300048907 Bacteria 1432
435 Ga0496106_0020482 3300048909 Bacteria 4908
436 Ga0496107_0006217 3300048910 Bacteria 8209
437 Ga0496109_0113719 3300048912 Bacteria 2518
438 Ga0496111_0068447 3300048914 Bacteria 2580
439 Ga0496111_0196542 3300048914 Bacteria 1499
440 Ga0496112_0722479 3300048915 Bacteria 923
441 Ga0496114_0000030 3300048917 Bacteria 168379
442 Ga0501031_0001590 3300049568 Bacteria 14167
443 Ga0501031_0207967 3300049568 Bacteria 1276
444 Ga0501033_0082570 3300049570 Bacteria 2356
445 Ga0501036_0001538 3300049572 Bacteria 17824
446 Ga0501036_0155572 3300049572 Bacteria 1928
447 Ga0501036_0468117 3300049572 Bacteria 1049
448 Ga0501037_0050416 3300049573 Bacteria 3046
449 Ga0501037_0078235 3300049573 Bacteria 2400
450 Ga0501037_0491760 3300049573 Bacteria 833
451 Ga0501038_0000960 3300049574 Bacteria 25782
452 Ga0501038_0011000 3300049574 Bacteria 8262
453 Ga0501038_0252716 3300049574 Bacteria 1396
454 Ga0501039_0005144 3300049575 Bacteria 9911
455 Ga0501039_0027321 3300049575 Bacteria 4388
456 Ga0501039_0038465 3300049575 Bacteria 3695
457 Ga0501039_0455350 3300049575 Bacteria 1005
458 Ga0501040_0001599 3300049576 Bacteria 14431
459 Ga0501040_0048226 3300049576 Bacteria 2911
460 Ga0501040_0064850 3300049576 Bacteria 2515
461 Ga0501040_0067105 3300049576 Bacteria 2472
462 Ga0501040_0197840 3300049576 Unclassified 1427
463 Ga0501041_0000355 3300049577 Bacteria 22648
464 Ga0501041_0046679 3300049577 Bacteria 2635
465 Ga0501041_0060537 3300049577 Bacteria 2317
466 Ga0501041_0272610 3300049577 Bacteria 1064
467 Ga0501042_0000507 3300049578 Bacteria 20293
468 Ga0501042_0008201 3300049578 Bacteria 6883
469 Ga0501042_0048695 3300049578 Bacteria 3022
470 Ga0501042_0125695 3300049578 Bacteria 1846
471 Ga0501042_0205233 3300049578 Bacteria 1421
472 Ga0501043_0011435 3300049579 Bacteria 6949
473 Ga0501046_0062775 3300049580 Bacteria 2902
474 Ga0501046_0143353 3300049580 Bacteria 1806
475 Ga0501048_0005286 3300049582 Bacteria 9834
476 Ga0501048_0005818 3300049582 Bacteria 9378
477 Ga0501048_0053822 3300049582 Bacteria 2860
478 Ga0501048_0113248 3300049582 Bacteria 1916
479 Ga0501068_0031072 3300049584 Bacteria 3171
480 Ga0501070_0030780 3300049586 Bacteria 4495
481 Ga0501071_0002480 3300049587 Bacteria 11209
482 Ga0501071_0003484 3300049587 Bacteria 9828
483 Ga0501071_0038117 3300049587 Bacteria 3434
484 Ga0501071_0384182 3300049587 Bacteria 1071
485 Ga0501072_0000533 3300049588 Bacteria 27307
486 Ga0501072_0002805 3300049588 Bacteria 13074
487 Ga0501072_0023906 3300049588 Bacteria 4749
488 Ga0501072_0038173 3300049588 Bacteria 3769
489 Ga0501072_0038311 3300049588 Bacteria 3762
490 Ga0501072_0112902 3300049588 Bacteria 2163
491 Ga0501072_0293940 3300049588 Bacteria 1291
492 Ga0501074_0012853 3300049590 Bacteria 6086
493 Ga0501074_0027357 3300049590 Bacteria 4135
494 Ga0501074_0059364 3300049590 Bacteria 2756
495 Ga0501074_0145945 3300049590 Bacteria 1692
496 Ga0501075_0000020 3300049591 Bacteria 67432
497 Ga0501075_0000035 3300049591 Bacteria 55355
498 Ga0501075_0004254 3300049591 Bacteria 9677
499 Ga0501075_0011479 3300049591 Bacteria 6271
500 Ga0501075_0026590 3300049591 Bacteria 4262
501 Ga0501075_0124018 3300049591 Bacteria 1966
502 Ga0501075_0288632 3300049591 Bacteria 1250
503 Ga0501075_0324422 3300049591 Bacteria 1173
504 Ga0501076_0000065 3300049592 Bacteria 53282
505 Ga0501076_0000074 3300049592 Bacteria 50353
506 Ga0501076_0000199 3300049592 Bacteria 36171
507 Ga0501076_0072589 3300049592 Bacteria 2754
508 Ga0501076_0100352 3300049592 Bacteria 2332
