F473078

General Info

Members Datasets Scaffolds Average Seq Length
657 306 1314 126

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100143335|Ga0068856_1001433352
Length 142
Sequence VGRAGRRWRIGRADELMPKQFYSASEAAKMLGISLDTLRRWDRAGRIETARDSGNRRIVAAAEVQRLRGEADAGHLSARNRLRGTVSEVKVEGLIAQVELVVDEPARLVAIVTADAVEDLDLKPGMPATAVVKATSVMVEHS

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
193 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
224 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
225 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 10.96
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 11.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100143335 3300005614 Bacteria 2397
2 JGI24747J21853_1001200 3300001978 Bacteria 1894
3 JGI24743J22301_10032513 3300001991 Bacteria 1031
4 JGI24738J21930_10050068 3300002075 Bacteria 851
5 JGI24744J21845_10000202 3300002077 Bacteria 9208
6 JGI24742J22300_10002689 3300002244 Bacteria 2854
7 Ga0070658_10056823 3300005327 Bacteria 3182
8 Ga0070658_10138973 3300005327 Bacteria 2028
9 Ga0070658_10477223 3300005327 Bacteria 1076
10 Ga0070683_100039464 3300005329 Bacteria 4335
11 Ga0070683_100557643 3300005329 Unclassified 1095
12 Ga0070690_100012303 3300005330 Bacteria 5035
13 Ga0070677_10121711 3300005333 Bacteria 1179
14 Ga0068869_100087534 3300005334 Bacteria 2337
15 Ga0068869_101245994 3300005334 Bacteria 655
16 Ga0068869_101626687 3300005334 Bacteria 575
17 Ga0070666_10025444 3300005335 Bacteria 3859
18 Ga0070680_100022230 3300005336 Bacteria 5047
19 Ga0070680_100113619 3300005336 Bacteria 2256
20 Ga0070680_100211590 3300005336 Bacteria 1636
21 Ga0070680_101398993 3300005336 Bacteria 606
22 Ga0070682_100001727 3300005337 Bacteria 12148
23 Ga0070682_100016652 3300005337 Bacteria 4278
24 Ga0068868_100034748 3300005338 Bacteria 3894
25 Ga0068868_100119059 3300005338 Bacteria 2153
26 Ga0068868_100416526 3300005338 Unclassified 1162
27 Ga0070660_100003251 3300005339 Bacteria 11151
28 Ga0070660_100082004 3300005339 Bacteria 2532
29 Ga0070660_100340188 3300005339 Bacteria 1235
30 Ga0070660_100887003 3300005339 Unclassified 752
31 Ga0070689_100005024 3300005340 Bacteria 8991
32 Ga0070691_10020490 3300005341 Bacteria 3056
33 Ga0070691_10115979 3300005341 Bacteria 1344
34 Ga0070691_10222501 3300005341 Bacteria 1001
35 Ga0070687_100044161 3300005343 Bacteria 2269
36 Ga0070687_100621337 3300005343 Unclassified 745
37 Ga0070692_10011016 3300005345 Bacteria 4139
38 Ga0070692_10510606 3300005345 Bacteria 781
39 Ga0070668_100003491 3300005347 Bacteria 11589
40 Ga0070669_100098005 3300005353 Bacteria 2208
41 Ga0070669_100130401 3300005353 Bacteria 1928
42 Ga0070671_100051609 3300005355 Bacteria 3420
43 Ga0070671_100171875 3300005355 Bacteria 1833
44 Ga0070671_100577041 3300005355 Bacteria 971
45 Ga0070674_100015115 3300005356 Bacteria 4812
46 Ga0070674_100024374 3300005356 Bacteria 3926
47 Ga0070673_100138294 3300005364 Bacteria 2052
48 Ga0070688_100024568 3300005365 Bacteria 3557
49 Ga0070688_100769614 3300005365 Bacteria 751
50 Ga0070688_100782055 3300005365 Unclassified 745
51 Ga0070659_100067228 3300005366 Bacteria 2842
52 Ga0070659_100068682 3300005366 Bacteria 2811
53 Ga0070659_100198257 3300005366 Bacteria 1652
54 Ga0070667_100838915 3300005367 Bacteria 854
55 Ga0070709_10041089 3300005434 Bacteria 2847
56 Ga0070709_10048644 3300005434 Bacteria 2647
57 Ga0070709_10203324 3300005434 Bacteria 1404
58 Ga0070709_10387366 3300005434 Bacteria 1041
59 Ga0070714_100001615 3300005435 Bacteria 16390
60 Ga0070714_100004161 3300005435 Bacteria 10879
61 Ga0070714_100007814 3300005435 Bacteria 8332
62 Ga0070713_100010349 3300005436 Bacteria 6736
63 Ga0070713_100046856 3300005436 Bacteria 3549
64 Ga0070713_100063409 3300005436 Bacteria 3098
65 Ga0070701_10000256 3300005438 Bacteria 17170
66 Ga0070701_10032314 3300005438 Bacteria 2605
67 Ga0070711_100003709 3300005439 Bacteria 8948
68 Ga0070711_100010992 3300005439 Bacteria 5612
69 Ga0070705_100004172 3300005440 Bacteria 7058
70 Ga0070705_100052988 3300005440 Bacteria 2373
71 Ga0070705_100056446 3300005440 Bacteria 2312
72 Ga0070705_100104042 3300005440 Bacteria 1799
73 Ga0070705_100237662 3300005440 Bacteria 1271
74 Ga0070700_100000501 3300005441 Bacteria 19560
75 Ga0070700_100103151 3300005441 Bacteria 1883
76 Ga0070700_100376944 3300005441 Unclassified 1060
77 Ga0070694_100092578 3300005444 Bacteria 2124
78 Ga0070694_100097957 3300005444 Bacteria 2069
79 Ga0070694_100317611 3300005444 Bacteria 1198
80 Ga0070708_101385503 3300005445 Bacteria 656
81 Ga0070663_100002744 3300005455 Bacteria 9979
82 Ga0070663_100010972 3300005455 Bacteria 5667
83 Ga0070678_100007975 3300005456 Bacteria 6313
84 Ga0070678_100035759 3300005456 Bacteria 3471
85 Ga0070678_100106715 3300005456 Bacteria 2183
86 Ga0070662_100101740 3300005457 Bacteria 2175
87 Ga0070681_10078241 3300005458 Bacteria 3264
88 Ga0070681_10291125 3300005458 Bacteria 1543
89 Ga0070681_10407128 3300005458 Bacteria 1272
90 Ga0068867_100002692 3300005459 Bacteria 12531
91 Ga0068867_100178410 3300005459 Bacteria 1687
92 Ga0068867_100268857 3300005459 Bacteria 1393