509 Ga0501076_0219230 3300049592 Bacteria 1555
510 Ga0501076_0355502 3300049592 Bacteria 1203
511 Ga0501076_0459301 3300049592 Bacteria 1049
512 Ga0501077_0000043 3300049593 Bacteria 64691
513 Ga0501077_0001173 3300049593 Bacteria 15848
514 Ga0501077_0016801 3300049593 Bacteria 4616
515 Ga0501077_0021524 3300049593 Bacteria 4081
516 Ga0501077_0027345 3300049593 Bacteria 3622
517 Ga0501077_0040562 3300049593 Bacteria 2966
518 Ga0501077_0045274 3300049593 Bacteria 2795
519 Ga0501077_0056666 3300049593 Bacteria 2488
520 Ga0501079_0029208 3300049741 Bacteria 4232
521 Ga0501079_0033259 3300049741 Bacteria 3966
522 Ga0501079_0033733 3300049741 Bacteria 3938
523 Ga0501079_0102594 3300049741 Bacteria 2218
524 Ga0501079_0229304 3300049741 Bacteria 1451
525 Ga0501079_0260932 3300049741 Bacteria 1354
526 Ga0501080_0020054 3300049742 Bacteria 6187
527 Ga0501080_0042502 3300049742 Bacteria 4231
528 Ga0501080_0048214 3300049742 Bacteria 3965
529 Ga0501080_0132158 3300049742 Bacteria 2311
530 Ga0501080_0226796 3300049742 Bacteria 1708
531 Ga0501081_0000453 3300049743 Bacteria 22671
532 Ga0501081_0002336 3300049743 Bacteria 11938
533 Ga0501081_0002389 3300049743 Bacteria 11817
534 Ga0501081_0021653 3300049743 Bacteria 4291
535 Ga0501081_0063950 3300049743 Bacteria 2554
536 Ga0501081_0080962 3300049743 Bacteria 2274
537 Ga0501081_0082121 3300049743 Bacteria 2257
538 Ga0501081_0132464 3300049743 Bacteria 1782
539 Ga0501083_0000344 3300049744 Bacteria 29353
540 Ga0501083_0008022 3300049744 Bacteria 7476
541 Ga0501083_0066552 3300049744 Bacteria 2399
542 Ga0501083_0094303 3300049744 Bacteria 1976
543 Ga0501035_0288299 3300049822 Bacteria 1386
544 Ga0501035_0433959 3300049822 Bacteria 1089
545 Ga0501035_0661382 3300049822 Bacteria 846
546 Ga0501045_0001528 3300049824 Bacteria 15404
547 Ga0501045_0006102 3300049824 Bacteria 8345
548 Ga0501045_0009714 3300049824 Bacteria 6731
549 Ga0501045_0072398 3300049824 Bacteria 2537
550 Ga0501045_0110066 3300049824 Bacteria 2042
551 Ga0501045_0231006 3300049824 Unclassified 1377
552 nmdc:mga05p37_1038068_c1 3300050507 Bacteria 866
553 nmdc:mga05p37_10402_c1 3300050507 Bacteria 11044
554 nmdc:mga05p37_108904_c1 3300050507 Bacteria 3408
555 nmdc:mga05p37_11728_c1 3300050507 Bacteria 10448
556 nmdc:mga05p37_1268_c1 3300050507 Bacteria 29301
557 nmdc:mga05p37_18462_c1 3300050507 Bacteria 8426
558 nmdc:mga05p37_24395_c1 3300050507 Bacteria 7349
559 nmdc:mga05p37_28553_c1 3300050507 Bacteria 6804
560 nmdc:mga05p37_290552_c1 3300050507 Bacteria 1946
561 nmdc:mga05p37_30229_c1 3300050507 Bacteria 6609
562 nmdc:mga05p37_35369_c1 3300050507 Bacteria 6124
563 nmdc:mga05p37_40076_c1 3300050507 Bacteria 5752
564 nmdc:mga05p37_432796_c1 3300050507 Bacteria 1528
565 nmdc:mga05p37_51435_c1 3300050507 Bacteria 5067
566 nmdc:mga09592_169427_c1 3300050508 Bacteria 1888
567 nmdc:mga09592_20696_c1 3300050508 Bacteria 5414
568 nmdc:mga09592_3431_c1 3300050508 Bacteria 12800
569 nmdc:mga09592_46765_c1 3300050508 Bacteria 3645
570 nmdc:mga09592_7041_c1 3300050508 Bacteria 9138
571 nmdc:mga09592_79392_c1 3300050508 Bacteria 2793
572 nmdc:mga0qj67_103326_c1 3300050509 Bacteria 2298
573 nmdc:mga0qj67_457585_c1 3300050509 Bacteria 1027
574 nmdc:mga06r32_10151_c1 3300050510 Bacteria 8500
575 nmdc:mga06r32_146349_c1 3300050510 Bacteria 2340
576 nmdc:mga06r32_275460_c1 3300050510 Bacteria 1670
577 nmdc:mga06r32_42238_c1 3300050510 Bacteria 4335
578 nmdc:mga06r32_462844_c1 3300050510 Bacteria 1247
579 nmdc:mga06r32_519701_c1 3300050510 Bacteria 1166
580 nmdc:mga06r32_728629_c1 3300050510 Bacteria 956
581 nmdc:mga06r32_8173_c1 3300050510 Bacteria 9414
582 nmdc:mga08y16_110289_c1 3300050511 Bacteria 2865
583 nmdc:mga08y16_312834_c1 3300050511 Bacteria 1617
584 nmdc:mga08y16_399618_c1 3300050511 Bacteria 1407
585 nmdc:mga0n895_11933_c1 3300050512 Bacteria 7775
586 nmdc:mga0n895_149929_c1 3300050512 Unclassified 2362
587 nmdc:mga0n895_1770_c1 3300050512 Bacteria 16370
588 nmdc:mga0n895_238561_c1 3300050512 Bacteria 1845
589 nmdc:mga0n895_271501_c1 3300050512 Bacteria 1720
590 nmdc:mga0n895_28078_c1 3300050512 Bacteria 5351
591 nmdc:mga0n895_34492_c1 3300050512 Bacteria 4872
592 nmdc:mga0n895_374867_c1 3300050512 Bacteria 1440
593 nmdc:mga0n895_39767_c1 3300050512 Bacteria 4566
594 nmdc:mga0n895_488130_c1 3300050512 Bacteria 1242
595 nmdc:mga0n895_585984_c1 3300050512 Bacteria 1119
596 nmdc:mga0n895_99338_c1 3300050512 Bacteria 2919
597 nmdc:mga0rr50_1612_c1 3300050513 Bacteria 12416
598 nmdc:mga0rr50_166496_c1 3300050513 Bacteria 1792
599 nmdc:mga0rr50_237997_c1 3300050513 Bacteria 1508
600 nmdc:mga0rr50_2919_c1 3300050513 Bacteria 9759
601 nmdc:mga0rr50_71172_c1 3300050513 Bacteria 2653
602 nmdc:mga0rr50_99779_c1 3300050513 Bacteria 2279
603 nmdc:mga08x19_101048_c1 3300050514 Bacteria 1914
604 nmdc:mga08x19_15065_c1 3300050514 Bacteria 4697
605 nmdc:mga08x19_201625_c1 3300050514 Bacteria 1364
606 nmdc:mga08x19_256672_c1 3300050514 Unclassified 1208
607 nmdc:mga08x19_307321_c1 3300050514 Bacteria 1102
608 nmdc:mga08x19_46862_c1 3300050514 Bacteria 2766
609 nmdc:mga08x19_48_c1 3300050514 Bacteria 141135
610 nmdc:mga08x19_527120_c1 3300050514 Bacteria 835
611 nmdc:mga08x19_573178_c1 3300050514 Bacteria 799
612 nmdc:mga08x19_81048_c1 3300050514 Bacteria 2131
613 nmdc:mga0a205_109947_c1 3300050515 Bacteria 2655
614 nmdc:mga0a205_1656_c1 3300050515 Bacteria 19165
615 nmdc:mga0a205_237693_c1 3300050515 Bacteria 1703
616 nmdc:mga0a205_2844_c1 3300050515 Bacteria 15314
617 nmdc:mga0a205_374238_c1 3300050515 Bacteria 1290
618 nmdc:mga0a205_4053_c1 3300050515 Bacteria 13098
619 nmdc:mga0a205_40555_c1 3300050515 Unclassified 4482
620 nmdc:mga0a205_526638_c1 3300050515 Bacteria 1038
621 nmdc:mga0a205_56045_c1 3300050515 Bacteria 3806
622 nmdc:mga0a205_6220_c1 3300050515 Bacteria 10774
623 nmdc:mga0a205_6881_c1 3300050515 Bacteria 9124
624 nmdc:mga0a205_78939_c1 3300050515 Bacteria 3180
625 nmdc:mga0a205_88475_c1 3300050515 Bacteria 2993
626 nmdc:mga0a205_90271_c1 3300050515 Bacteria 2961
627 nmdc:mga0a205_9405_c2 3300050515 Bacteria 7180
628 Ga0501084_0000666 3300054114 Bacteria 26202
629 Ga0501084_0013009 3300054114 Bacteria 6887
630 Ga0501084_0081197 3300054114 Bacteria 2719
631 Ga0501084_0088091 3300054114 Bacteria 2606
632 Ga0501084_0090342 3300054114 Bacteria 2571
633 Ga0501084_0561761 3300054114 Bacteria 964
634 Ga0501082_0000724 3300060353 Bacteria 29115
635 Ga0501082_0002242 3300060353 Bacteria 16911
636 Ga0501082_0004946 3300060353 Bacteria 11625
637 Ga0501082_0005616 3300060353 Bacteria 10885
638 Ga0501082_0018119 3300060353 Bacteria 6064
639 Ga0501082_0037684 3300060353 Bacteria 4170
640 Ga0501082_0062553 3300060353 Bacteria 3204
641 Ga0501082_0062885 3300060353 Bacteria 3196
642 Ga0501082_0089545 3300060353 Bacteria 2657
643 Ga0501082_0111236 3300060353 Bacteria 2371
644 Ga0501082_0322750 3300060353 Bacteria 1345
645 Ga0501082_0477413 3300060353 Bacteria 1090
646 Ga0501082_0794156 3300060353 Bacteria 828
647 Ga0530510_0000163 3300061734 Bacteria 40170
648 Ga0530510_0000496 3300061734 Bacteria 25056
649 Ga0530510_0003566 3300061734 Bacteria 10724