93 Ga0070685_10019902 3300005466 Bacteria 3627
94 Ga0070685_10042476 3300005466 Unclassified 2595
95 Ga0070706_100603751 3300005467 Bacteria 1019
96 Ga0070698_100108843 3300005471 Bacteria 2738
97 Ga0070698_100380580 3300005471 Bacteria 1344
98 Ga0070699_100616545 3300005518 Bacteria 990
99 Ga0070699_101786060 3300005518 Unclassified 563
100 Ga0070679_100032075 3300005530 Bacteria 5195
101 Ga0070679_100063066 3300005530 Bacteria 3694
102 Ga0070679_100158157 3300005530 Bacteria 2240
103 Ga0070679_100174735 3300005530 Bacteria 2120
104 Ga0070679_100463422 3300005530 Bacteria 1212
105 Ga0070679_101666351 3300005530 Bacteria 585
106 Ga0070684_100278586 3300005535 Bacteria 1532
107 Ga0070684_101780559 3300005535 Unclassified 581
108 Ga0068853_100030330 3300005539 Bacteria 4567
109 Ga0070672_100469993 3300005543 Bacteria 1085
110 Ga0070686_100014177 3300005544 Bacteria 4588
111 Ga0070686_100016659 3300005544 Bacteria 4278
112 Ga0070686_100044913 3300005544 Bacteria 2781
113 Ga0070695_100001141 3300005545 Bacteria 14557
114 Ga0070695_100142910 3300005545 Bacteria 1662
115 Ga0070695_100218475 3300005545 Bacteria 1372
116 Ga0070695_100855733 3300005545 Bacteria 732
117 Ga0070696_100018983 3300005546 Bacteria 4654
118 Ga0070696_100034855 3300005546 Bacteria 3464
119 Ga0070696_100105810 3300005546 Bacteria 2022
120 Ga0070693_100053414 3300005547 Bacteria 2320
121 Ga0070693_100053663 3300005547 Bacteria 2315
122 Ga0070693_100629478 3300005547 Bacteria 778
123 Ga0070693_101012975 3300005547 Bacteria 629
124 Ga0070665_100152482 3300005548 Bacteria 2313
125 Ga0070704_100038579 3300005549 Bacteria 3273
126 Ga0070704_100047488 3300005549 Bacteria 3001
127 Ga0068855_100527793 3300005563 Bacteria 1280
128 Ga0068855_101345704 3300005563 Bacteria 738
129 Ga0070664_100235906 3300005564 Bacteria 1641
130 Ga0070664_101425841 3300005564 Unclassified 655
131 Ga0068854_100064201 3300005578 Bacteria 2667
132 Ga0068854_100174826 3300005578 Bacteria 1673
133 Ga0068854_100665044 3300005578 Bacteria 896
134 Ga0068856_100009072 3300005614 Bacteria 9678
135 Ga0068856_100060019 3300005614 Bacteria 3757
136 Ga0070702_100067827 3300005615 Bacteria 2097
137 Ga0070702_101365262 3300005615 Bacteria 578
138 Ga0068852_100004631 3300005616 Bacteria 9748
139 Ga0068852_100321871 3300005616 Bacteria 1502
140 Ga0068859_100139234 3300005617 Bacteria 2500
141 Ga0068859_100949869 3300005617 Bacteria 943
142 Ga0068864_101854398 3300005618 Unclassified 608
143 Ga0068866_10016350 3300005718 Bacteria 3316
144 Ga0068866_10452189 3300005718 Bacteria 840
145 Ga0068861_100009376 3300005719 Bacteria 6757
146 Ga0068861_100178050 3300005719 Bacteria 1768
147 Ga0068861_100383915 3300005719 Unclassified 1242
148 Ga0068851_10458888 3300005834 Bacteria 758
149 Ga0068863_101165769 3300005841 Bacteria 776
150 Ga0068860_100063401 3300005843 Bacteria 3511
151 Ga0068862_100040614 3300005844 Bacteria 3954
152 Ga0068862_100221876 3300005844 Bacteria 1712
153 Ga0081455_10007728 3300005937 Bacteria 11280
154 Ga0081540_1002900 3300005983 Bacteria 13822
155 Ga0081540_1262079 3300005983 Bacteria 600
156 Ga0081539_10014843 3300005985 Bacteria 5721
157 Ga0070717_10002428 3300006028 Bacteria 13160
158 Ga0070717_10006179 3300006028 Bacteria 8790
159 Ga0075432_10125501 3300006058 Bacteria 968
160 Ga0070715_10007258 3300006163 Bacteria 3810
161 Ga0070715_10062343 3300006163 Bacteria 1640
162 Ga0070715_10067609 3300006163 Bacteria 1587
163 Ga0070716_100018234 3300006173 Bacteria 3652
164 Ga0070716_100964247 3300006173 Unclassified 672
165 Ga0070712_100005301 3300006175 Bacteria 7979
166 Ga0070712_100289366 3300006175 Unclassified 1322
167 Ga0075367_10155356 3300006178 Bacteria 1421
168 Ga0097621_100044364 3300006237 Bacteria 3587
169 Ga0097621_100132154 3300006237 Bacteria 2126
170 Ga0068871_100042510 3300006358 Bacteria 3648
171 Ga0075428_101129694 3300006844 Unclassified 827
172 Ga0075428_101282939 3300006844 Archaea 770
173 Ga0075431_100162024 3300006847 Bacteria 2300
174 Ga0075433_10062525 3300006852 Bacteria 3260
175 Ga0075433_11426143 3300006852 Unclassified 599
176 Ga0075434_100023820 3300006871 Bacteria 5973
177 Ga0075434_100144728 3300006871 Bacteria 2397
178 Ga0075429_101656986 3300006880 Bacteria 556
179 Ga0068865_100002886 3300006881 Bacteria 10243
180 Ga0068865_101174158 3300006881 Unclassified 679
181 Ga0075436_100018494 3300006914 Bacteria 4770
182 Ga0075436_100523140 3300006914 Bacteria 869
183 Ga0097620_100139239 3300006931 Bacteria 2500
184 Ga0097620_100949952 3300006931 Bacteria 943
185 Ga0075435_100049436 3300007076 Bacteria 3382
186 Ga0105250_10272525 3300009092 Bacteria 727
187 Ga0105240_10021245 3300009093 Bacteria 8639
188 Ga0105240_10850695 3300009093 Bacteria 985
189 Ga0105240_11247523 3300009093 Unclassified 786
190 Ga0111539_10108143 3300009094 Bacteria 3263
191 Ga0111539_10737666 3300009094 Unclassified 1147
192 Ga0111539_11497465 3300009094 Bacteria 783
193 Ga0111539_11817119 3300009094 Bacteria 707
194 Ga0111539_12174552 3300009094 Bacteria 644
195 Ga0105245_10005580 3300009098 Bacteria 11055
196 Ga0105245_10028788 3300009098 Bacteria 4902
197 Ga0105245_10030025 3300009098 Bacteria 4806