650 Ga0530510_0008014 3300061734 Bacteria 7367
651 Ga0530510_0022255 3300061734 Bacteria 4514
652 Ga0530510_0048065 3300061734 Bacteria 3084
653 Ga0530510_0054665 3300061734 Bacteria 2885
654 Ga0530510_0064316 3300061734 Bacteria 2657
655 Ga0530510_0125868 3300061734 Bacteria 1883
656 Ga0530510_0229801 3300061734 Bacteria 1380
657 Ga0530510_0450825 3300061734 Bacteria 973
658 Ga0207684_10004867
659 rootH1_10151800
660 Ga0065707_10009275
661 Ga0065707_10151908
662 Ga0065707_10276294
663 Ga0070658_10030152
664 Ga0070658_10334853
665 Ga0070676_10004718
666 Ga0070676_10022882
667 Ga0070690_100010773
668 Ga0070690_100326095
669 Ga0070670_100018757
670 Ga0070670_100269116
671 Ga0070677_10005091
672 Ga0068869_100083841
673 Ga0070666_10000280
674 Ga0070666_10001119
675 Ga0070666_10021487
676 Ga0070666_10109301
677 Ga0068868_100004592
678 Ga0068868_100192873
679 Ga0070689_100136638
680 Ga0070661_100058464
681 Ga0070692_10013488
682 Ga0070668_100112281
683 Ga0070669_100000067
684 Ga0070669_100046382
685 Ga0070669_100394983
686 Ga0070675_100002914
687 Ga0070675_100016893
688 Ga0070674_100003909
689 Ga0070673_100275144
690 Ga0070673_100421776
691 Ga0070688_100027161
692 Ga0070667_100002369
693 Ga0070667_100072409
694 Ga0070667_100104351
695 Ga0070709_10000061
696 Ga0070709_10000188
697 Ga0070710_10148530
698 Ga0070701_10103679
699 Ga0070711_100130040
700 Ga0070705_100021357
701 Ga0070705_100052202
702 Ga0070705_100201897
703 Ga0070700_100251462
704 Ga0070708_100005913
705 Ga0070708_100111503
706 Ga0070708_100186276
707 Ga0070708_100251707
708 Ga0070708_100253921
709 Ga0070708_100328566
710 Ga0070708_100353427
711 Ga0070708_100605856
712 Ga0070708_100763678
713 Ga0070678_100022905
714 Ga0070678_100026481
715 Ga0068867_100002678
716 Ga0070685_10006671
717 Ga0070685_10417634
718 Ga0070706_100000695
719 Ga0070706_100001793
720 Ga0070706_100009584
721 Ga0070706_100040209
722 Ga0070706_100108132
723 Ga0070706_100174677
724 Ga0070706_100207906
725 Ga0070707_100001621
726 Ga0070707_100119218
727 Ga0070707_100144417
728 Ga0070707_100475616
729 Ga0070698_100000039
730 Ga0070698_100009834
731 Ga0070698_100045109
732 Ga0070698_100127769
733 Ga0070698_100440554
734 Ga0070699_100000001
735 Ga0070699_100000487
736 Ga0070699_100001436
737 Ga0070699_100077225
738 Ga0070699_100309026
739 Ga0070699_100375385
740 Ga0070699_100412263
741 Ga0070697_100001957
742 Ga0070697_100004765
743 Ga0070697_100050257
744 Ga0070697_100059657
745 Ga0070697_100110725
746 Ga0070697_100148370
747 Ga0070697_100208302
748 Ga0070697_100263452
749 Ga0070672_100006171
750 Ga0070672_100009561
751 Ga0070672_100048438
752 Ga0070672_100245420
753 Ga0070695_100159070
754 Ga0070695_100416807
755 Ga0070665_100000192
756 Ga0070665_100005709
757 Ga0070665_100042241
758 Ga0070704_100018735
759 Ga0070704_100077805
760 Ga0070704_100149051
761 Ga0070704_100317455
762 Ga0070664_100009024
763 Ga0070664_100029797
764 Ga0068856_100005623
765 Ga0070702_100019049
766 Ga0068859_100000011
767 Ga0068859_100031529
768 Ga0068859_100087740
769 Ga0068859_100365914
770 Ga0068859_100401798
771 Ga0068864_100004914
772 Ga0068864_100118245
773 Ga0068866_10008283
774 Ga0068863_100015039
775 Ga0068863_100044719
776 Ga0068863_100085759
777 Ga0068858_100000696
778 Ga0068858_100029375
779 Ga0068858_100135556
780 Ga0068858_100153908
781 Ga0068860_100001744
782 Ga0068860_100037879
783 Ga0068860_100041504
784 Ga0068860_100042864
785 Ga0068860_100414861
786 Ga0068862_100003946
787 Ga0068862_100109481
788 Ga0068862_100156142
789 Ga0081455_10054893
790 Ga0081455_10106497
791 Ga0081540_1063724
792 Ga0081539_10000069
793 Ga0081539_10012083
794 Ga0081539_10089988
795 Ga0075432_10124832
796 Ga0070715_10039185
797 Ga0070716_100004444
798 Ga0070716_100029845
799 Ga0070716_100055209
800 Ga0070716_100058039
801 Ga0070712_100188782
802 Ga0070712_100510981
803 Ga0097621_100030848
804 Ga0097621_100053386
805 Ga0068871_100048937
806 Ga0068871_100112804
807 Ga0075428_100003389
808 Ga0075428_100024055
809 Ga0075428_100054477
810 Ga0075428_100346784
811 Ga0075430_100155640
812 Ga0075431_100006312
813 Ga0075431_100040527
814 Ga0075431_100040902
815 Ga0075431_100136854
816 Ga0075431_100141324
817 Ga0075431_100319918
818 Ga0075433_10000635
819 Ga0075433_10001574
820 Ga0075433_10006071
821 Ga0075433_10009002
822 Ga0075433_10011625
823 Ga0075433_10021047
824 Ga0075433_10058731
825 Ga0075433_10064484
826 Ga0075433_10087136
827 Ga0075433_10105082
828 Ga0075433_10156734
829 Ga0075433_10198091
830 Ga0075433_10214395
831 Ga0075434_100000231
832 Ga0075434_100007808
833 Ga0075434_100011373
834 Ga0075434_100011826
835 Ga0075434_100033216
836 Ga0075434_100045959
837 Ga0075434_100069633
838 Ga0075434_100080717
839 Ga0075434_100320816
840 Ga0075434_100334462
841 Ga0075434_100414367
842 Ga0075434_100515701
843 Ga0075434_100570879
844 Ga0075429_100003245
845 Ga0075429_100003386
846 Ga0075429_100017506
847 Ga0075429_100064709
848 Ga0075429_100090931
849 Ga0075429_100095909
850 Ga0075429_100753932
851 Ga0075436_100002298
852 Ga0075436_100003283
853 Ga0075436_100010775
854 Ga0075436_100045766
855 Ga0075436_100090388
856 Ga0075436_100114495
857 Ga0097620_100000011
858 Ga0097620_100031529
859 Ga0097620_100087731
860 Ga0097620_100365945
861 Ga0097620_100401838
862 Ga0075435_100002183
863 Ga0075435_100020268
864 Ga0075435_100022879
865 Ga0075435_100032963
866 Ga0075435_100075766
867 Ga0075435_100181431
868 Ga0075435_100224616
869 Ga0099794_10002270
870 Ga0111539_10056326
871 Ga0111539_10110067
872 Ga0111539_10128580
873 Ga0111539_10886708
874 Ga0105245_10053841
875 Ga0105245_10074684
876 Ga0114129_10000480
877 Ga0114129_10000481
878 Ga0114129_10001262
879 Ga0114129_10003062
880 Ga0114129_10005162
881 Ga0114129_10006637
882 Ga0114129_10011313
883 Ga0114129_10024047
884 Ga0114129_10025268
885 Ga0114129_10031674
886 Ga0114129_10039241
887 Ga0114129_10141430
888 Ga0114129_10300334
889 Ga0114129_10334787
890 Ga0114129_10392016
891 Ga0114129_10547196
892 Ga0114129_10631846
893 Ga0114129_10775099
894 Ga0105243_10671561
895 Ga0105248_10000542
896 Ga0105248_10060397
897 Ga0105249_10026901
898 Ga0105249_10051320
899 Ga0105249_10258946
900 Ga0105249_10303578
901 Ga0105249_10432737
902 Ga0157374_10005043
903 Ga0157378_10029667
904 Ga0157378_10128484
905 Ga0163162_10070000
906 Ga0163162_10118778
907 Ga0163162_10808300
908 Ga0157375_10000977
909 Ga0157375_10052639
910 Ga0157375_10077281
911 Ga0157375_10114176
912 Ga0157375_10204167
913 Ga0163163_10038227
914 Ga0163163_10053332
915 Ga0163163_10391352
916 Ga0157380_10013063
917 Ga0157380_10182138
918 Ga0157377_10186817
919 Ga0157379_10002140
920 Ga0157379_10439569
921 Ga0157376_10004116
922 Ga0157376_10030301
923 Ga0157376_10670686
924 Ga0228598_1004429
925 Ga0207697_10010731
926 Ga0207682_10003551
927 Ga0207692_10099129
928 Ga0207642_10027039
929 Ga0207710_10097927
930 Ga0207688_10085441
931 Ga0207680_10000698
932 Ga0207680_10001569
933 Ga0207680_10092585
934 Ga0207680_10116773
935 Ga0207680_10187028
936 Ga0207699_10000061
937 Ga0207699_10000173
938 Ga0207645_10026035
939 Ga0207643_10001965