198 Ga0105245_10269554 3300009098 Bacteria 1660
199 Ga0105245_11772123 3300009098 Bacteria 670
200 Ga0105247_10021826 3300009101 Bacteria 3852
201 Ga0114129_10079841 3300009147 Bacteria 4548
202 Ga0114129_10996583 3300009147 Unclassified 1055
203 Ga0105243_10003859 3300009148 Bacteria 11972
204 Ga0105243_10020436 3300009148 Bacteria 5021
205 Ga0105243_10477360 3300009148 Unclassified 1176
206 Ga0105241_10084203 3300009174 Bacteria 2496
207 Ga0105241_10111169 3300009174 Bacteria 2193
208 Ga0105241_10201890 3300009174 Bacteria 1661
209 Ga0105241_10402943 3300009174 Bacteria 1200
210 Ga0105241_11703208 3300009174 Bacteria 613
211 Ga0105242_10001491 3300009176 Bacteria 18433
212 Ga0105242_10124905 3300009176 Bacteria 2213
213 Ga0105242_10344796 3300009176 Bacteria 1374
214 Ga0105242_12760440 3300009176 Bacteria 541
215 Ga0105248_10020234 3300009177 Bacteria 7372
216 Ga0105248_10686652 3300009177 Bacteria 1155
217 Ga0105237_10022945 3300009545 Bacteria 6400
218 Ga0105237_10146707 3300009545 Bacteria 2354
219 Ga0105237_10328245 3300009545 Bacteria 1534
220 Ga0105238_10088524 3300009551 Bacteria 3082
221 Ga0105238_10093465 3300009551 Bacteria 2995
222 Ga0105238_10113440 3300009551 Bacteria 2690
223 Ga0105249_10001367 3300009553 Bacteria 21337
224 Ga0105249_10088354 3300009553 Bacteria 2895
225 Ga0105239_10010990 3300010375 Bacteria 10106
226 Ga0105239_10088652 3300010375 Bacteria 3411
227 Ga0105239_10235874 3300010375 Bacteria 2053
228 Ga0105239_12506566 3300010375 Bacteria 601
229 Ga0105246_10137561 3300011119 Bacteria 1833
230 Ga0157342_1009904 3300012507 Bacteria 966
231 Ga0157371_10110552 3300013102 Bacteria 1951
232 Ga0157371_11068383 3300013102 Unclassified 618
233 Ga0157370_10277101 3300013104 Bacteria 1550
234 Ga0157369_10015899 3300013105 Bacteria 8473
235 Ga0157369_10030605 3300013105 Bacteria 5935
236 Ga0157369_10337241 3300013105 Bacteria 1566
237 Ga0157374_10064787 3300013296 Bacteria 3431
238 Ga0157374_10437428 3300013296 Bacteria 1308
239 Ga0157378_10042799 3300013297 Bacteria 4020
240 Ga0163162_10013157 3300013306 Bacteria 8080
241 Ga0163162_10182777 3300013306 Bacteria 2223
242 Ga0163162_10758668 3300013306 Unclassified 1089
243 Ga0157372_10188303 3300013307 Bacteria 2390
244 Ga0157372_10330190 3300013307 Bacteria 1776
245 Ga0157372_10664034 3300013307 Bacteria 1214
246 Ga0157375_10053443 3300013308 Bacteria 3974
247 Ga0157375_10064006 3300013308 Bacteria 3660
248 Ga0157375_10079912 3300013308 Bacteria 3307
249 Ga0157375_10327243 3300013308 Bacteria 1697
250 Ga0157380_10011347 3300014326 Bacteria 6437
251 Ga0157380_10256063 3300014326 Bacteria 1587
252 Ga0182008_10045157 3300014497 Bacteria 2191
253 Ga0157377_10002581 3300014745 Bacteria 8046
254 Ga0157377_10251175 3300014745 Bacteria 1146
255 Ga0157377_10971350 3300014745 Unclassified 641
256 Ga0157379_10241779 3300014968 Bacteria 1637
257 Ga0157376_10009763 3300014969 Bacteria 6990
258 Ga0157376_10215052 3300014969 Bacteria 1777
259 Ga0182007_10436908 3300015262 Bacteria 503
260 Ga0163161_10458829 3300017792 Unclassified 1031
261 Ga0197907_11370037 3300020069 Bacteria 1541
262 Ga0206356_10052362 3300020070 Bacteria 4119
263 Ga0206356_11550560 3300020070 Bacteria 1061
264 Ga0207653_10241431 3300025885 Unclassified 690
265 Ga0207682_10065357 3300025893 Bacteria 1531
266 Ga0207692_10008231 3300025898 Bacteria 4310
267 Ga0207642_10000920 3300025899 Bacteria 9215
268 Ga0207642_10154232 3300025899 Bacteria 1226
269 Ga0207710_10024695 3300025900 Bacteria 2590
270 Ga0207680_10107183 3300025903 Unclassified 1806
271 Ga0207680_10141881 3300025903 Bacteria 1593
272 Ga0207685_10120699 3300025905 Bacteria 1150
273 Ga0207699_11048710 3300025906 Unclassified 603
274 Ga0207705_10138494 3300025909 Bacteria 1816
275 Ga0207705_10493179 3300025909 Bacteria 951
276 Ga0207654_10030254 3300025911 Bacteria 2971
277 Ga0207654_10129908 3300025911 Bacteria 1593
278 Ga0207654_10196375 3300025911 Bacteria 1326
279 Ga0207707_10041323 3300025912 Bacteria 4027
280 Ga0207707_10142166 3300025912 Bacteria 2098
281 Ga0207707_10264293 3300025912 Bacteria 1492
282 Ga0207695_10165788 3300025913 Bacteria 2138
283 Ga0207695_10638917 3300025913 Bacteria 945
284 Ga0207671_10045455 3300025914 Bacteria 3247
285 Ga0207671_10294693 3300025914 Bacteria 1281
286 Ga0207671_10339116 3300025914 Bacteria 1191
287 Ga0207693_10000351 3300025915 Bacteria 42500
288 Ga0207693_10002631 3300025915 Bacteria 15592
289 Ga0207693_10172266 3300025915 Bacteria 1704
290 Ga0207693_10177875 3300025915 Bacteria 1674
291 Ga0207663_10040101 3300025916 Bacteria 2844
292 Ga0207663_10047309 3300025916 Bacteria 2655
293 Ga0207663_11206080 3300025916 Unclassified 609
294 Ga0207660_10036394 3300025917 Bacteria 3422
295 Ga0207660_10099323 3300025917 Bacteria 2172
296 Ga0207660_10134111 3300025917 Bacteria 1888
297 Ga0207660_10885645 3300025917 Bacteria 728
298 Ga0207662_10436817 3300025918 Bacteria 893
299 Ga0207657_10006207 3300025919 Bacteria 12423
300 Ga0207657_10031436 3300025919 Bacteria 4808
301 Ga0207657_10037142 3300025919 Bacteria 4355
302 Ga0207649_10340396 3300025920 Bacteria 1107