940 Ga0207684_10000422
941 Ga0207684_10000457
942 Ga0207684_10005654
943 Ga0207684_10280362
944 Ga0207663_10049184
945 Ga0207649_10017363
946 Ga0207646_10003551
947 Ga0207646_10008658
948 Ga0207646_10025277
949 Ga0207646_10205896
950 Ga0207681_10000018
951 Ga0207681_10053238
952 Ga0207650_10026582
953 Ga0207659_10028207
954 Ga0207659_10083398
955 Ga0207700_10152642
956 Ga0207644_10068829
957 Ga0207706_10563706
958 Ga0207709_10245213
959 Ga0207670_10170945
960 Ga0207665_10030787
961 Ga0207665_10030895
962 Ga0207665_10045308
963 Ga0207665_10149468
964 Ga0207665_10256428
965 Ga0207691_10000236
966 Ga0207691_10030887
967 Ga0207691_10051283
968 Ga0207711_10000463
969 Ga0207711_10107912
970 Ga0207711_10186038
971 Ga0207689_10014810
972 Ga0207689_10015205
973 Ga0207689_10461004
974 Ga0207679_10360672
975 Ga0207667_10201947
976 Ga0207651_10004483
977 Ga0207651_10206081
978 Ga0207712_10044866
979 Ga0207712_10057065
980 Ga0207712_10211081
981 Ga0207668_10287349
982 Ga0207658_10037902
983 Ga0207658_10062494
984 Ga0207658_10081654
985 Ga0207677_10009384
986 Ga0207703_10002265
987 Ga0207703_10088002
988 Ga0207703_10129945
989 Ga0207703_10232574
990 Ga0207678_10009963
991 Ga0207678_10039644
992 Ga0207708_10089114
993 Ga0207702_10007527
994 Ga0207641_10146658
995 Ga0207648_10009120
996 Ga0207648_10345434
997 Ga0207676_10053472
998 Ga0207676_10069766
999 Ga0207675_100008654
1000 Ga0207675_100026392
1001 Ga0207683_10005485
1002 Ga0207683_10046165
1003 Ga0210000_1002050
1004 Ga0209995_1003044
1005 Ga0209982_1015914
1006 Ga0209970_1002078
1007 Ga0210002_1005132
1008 Ga0209971_1002070
1009 Ga0209974_10000984
1010 Ga0207428_10044025
1011 Ga0207428_10194909
1012 Ga0268266_10000298
1013 Ga0268266_10010268
1014 Ga0268266_10018541
1015 Ga0268265_10001599
1016 Ga0268265_10103601
1017 Ga0268265_10172816
1018 Ga0268265_10177983
1019 Ga0268265_10183342
1020 Ga0268264_10005948
1021 Ga0268264_10009784
1022 Ga0268264_10080567
1023 Ga0268264_10148883
1024 Ga0268264_10287953
1025 Ga0268264_10384635
1026 Ga0268264_10645512
1027 Ga0307408_100008647
1028 Ga0307508_10013230
1029 Ga0265342_10065362
1030 Ga0307410_10028940
1031 Ga0307412_10110483
1032 Ga0307409_100136065
1033 Ga0307416_100009346
1034 Ga0307411_10039141
1035 Ga0316583_10063543
1036 Ga0373948_0031993
1037 Ga0373926_0059126
1038 Ga0373929_0000012
1039 Ga0373943_0177903
1040 Ga0373955_0100006
1041 Ga0373931_0030558
1042 Ga0373935_0004442
1043 Ga0373935_0184257
1044 Ga0373937_0030783
1045 Ga0373937_0034088
1046 Ga0373937_0124693
1047 Ga0373937_0972703
1048 Ga0373925_0009142
1049 Ga0373925_0039376
1050 Ga0395899_0020904
1051 Ga0395900_0045416
1052 Ga0395898_0010580
1053 Ga0395901_0001137
1054 Ga0395901_0373412
1055 Ga0451793_0951705
1056 Ga0451807_1052407
1057 Ga0451807_2162117
1058 Ga0451577_0462485
1059 Ga0451577_0481671
1060 Ga0453683_0000574
1061 Ga0453683_0098828
1062 Ga0466963_0109396
1063 Ga0453684_0137947
1064 Ga0451576_0044738
1065 Ga0466967_0200977
1066 Ga0495629_0048854
1067 Ga0495580_0000625
1068 Ga0495580_0000901
1069 Ga0495580_0003086
1070 Ga0495580_0080129
1071 Ga0495662_0046608
1072 Ga0495662_0050074
1073 Ga0495633_0061602
1074 Ga0495656_0299666
1075 Ga0495657_0207285
1076 Ga0495647_0023255
1077 Ga0495647_0099155
1078 Ga0495658_0013300
1079 Ga0495670_0282607
1080 Ga0495636_0070618
1081 Ga0495684_0013908
1082 Ga0495684_0111972
1083 Ga0495602_0133989
1084 Ga0495602_0189033
1085 Ga0496100_0018468
1086 Ga0496101_0147863
1087 Ga0496102_0001398
1088 Ga0496102_0056079
1089 Ga0496102_0187518
1090 Ga0496104_0111526
1091 Ga0496104_0332651
1092 Ga0496106_0020482
1093 Ga0496107_0006217
1094 Ga0496109_0113719
1095 Ga0496111_0068447
1096 Ga0496111_0196542
1097 Ga0496112_0722479
1098 Ga0496114_0000030
1099 Ga0501031_0001590
1100 Ga0501031_0207967
1101 Ga0501033_0082570
1102 Ga0501036_0001538
1103 Ga0501036_0155572
1104 Ga0501036_0468117
1105 Ga0501037_0050416
1106 Ga0501037_0078235
1107 Ga0501037_0491760
1108 Ga0501038_0000960
1109 Ga0501038_0011000
1110 Ga0501038_0252716
1111 Ga0501039_0005144
1112 Ga0501039_0027321
1113 Ga0501039_0038465
1114 Ga0501039_0455350
1115 Ga0501040_0001599
1116 Ga0501040_0048226
1117 Ga0501040_0064850
1118 Ga0501040_0067105
1119 Ga0501040_0197840
1120 Ga0501041_0000355
1121 Ga0501041_0046679
1122 Ga0501041_0060537
1123 Ga0501041_0272610
1124 Ga0501042_0000507
1125 Ga0501042_0008201
1126 Ga0501042_0048695
1127 Ga0501042_0125695
1128 Ga0501042_0205233
1129 Ga0501043_0011435
1130 Ga0501046_0062775
1131 Ga0501046_0143353
1132 Ga0501048_0005286
1133 Ga0501048_0005818
1134 Ga0501048_0053822
1135 Ga0501048_0113248
1136 Ga0501068_0031072
1137 Ga0501070_0030780
1138 Ga0501071_0002480
1139 Ga0501071_0003484
1140 Ga0501071_0038117
1141 Ga0501071_0384182
1142 Ga0501072_0000533
1143 Ga0501072_0002805
1144 Ga0501072_0023906
1145 Ga0501072_0038173
1146 Ga0501072_0038311
1147 Ga0501072_0112902
1148 Ga0501072_0293940
1149 Ga0501074_0012853
1150 Ga0501074_0027357
1151 Ga0501074_0059364
1152 Ga0501074_0145945
1153 Ga0501075_0000020
1154 Ga0501075_0000035
1155 Ga0501075_0004254
1156 Ga0501075_0011479
1157 Ga0501075_0026590
1158 Ga0501075_0124018
1159 Ga0501075_0288632
1160 Ga0501075_0324422
1161 Ga0501076_0000065
1162 Ga0501076_0000074
1163 Ga0501076_0000199
1164 Ga0501076_0072589
1165 Ga0501076_0100352
1166 Ga0501076_0219230
1167 Ga0501076_0355502
1168 Ga0501076_0459301
1169 Ga0501077_0000043
1170 Ga0501077_0001173
1171 Ga0501077_0016801
1172 Ga0501077_0021524
1173 Ga0501077_0027345
1174 Ga0501077_0040562
1175 Ga0501077_0045274
1176 Ga0501077_0056666
1177 Ga0501079_0029208
1178 Ga0501079_0033259
1179 Ga0501079_0033733
1180 Ga0501079_0102594
1181 Ga0501079_0229304
1182 Ga0501079_0260932
1183 Ga0501080_0020054
1184 Ga0501080_0042502
1185 Ga0501080_0048214
1186 Ga0501080_0132158
1187 Ga0501080_0226796
1188 Ga0501081_0000453
1189 Ga0501081_0002336
1190 Ga0501081_0002389
1191 Ga0501081_0021653
1192 Ga0501081_0063950
1193 Ga0501081_0080962
1194 Ga0501081_0082121
1195 Ga0501081_0132464
1196 Ga0501083_0000344
1197 Ga0501083_0008022
1198 Ga0501083_0066552
1199 Ga0501083_0094303
1200 Ga0501035_0288299
1201 Ga0501035_0433959
1202 Ga0501035_0661382
1203 Ga0501045_0001528
1204 Ga0501045_0006102
1205 Ga0501045_0009714
1206 Ga0501045_0072398
1207 Ga0501045_0110066
1208 Ga0501045_0231006
1209 nmdc:mga05p37_1038068_c1
1210 nmdc:mga05p37_10402_c1
1211 nmdc:mga05p37_108904_c1
1212 nmdc:mga05p37_11728_c1
1213 nmdc:mga05p37_1268_c1
1214 nmdc:mga05p37_18462_c1
1215 nmdc:mga05p37_24395_c1
1216 nmdc:mga05p37_28553_c1
1217 nmdc:mga05p37_290552_c1
1218 nmdc:mga05p37_30229_c1
1219 nmdc:mga05p37_35369_c1
1220 nmdc:mga05p37_40076_c1
1221 nmdc:mga05p37_432796_c1
1222 nmdc:mga05p37_51435_c1
1223 nmdc:mga09592_169427_c1
1224 nmdc:mga09592_20696_c1
1225 nmdc:mga09592_3431_c1
1226 nmdc:mga09592_46765_c1
1227 nmdc:mga09592_7041_c1
1228 nmdc:mga09592_79392_c1
1229 nmdc:mga0qj67_103326_c1
1230 nmdc:mga0qj67_457585_c1
1231 nmdc:mga06r32_10151_c1
1232 nmdc:mga06r32_146349_c1
1233 nmdc:mga06r32_275460_c1
1234 nmdc:mga06r32_42238_c1
1235 nmdc:mga06r32_462844_c1
1236 nmdc:mga06r32_519701_c1
1237 nmdc:mga06r32_728629_c1