303 Ga0207652_10043679 3300025921 Bacteria 3817
304 Ga0207652_10067331 3300025921 Bacteria 3105
305 Ga0207652_10130879 3300025921 Unclassified 2238
306 Ga0207681_10117549 3300025923 Bacteria 1945
307 Ga0207694_10192991 3300025924 Bacteria 1655
308 Ga0207694_11596379 3300025924 Bacteria 550
309 Ga0207687_10010487 3300025927 Bacteria 6053
310 Ga0207687_11591935 3300025927 Bacteria 561
311 Ga0207700_10052779 3300025928 Bacteria 3042
312 Ga0207700_10160909 3300025928 Bacteria 1864
313 Ga0207664_10003765 3300025929 Bacteria 10188
314 Ga0207664_10006073 3300025929 Bacteria 8272
315 Ga0207664_10289297 3300025929 Bacteria 1440
316 Ga0207664_10333508 3300025929 Bacteria 1340
317 Ga0207644_10036655 3300025931 Bacteria 3445
318 Ga0207690_10018832 3300025932 Bacteria 4240
319 Ga0207690_11081353 3300025932 Bacteria 668
320 Ga0207706_10009100 3300025933 Bacteria 9131
321 Ga0207686_10004754 3300025934 Bacteria 7286
322 Ga0207686_10559128 3300025934 Bacteria 895
323 Ga0207686_10650800 3300025934 Bacteria 834
324 Ga0207709_10002704 3300025935 Bacteria 10965
325 Ga0207670_10415652 3300025936 Bacteria 1078
326 Ga0207669_10001269 3300025937 Bacteria 10714
327 Ga0207704_10003566 3300025938 Bacteria 7070
328 Ga0207665_10000927 3300025939 Bacteria 19822
329 Ga0207665_10064161 3300025939 Archaea 2496
330 Ga0207691_10022363 3300025940 Bacteria 5964
331 Ga0207689_10622836 3300025942 Bacteria 908
332 Ga0207689_10891396 3300025942 Bacteria 751
333 Ga0207661_10059661 3300025944 Bacteria 3075
334 Ga0207661_10070430 3300025944 Bacteria 2855
335 Ga0207661_11769114 3300025944 Unclassified 563
336 Ga0207679_11198268 3300025945 Bacteria 697
337 Ga0207667_10536735 3300025949 Bacteria 1184
338 Ga0207651_10158382 3300025960 Bacteria 1772
339 Ga0207712_10002297 3300025961 Bacteria 12413
340 Ga0207712_10064751 3300025961 Bacteria 2607
341 Ga0207668_10011068 3300025972 Bacteria 5471
342 Ga0207640_10170972 3300025981 Unclassified 1619
343 Ga0207640_10295955 3300025981 Bacteria 1278
344 Ga0207640_10847553 3300025981 Bacteria 795
345 Ga0207658_10665337 3300025986 Bacteria 939
346 Ga0207658_10961808 3300025986 Bacteria 779
347 Ga0207677_10026165 3300026023 Bacteria 3654
348 Ga0207677_10269240 3300026023 Bacteria 1393
349 Ga0207677_10401823 3300026023 Unclassified 1162
350 Ga0207677_10409928 3300026023 Bacteria 1151
351 Ga0207639_10493919 3300026041 Bacteria 1117
352 Ga0207678_10005587 3300026067 Bacteria 11240
353 Ga0207678_10046356 3300026067 Bacteria 3759
354 Ga0207708_10002127 3300026075 Bacteria 14608
355 Ga0207708_10016108 3300026075 Bacteria 5615
356 Ga0207708_10152727 3300026075 Bacteria 1819
357 Ga0207708_10819062 3300026075 Bacteria 802
358 Ga0207702_10001791 3300026078 Bacteria 21150
359 Ga0207702_10011629 3300026078 Bacteria 7332
360 Ga0207702_10183753 3300026078 Unclassified 1927
361 Ga0207702_10347471 3300026078 Bacteria 1418
362 Ga0207641_11212846 3300026088 Bacteria 754
363 Ga0207648_10000637 3300026089 Bacteria 39335
364 Ga0207648_10032188 3300026089 Bacteria 4631
365 Ga0207676_10817681 3300026095 Bacteria 910
366 Ga0207676_11085409 3300026095 Bacteria 791
367 Ga0207675_100016317 3300026118 Bacteria 6933
368 Ga0207675_100149496 3300026118 Bacteria 2222
369 Ga0207675_101073946 3300026118 Archaea 824
370 Ga0207683_10004424 3300026121 Bacteria 12146
371 Ga0207683_10005491 3300026121 Bacteria 10862
372 Ga0207683_10111714 3300026121 Bacteria 2447
373 Ga0207683_10400372 3300026121 Bacteria 1263
374 Ga0207698_10485596 3300026142 Bacteria 1199
375 Ga0207698_11285652 3300026142 Bacteria 746
376 Ga0209998_10011927 3300027717 Bacteria 1804
377 Ga0207428_10006125 3300027907 Bacteria 11112
378 Ga0207428_10064822 3300027907 Bacteria 2884
379 Ga0207428_11046103 3300027907 Unclassified 572
380 Ga0268266_10152829 3300028379 Bacteria 2082
381 Ga0268265_10083651 3300028380 Bacteria 2528
382 Ga0268264_12595247 3300028381 Unclassified 511
383 Ga0265338_10110940 3300028800 Bacteria 2209
384 Ga0265338_10264581 3300028800 Bacteria 1263
385 Ga0265320_10212462 3300031240 Bacteria 863
386 Ga0265340_10175282 3300031247 Bacteria 971
387 Ga0265327_10055169 3300031251 Bacteria 2053
388 Ga0265327_10367963 3300031251 Bacteria 627
389 Ga0265342_10223219 3300031712 Bacteria 1014
390 Ga0307409_100071566 3300031995 Bacteria 2758
391 Ga0307409_100271424 3300031995 Bacteria 1562
392 Ga0307416_100125707 3300032002 Bacteria 2296
393 Ga0307416_100877708 3300032002 Unclassified 996
394 Ga0307414_10192164 3300032004 Bacteria 1653
395 Ga0307414_12313715 3300032004 Unclassified 502
396 Ga0307415_100697985 3300032126 Unclassified 915
397 Ga0307415_101284322 3300032126 Unclassified 693
398 Ga0373930_0055789 3300034816 Bacteria 872
399 Ga0373948_0106637 3300034817 Bacteria 665
400 Ga0373958_0095861 3300034819 Bacteria 690
401 Ga0373959_0002199 3300034820 Bacteria 3109
402 Ga0373951_0022425 3300035091 Bacteria 1454
403 Ga0373952_0038160 3300035092 Bacteria 1099
404 Ga0373932_0018488 3300035112 Bacteria 1803
405 Ga0373939_0011676 3300035114 Bacteria 2223
406 Ga0373941_0069107 3300035115 Bacteria 1168
407 Ga0373945_0025781 3300035116 Bacteria 2045
408 Ga0373953_0486522 3300035117 Bacteria 547
409 Ga0373956_0106929 3300035119 Bacteria 1301
410 Ga0373960_0006999 3300035121 Bacteria 2661
411 Ga0373960_0106113 3300035121 Bacteria 916
412 Ga0373960_0195460 3300035121 Unclassified 713
413 Ga0373943_0226879 3300035170 Bacteria 1042
414 Ga0373946_0115153 3300035171 Bacteria 1221
415 Ga0373942_0041536 3300035207 Bacteria 1258
416 Ga0373942_0096079 3300035207 Bacteria 900
417 Ga0373961_0005949 3300035241 Bacteria 2931
418 Ga0373962_0069544 3300035242 Bacteria 1050
419 Ga0373931_0013547 3300035691 Bacteria 3972
420 Ga0373931_0186535 3300035691 Unclassified 1231
421 Ga0373935_0054227 3300035692 Bacteria 2552
422 Ga0373947_0000992 3300035725 Bacteria 17358
423 Ga0373947_0087473 3300035725 Bacteria 1938
424 Ga0373925_0021650 3300037068 Bacteria 4686
425 Ga0373925_1067967 3300037068 Bacteria 664
426 Ga0395899_0046337 3300037312 Bacteria 3238
427 Ga0395899_0064623 3300037312 Bacteria 2690
428 Ga0395899_0804471 3300037312 Unclassified 580
429 Ga0395900_0036062 3300037418 Bacteria 5096
430 Ga0395900_0076897 3300037418 Bacteria 3430
431 Ga0395900_0288430 3300037418 Bacteria 1631
432 Ga0395900_0454071 3300037418 Bacteria 1237
433 Ga0395900_0711633 3300037418 Unclassified 937
434 Ga0395900_0925986 3300037418 Bacteria 794
435 Ga0395900_1047141 3300037418 Bacteria 735
436 Ga0395898_0006637 3300037466 Bacteria 12338
437 Ga0395898_0540839 3300037466 Bacteria 1107
438 Ga0395898_0749055 3300037466 Bacteria 918
439 Ga0395898_1318698 3300037466 Bacteria 651
440 Ga0395905_0006971 3300037471 Bacteria 11298
441 Ga0395905_1878265 3300037471 Bacteria 505
442 Ga0395901_0029113 3300038443 Bacteria 5683
443 Ga0395901_0086480 3300038443 Bacteria 3278
444 Ga0395901_0197345 3300038443 Bacteria 2110
445 Ga0395901_0202386 3300038443 Bacteria 2081
446 Ga0395901_0932106 3300038443 Unclassified 848
447 Ga0395901_1320641 3300038443 Bacteria 682
448 Ga0395901_1415130 3300038443 Unclassified 653
449 Ga0395901_1570409 3300038443 Bacteria 612
450 Ga0395901_1791978 3300038443 Bacteria 563
451 Ga0436362_1069002 3300039453 Bacteria 522
452 Ga0451833_1023371 3300041491 Bacteria 558
453 Ga0451839_1202250 3300041496 Archaea 918
454 Ga0451853_2887698 3300041512 Bacteria 660
455 Ga0439448_0014822 3300042005 Bacteria 2355
456 Ga0439450_173768 3300042008 Unclassified 570
457 Ga0439463_020636 3300042016 Unclassified 1644
458 Ga0466969_0001118 3300044656 Bacteria 14481
459 Ga0466965_0067924 3300044683 Bacteria 1789
460 Ga0466965_0166701 3300044683 Bacteria 1157
461 Ga0466961_0001935 3300044693 Bacteria 12908
462 Ga0466963_0004597 3300044694 Bacteria 8036
463 Ga0466963_0004971 3300044694 Bacteria 7757
464 Ga0466963_0014976 3300044694 Bacteria 4792
465 Ga0466963_0066363 3300044694 Bacteria 2420
466 Ga0466964_0005834 3300044706 Bacteria 4580
467 Ga0466964_0014955 3300044706 Bacteria 2955
468 Ga0466964_0022943 3300044706 Bacteria 2424
469 Ga0466964_0044812 3300044706 Bacteria 1798
470 Ga0466964_0245174 3300044706 Bacteria 881
471 Ga0466971_0054777 3300044719 Bacteria 1797
472 Ga0466971_0070980 3300044719 Bacteria 1582
473 Ga0466971_0090114 3300044719 Bacteria 1404
474 Ga0466968_0001349 3300044735 Bacteria 8764
475 Ga0466968_0094778 3300044735 Bacteria 1327
476 Ga0466970_0021083 3300044765 Bacteria 3391
477 Ga0466957_0016743 3300044842 Bacteria 4288
478 Ga0466957_0026155 3300044842 Bacteria 3461
479 Ga0466957_0125106 3300044842 Bacteria 1642
480 Ga0466957_1219846 3300044842 Unclassified 544
481 Ga0466960_0264640 3300044901 Unclassified 959
482 Ga0466960_0726035 3300044901 Bacteria 597
483 Ga0466960_0800498 3300044901 Bacteria 571
484 Ga0466959_0042039 3300045049 Bacteria 3372
485 Ga0451576_0167075 3300045051 Bacteria 2296
486 Ga0451576_1156875 3300045051 Bacteria 809
487 Ga0451576_1218535 3300045051 Unclassified 786
488 Ga0466958_0192142 3300045836 Bacteria 1298
489 Ga0466958_0398791 3300045836 Unclassified 888
490 Ga0466967_0004236 3300045976 Bacteria 9626
491 Ga0466967_0060841 3300045976 Bacteria 3348
492 Ga0466967_0063694 3300045976 Bacteria 3277
493 Ga0466967_0077846 3300045976 Bacteria 2986
494 Ga0466967_0091162 3300045976 Bacteria 2769
495 Ga0466967_0107182 3300045976 Bacteria 2562
496 Ga0466967_0119678 3300045976 Bacteria 2431
497 Ga0466967_0190339 3300045976 Bacteria 1938
498 Ga0466967_0192205 3300045976 Bacteria 1929
499 Ga0466967_0262833 3300045976 Bacteria 1651
500 Ga0466967_0278513 3300045976 Bacteria 1604
501 Ga0466967_0528081 3300045976 Bacteria 1160
502 Ga0466967_0762618 3300045976 Bacteria 960
503 Ga0466967_0784797 3300045976 Unclassified 945
504 Ga0495603_0001721 3300046455 Bacteria 12889
505 Ga0495603_0062501 3300046455 Bacteria 2198
506 Ga0495603_0253464 3300046455 Bacteria 1013
507 Ga0495590_0237764 3300046457 Unclassified 676
508 Ga0495629_0668028 3300046459 Bacteria 691
509 Ga0495641_0001084 3300046461 Bacteria 23453
510 Ga0495641_0021952 3300046461 Bacteria 3203
511 Ga0495641_0055377 3300046461 Bacteria 1801
512 Ga0495641_0201339 3300046461 Unclassified 892
513 Ga0495651_0538645 3300046462 Bacteria 743
514 Ga0495651_0650843 3300046462 Bacteria 661
515 Ga0495580_0131112 3300046472 Bacteria 1739
516 Ga0495580_0424480 3300046472 Unclassified 894