1238 nmdc:mga06r32_8173_c1
1239 nmdc:mga08y16_110289_c1
1240 nmdc:mga08y16_312834_c1
1241 nmdc:mga08y16_399618_c1
1242 nmdc:mga0n895_11933_c1
1243 nmdc:mga0n895_149929_c1
1244 nmdc:mga0n895_1770_c1
1245 nmdc:mga0n895_238561_c1
1246 nmdc:mga0n895_271501_c1
1247 nmdc:mga0n895_28078_c1
1248 nmdc:mga0n895_34492_c1
1249 nmdc:mga0n895_374867_c1
1250 nmdc:mga0n895_39767_c1
1251 nmdc:mga0n895_488130_c1
1252 nmdc:mga0n895_585984_c1
1253 nmdc:mga0n895_99338_c1
1254 nmdc:mga0rr50_1612_c1
1255 nmdc:mga0rr50_166496_c1
1256 nmdc:mga0rr50_237997_c1
1257 nmdc:mga0rr50_2919_c1
1258 nmdc:mga0rr50_71172_c1
1259 nmdc:mga0rr50_99779_c1
1260 nmdc:mga08x19_101048_c1
1261 nmdc:mga08x19_15065_c1
1262 nmdc:mga08x19_201625_c1
1263 nmdc:mga08x19_256672_c1
1264 nmdc:mga08x19_307321_c1
1265 nmdc:mga08x19_46862_c1
1266 nmdc:mga08x19_48_c1
1267 nmdc:mga08x19_527120_c1
1268 nmdc:mga08x19_573178_c1
1269 nmdc:mga08x19_81048_c1
1270 nmdc:mga0a205_109947_c1
1271 nmdc:mga0a205_1656_c1
1272 nmdc:mga0a205_237693_c1
1273 nmdc:mga0a205_2844_c1
1274 nmdc:mga0a205_374238_c1
1275 nmdc:mga0a205_4053_c1
1276 nmdc:mga0a205_40555_c1
1277 nmdc:mga0a205_526638_c1
1278 nmdc:mga0a205_56045_c1
1279 nmdc:mga0a205_6220_c1
1280 nmdc:mga0a205_6881_c1
1281 nmdc:mga0a205_78939_c1
1282 nmdc:mga0a205_88475_c1
1283 nmdc:mga0a205_90271_c1
1284 nmdc:mga0a205_9405_c2
1285 Ga0501084_0000666
1286 Ga0501084_0013009
1287 Ga0501084_0081197
1288 Ga0501084_0088091
1289 Ga0501084_0090342
1290 Ga0501084_0561761
1291 Ga0501082_0000724
1292 Ga0501082_0002242
1293 Ga0501082_0004946
1294 Ga0501082_0005616
1295 Ga0501082_0018119
1296 Ga0501082_0037684
1297 Ga0501082_0062553
1298 Ga0501082_0062885
1299 Ga0501082_0089545
1300 Ga0501082_0111236
1301 Ga0501082_0322750
1302 Ga0501082_0477413
1303 Ga0501082_0794156
1304 Ga0530510_0000163
1305 Ga0530510_0000496
1306 Ga0530510_0003566
1307 Ga0530510_0008014
1308 Ga0530510_0022255
1309 Ga0530510_0048065
1310 Ga0530510_0054665
1311 Ga0530510_0064316
1312 Ga0530510_0125868
1313 Ga0530510_0229801
1314 Ga0530510_0450825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

76

287

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch9-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd 0.9285 5 245
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9214 4 247
7d08-assembly1.cif.gz_A acinetobacter mlafedb complex in atp-bound vtrans1 conformation 0.919 4 247
7d0a-assembly1.cif.gz_D acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation 0.9163 4 246
6zy9-assembly1.cif.gz_H cryo-em structure of mlafedb in complex with amp-pnp 0.9159 5 245
ID Description Score Start End Superfamily
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4657 11 244 1.10.357.20
af_Q4CZP8_573_734_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4578 44 236 1.10.1760.20
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4574 11 244 1.10.357.20
af_Q4CZP8_573_734_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4485 44 236 1.10.1760.20
af_K7M452_350_510_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4252 48 244 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7Z3Q2-F1-model_v4 ABC transporter permease 0.9737 4 247 GO:0005548
GO:0043190
AF-A0A6B1H434-F1-model_v4 ABC transporter permease 0.9725 22 250 GO:0005548
GO:0043190
AF-A0A2H6ETH4-F1-model_v4 Putative phospholipid ABC transporter permease protein MlaE 0.9719 4 249 GO:0005548
GO:0043190
AF-A0A1Q7ZJ05-F1-model_v4 Transporter 0.9718 6 247 GO:0005548
GO:0043190
AF-A0A7C5WKK4-F1-model_v4 ABC transporter permease 0.9701 4 249 GO:0005548
GO:0043190

Map