517 Ga0495582_0007104 3300046473 Bacteria 6218
518 Ga0495582_0077880 3300046473 Bacteria 1839
519 Ga0495582_0104420 3300046473 Bacteria 1588
520 Ga0495639_0057600 3300046475 Bacteria 1776
521 Ga0495639_0225822 3300046475 Unclassified 922
522 Ga0495584_0224004 3300046491 Bacteria 956
523 Ga0495585_0091213 3300046492 Bacteria 1641
524 Ga0495585_0383392 3300046492 Unclassified 679
525 Ga0495594_0016808 3300046499 Bacteria 3859
526 Ga0495594_0107824 3300046499 Bacteria 1569
527 Ga0495596_0261276 3300046500 Bacteria 672
528 Ga0495607_0202070 3300046501 Bacteria 983
529 Ga0495607_0289992 3300046501 Unclassified 774
530 Ga0495608_0558017 3300046511 Bacteria 690
531 Ga0495630_1219727 3300046517 Bacteria 568
532 Ga0495663_0038116 3300046525 Bacteria 1452
533 Ga0495663_0229906 3300046525 Bacteria 654
534 Ga0495665_0623639 3300046531 Unclassified 538
535 Ga0495640_0485829 3300046533 Bacteria 752
536 Ga0495586_0204435 3300046535 Bacteria 1120
537 Ga0495598_0382133 3300046537 Bacteria 547
538 Ga0495609_0102457 3300046538 Bacteria 1240
539 Ga0495656_0230852 3300046615 Unclassified 928
540 Ga0495656_0368719 3300046615 Unclassified 747
541 Ga0495668_0615762 3300046616 Bacteria 600
542 Ga0495659_0209015 3300046664 Bacteria 803
543 Ga0495661_0141598 3300046665 Bacteria 1308
544 Ga0495588_0000750 3300046674 Bacteria 14820
545 Ga0495588_0121800 3300046674 Bacteria 1375
546 Ga0495588_0138110 3300046674 Bacteria 1287
547 Ga0495657_0749466 3300046675 Unclassified 560
548 Ga0495647_0071578 3300046681 Unclassified 1389
549 Ga0495658_0039083 3300046683 Bacteria 2631
550 Ga0495658_0116381 3300046683 Bacteria 1612
551 Ga0495658_0889737 3300046683 Unclassified 569
552 Ga0495671_0652782 3300046692 Bacteria 500
553 Ga0495589_0157206 3300046794 Unclassified 1084
554 Ga0495581_0010410 3300047315 Bacteria 5378
555 Ga0495604_0330054 3300047317 Bacteria 1018
556 Ga0495636_0542915 3300047318 Unclassified 565
557 Ga0495674_0358383 3300047319 Bacteria 1183
558 Ga0495676_0001211 3300047321 Bacteria 22079
559 Ga0495676_0069244 3300047321 Bacteria 2723
560 Ga0495676_0086812 3300047321 Bacteria 2353
561 Ga0495684_0171007 3300047471 Unclassified 1616
562 Ga0495684_0542691 3300047471 Bacteria 793
563 Ga0496100_0002091 3300048903 Bacteria 10050
564 Ga0496100_0073853 3300048903 Bacteria 2284
565 Ga0496100_0667722 3300048903 Bacteria 810
566 Ga0496100_0781387 3300048903 Bacteria 747
567 Ga0496101_0007808 3300048904 Bacteria 6955
568 Ga0496101_0110777 3300048904 Bacteria 2066
569 Ga0496101_0176060 3300048904 Bacteria 1645
570 Ga0496102_0007668 3300048905 Bacteria 9220
571 Ga0496102_0008004 3300048905 Bacteria 9034
572 Ga0496102_0049344 3300048905 Bacteria 3829
573 Ga0496102_0075844 3300048905 Bacteria 3091
574 Ga0496102_0676423 3300048905 Bacteria 955
575 Ga0496103_0001950 3300048906 Bacteria 13339
576 Ga0496103_0011554 3300048906 Bacteria 5235
577 Ga0496103_0013328 3300048906 Bacteria 4873
578 Ga0496103_0016165 3300048906 Bacteria 4454
579 Ga0496103_0125660 3300048906 Bacteria 1636
580 Ga0496104_0137659 3300048907 Bacteria 2346
581 Ga0496104_0423965 3300048907 Bacteria 1242
582 Ga0496104_0510315 3300048907 Unclassified 1113
583 Ga0496105_0031426 3300048908 Bacteria 4352
584 Ga0496105_0229917 3300048908 Bacteria 1507
585 Ga0496105_0371377 3300048908 Bacteria 1139
586 Ga0496105_0407483 3300048908 Bacteria 1078
587 Ga0496105_0833619 3300048908 Bacteria 699
588 Ga0496105_1284314 3300048908 Bacteria 535
589 Ga0496106_0019806 3300048909 Bacteria 4988
590 Ga0496106_0072264 3300048909 Bacteria 2638
591 Ga0496106_0295169 3300048909 Bacteria 1299
592 Ga0496106_0798606 3300048909 Bacteria 749
593 Ga0496107_0004683 3300048910 Bacteria 9288
594 Ga0496107_0043009 3300048910 Bacteria 3245
595 Ga0496107_0053450 3300048910 Bacteria 2914
596 Ga0496107_0056189 3300048910 Bacteria 2844
597 Ga0496107_0092092 3300048910 Bacteria 2216
598 Ga0496107_0201237 3300048910 Bacteria 1480
599 Ga0496107_0425112 3300048910 Bacteria 988
600 Ga0496107_1287947 3300048910 Bacteria 523
601 Ga0496108_0003225 3300048911 Bacteria 13114
602 Ga0496108_0019238 3300048911 Bacteria 5605
603 Ga0496108_1398000 3300048911 Bacteria 585
604 Ga0496109_0003517 3300048912 Bacteria 13086
605 Ga0496109_0047881 3300048912 Bacteria 3888
606 Ga0496109_0065765 3300048912 Bacteria 3319
607 Ga0496109_1196950 3300048912 Bacteria 696
608 Ga0496110_0009067 3300048913 Bacteria 8030
609 Ga0496110_0040108 3300048913 Bacteria 4080
610 Ga0496110_0212550 3300048913 Bacteria 1758
611 Ga0496110_0531356 3300048913 Bacteria 1070
612 Ga0496110_0803347 3300048913 Bacteria 845
613 Ga0496110_1245146 3300048913 Bacteria 653
614 Ga0496111_0005326 3300048914 Bacteria 8220
615 Ga0496111_0031394 3300048914 Bacteria 3784
616 Ga0496111_0042948 3300048914 Bacteria 3248
617 Ga0496111_1016310 3300048914 Bacteria 594
618 Ga0496112_0004871 3300048915 Bacteria 11475
619 Ga0496112_0060726 3300048915 Bacteria 3725
620 Ga0496112_0082257 3300048915 Bacteria 3185
621 Ga0496112_0093344 3300048915 Bacteria 2980
622 Ga0496112_0222627 3300048915 Bacteria 1842
623 Ga0496113_0047407 3300048916 Bacteria 3193
624 Ga0496113_0660998 3300048916 Unclassified 835
625 Ga0496114_0001279 3300048917 Bacteria 19001
626 Ga0496114_0331389 3300048917 Unclassified 1345
627 Ga0496114_0444934 3300048917 Bacteria 1147
628 Ga0496115_0008515 3300048918 Bacteria 7587
629 Ga0496115_0180090 3300048918 Bacteria 1747
630 Ga0496115_0181634 3300048918 Bacteria 1739
631 Ga0496115_0275962 3300048918 Unclassified 1380
632 Ga0496115_0284180 3300048918 Bacteria 1358
633 Ga0496115_0713883 3300048918 Bacteria 787
634 Ga0496115_1210349 3300048918 Bacteria 567
635 Ga0501067_0010506 3300049583 Bacteria 5126
636 Ga0501069_0044716 3300049585 Bacteria 2452
637 Ga0501069_0211220 3300049585 Bacteria 1126
638 Ga0501070_0486172 3300049586 Bacteria 993
639 nmdc:mga04h51_305385_c1 3300050495 Bacteria 649
640 nmdc:mga05p37_1143907_c1 3300050507 Unclassified 810
641 nmdc:mga09592_340539_c1 3300050508 Bacteria 1298
642 nmdc:mga06r32_172321_c1 3300050510 Unclassified 2148
643 nmdc:mga08y16_129259_c1 3300050511 Bacteria 2628
644 nmdc:mga08y16_28704_c1 3300050511 Bacteria 5864
645 nmdc:mga08y16_554487_c1 3300050511 Unclassified 1163
646 nmdc:mga0n895_124533_c1 3300050512 Bacteria 2600
647 nmdc:mga0n895_4355_c1 3300050512 Bacteria 11608
648 nmdc:mga0n895_769780_c1 3300050512 Bacteria 955
649 nmdc:mga0n895_798995_c1 3300050512 Bacteria 934
650 nmdc:mga0rr50_17967_c1 3300050513 Bacteria 4738
651 nmdc:mga0rr50_63024_c1 3300050513 Bacteria 2799
652 nmdc:mga08x19_15363_c1 3300050514 Bacteria 4658
653 nmdc:mga0a205_4902_c1 3300050515 Bacteria 12033
654 nmdc:mga0a205_575505_c1 3300050515 Unclassified 980
655 Ga0466962_0004259 3300061719 Bacteria 6854
656 Ga0466962_0172813 3300061719 Bacteria 1052
657 Ga0530510_0057000 3300061734 Bacteria 2823
658 Ga0068856_100143335
659 JGI24747J21853_1001200
660 JGI24743J22301_10032513
661 JGI24738J21930_10050068
662 JGI24744J21845_10000202
663 JGI24742J22300_10002689
664 Ga0070658_10056823
665 Ga0070658_10138973
666 Ga0070658_10477223
667 Ga0070683_100039464
668 Ga0070683_100557643
669 Ga0070690_100012303
670 Ga0070677_10121711
671 Ga0068869_100087534
672 Ga0068869_101245994
673 Ga0068869_101626687
674 Ga0070666_10025444
675 Ga0070680_100022230
676 Ga0070680_100113619
677 Ga0070680_100211590
678 Ga0070680_101398993
679 Ga0070682_100001727
680 Ga0070682_100016652
681 Ga0068868_100034748
682 Ga0068868_100119059
683 Ga0068868_100416526
684 Ga0070660_100003251
685 Ga0070660_100082004
686 Ga0070660_100340188
687 Ga0070660_100887003
688 Ga0070689_100005024
689 Ga0070691_10020490
690 Ga0070691_10115979
691 Ga0070691_10222501
692 Ga0070687_100044161
693 Ga0070687_100621337
694 Ga0070692_10011016
695 Ga0070692_10510606
696 Ga0070668_100003491
697 Ga0070669_100098005
698 Ga0070669_100130401
699 Ga0070671_100051609
700 Ga0070671_100171875
701 Ga0070671_100577041
702 Ga0070674_100015115
703 Ga0070674_100024374
704 Ga0070673_100138294
705 Ga0070688_100024568
706 Ga0070688_100769614
707 Ga0070688_100782055
708 Ga0070659_100067228
709 Ga0070659_100068682
710 Ga0070659_100198257
711 Ga0070667_100838915
712 Ga0070709_10041089
713 Ga0070709_10048644
714 Ga0070709_10203324
715 Ga0070709_10387366
716 Ga0070714_100001615
717 Ga0070714_100004161
718 Ga0070714_100007814
719 Ga0070713_100010349
720 Ga0070713_100046856
721 Ga0070713_100063409
722 Ga0070701_10000256
723 Ga0070701_10032314
724 Ga0070711_100003709
725 Ga0070711_100010992
726 Ga0070705_100004172
727 Ga0070705_100052988
728 Ga0070705_100056446
729 Ga0070705_100104042
730 Ga0070705_100237662
731 Ga0070700_100000501
732 Ga0070700_100103151
733 Ga0070700_100376944
734 Ga0070694_100092578
735 Ga0070694_100097957
736 Ga0070694_100317611
737 Ga0070708_101385503
738 Ga0070663_100002744
739 Ga0070663_100010972
740 Ga0070678_100007975
741 Ga0070678_100035759
742 Ga0070678_100106715
743 Ga0070662_100101740
744 Ga0070681_10078241
745 Ga0070681_10291125
746 Ga0070681_10407128
747 Ga0068867_100002692
748 Ga0068867_100178410
749 Ga0068867_100268857
750 Ga0070685_10019902
751 Ga0070685_10042476
752 Ga0070706_100603751
753 Ga0070698_100108843
754 Ga0070698_100380580
755 Ga0070699_100616545
756 Ga0070699_101786060
757 Ga0070679_100032075
758 Ga0070679_100063066
759 Ga0070679_100158157
760 Ga0070679_100174735
761 Ga0070679_100463422
762 Ga0070679_101666351
763 Ga0070684_100278586
764 Ga0070684_101780559
765 Ga0068853_100030330
766 Ga0070672_100469993
767 Ga0070686_100014177
768 Ga0070686_100016659
769 Ga0070686_100044913
770 Ga0070695_100001141
771 Ga0070695_100142910
772 Ga0070695_100218475
773 Ga0070695_100855733
774 Ga0070696_100018983
775 Ga0070696_100034855
776 Ga0070696_100105810
777 Ga0070693_100053414
778 Ga0070693_100053663
779 Ga0070693_100629478
780 Ga0070693_101012975
781 Ga0070665_100152482
782 Ga0070704_100038579
783 Ga0070704_100047488
784 Ga0068855_100527793
785 Ga0068855_101345704
786 Ga0070664_100235906
787 Ga0070664_101425841
788 Ga0068854_100064201
789 Ga0068854_100174826
790 Ga0068854_100665044
791 Ga0068856_100009072
792 Ga0068856_100060019
793 Ga0070702_100067827
794 Ga0070702_101365262
795 Ga0068852_100004631
796 Ga0068852_100321871
797 Ga0068859_100139234
798 Ga0068859_100949869
799 Ga0068864_101854398
800 Ga0068866_10016350
801 Ga0068866_10452189
802 Ga0068861_100009376
803 Ga0068861_100178050
804 Ga0068861_100383915
805 Ga0068851_10458888
806 Ga0068863_101165769
807 Ga0068860_100063401
808 Ga0068862_100040614
809 Ga0068862_100221876
810 Ga0081455_10007728
811 Ga0081540_1002900
812 Ga0081540_1262079
813 Ga0081539_10014843
814 Ga0070717_10002428
815 Ga0070717_10006179
816 Ga0075432_10125501
817 Ga0070715_10007258
818 Ga0070715_10062343
819 Ga0070715_10067609
820 Ga0070716_100018234
821 Ga0070716_100964247
822 Ga0070712_100005301
823 Ga0070712_100289366
824 Ga0075367_10155356
825 Ga0097621_100044364
826 Ga0097621_100132154
827 Ga0068871_100042510
828 Ga0075428_101129694
829 Ga0075428_101282939
830 Ga0075431_100162024
831 Ga0075433_10062525
832 Ga0075433_11426143
833 Ga0075434_100023820
834 Ga0075434_100144728
835 Ga0075429_101656986
836 Ga0068865_100002886
837 Ga0068865_101174158
838 Ga0075436_100018494
839 Ga0075436_100523140
840 Ga0097620_100139239
841 Ga0097620_100949952
842 Ga0075435_100049436
843 Ga0105250_10272525
844 Ga0105240_10021245
845 Ga0105240_10850695
846 Ga0105240_11247523
847 Ga0111539_10108143
848 Ga0111539_10737666
849 Ga0111539_11497465
850 Ga0111539_11817119
851 Ga0111539_12174552
852 Ga0105245_10005580
853 Ga0105245_10028788
854 Ga0105245_10030025
855 Ga0105245_10269554
856 Ga0105245_11772123
857 Ga0105247_10021826
858 Ga0114129_10079841
859 Ga0114129_10996583
860 Ga0105243_10003859
861 Ga0105243_10020436
862 Ga0105243_10477360
863 Ga0105241_10084203
864 Ga0105241_10111169
865 Ga0105241_10201890
866 Ga0105241_10402943
867 Ga0105241_11703208
868 Ga0105242_10001491
869 Ga0105242_10124905
870 Ga0105242_10344796
871 Ga0105242_12760440
872 Ga0105248_10020234
873 Ga0105248_10686652
874 Ga0105237_10022945
875 Ga0105237_10146707
876 Ga0105237_10328245
877 Ga0105238_10088524
878 Ga0105238_10093465
879 Ga0105238_10113440
880 Ga0105249_10001367
881 Ga0105249_10088354
882 Ga0105239_10010990
883 Ga0105239_10088652
884 Ga0105239_10235874
885 Ga0105239_12506566
886 Ga0105246_10137561
887 Ga0157342_1009904
888 Ga0157371_10110552
889 Ga0157371_11068383
890 Ga0157370_10277101
891 Ga0157369_10015899
892 Ga0157369_10030605
893 Ga0157369_10337241
894 Ga0157374_10064787
895 Ga0157374_10437428
896 Ga0157378_10042799
897 Ga0163162_10013157
898 Ga0163162_10182777
899 Ga0163162_10758668
900 Ga0157372_10188303
901 Ga0157372_10330190
902 Ga0157372_10664034
903 Ga0157375_10053443
904 Ga0157375_10064006
905 Ga0157375_10079912
906 Ga0157375_10327243
907 Ga0157380_10011347
908 Ga0157380_10256063
909 Ga0182008_10045157
910 Ga0157377_10002581
911 Ga0157377_10251175
912 Ga0157377_10971350
913 Ga0157379_10241779
914 Ga0157376_10009763
915 Ga0157376_10215052
916 Ga0182007_10436908
917 Ga0163161_10458829
918 Ga0197907_11370037
919 Ga0206356_10052362
920 Ga0206356_11550560
921 Ga0207653_10241431
922 Ga0207682_10065357
923 Ga0207692_10008231
924 Ga0207642_10000920
925 Ga0207642_10154232
926 Ga0207710_10024695
927 Ga0207680_10107183
928 Ga0207680_10141881
929 Ga0207685_10120699
930 Ga0207699_11048710
931 Ga0207705_10138494
932 Ga0207705_10493179
933 Ga0207654_10030254
934 Ga0207654_10129908
935 Ga0207654_10196375
936 Ga0207707_10041323
937 Ga0207707_10142166
938 Ga0207707_10264293
939 Ga0207695_10165788
940 Ga0207695_10638917
941 Ga0207671_10045455
942 Ga0207671_10294693
943 Ga0207671_10339116
944 Ga0207693_10000351
945 Ga0207693_10002631
946 Ga0207693_10172266
947 Ga0207693_10177875
948 Ga0207663_10040101
949 Ga0207663_10047309
950 Ga0207663_11206080
951 Ga0207660_10036394
952 Ga0207660_10099323
953 Ga0207660_10134111
954 Ga0207660_10885645
955 Ga0207662_10436817
956 Ga0207657_10006207
957 Ga0207657_10031436
958 Ga0207657_10037142
959 Ga0207649_10340396
960 Ga0207652_10043679
961 Ga0207652_10067331
962 Ga0207652_10130879
963 Ga0207681_10117549
964 Ga0207694_10192991
965 Ga0207694_11596379
966 Ga0207687_10010487
967 Ga0207687_11591935
968 Ga0207700_10052779
969 Ga0207700_10160909
970 Ga0207664_10003765
971 Ga0207664_10006073
972 Ga0207664_10289297
973 Ga0207664_10333508
974 Ga0207644_10036655
975 Ga0207690_10018832
976 Ga0207690_11081353
977 Ga0207706_10009100
978 Ga0207686_10004754
979 Ga0207686_10559128
980 Ga0207686_10650800
981 Ga0207709_10002704
982 Ga0207670_10415652
983 Ga0207669_10001269
984 Ga0207704_10003566
985 Ga0207665_10000927
986 Ga0207665_10064161
987 Ga0207691_10022363
988 Ga0207689_10622836
989 Ga0207689_10891396
990 Ga0207661_10059661
991 Ga0207661_10070430
992 Ga0207661_11769114
993 Ga0207679_11198268
994 Ga0207667_10536735
995 Ga0207651_10158382
996 Ga0207712_10002297
997 Ga0207712_10064751
998 Ga0207668_10011068
999 Ga0207640_10170972
1000 Ga0207640_10295955
1001 Ga0207640_10847553
1002 Ga0207658_10665337
1003 Ga0207658_10961808
1004 Ga0207677_10026165
1005 Ga0207677_10269240
1006 Ga0207677_10401823
1007 Ga0207677_10409928
1008 Ga0207639_10493919
1009 Ga0207678_10005587
1010 Ga0207678_10046356
1011 Ga0207708_10002127
1012 Ga0207708_10016108
1013 Ga0207708_10152727
1014 Ga0207708_10819062
1015 Ga0207702_10001791
1016 Ga0207702_10011629
1017 Ga0207702_10183753
1018 Ga0207702_10347471
1019 Ga0207641_11212846
1020 Ga0207648_10000637
1021 Ga0207648_10032188
1022 Ga0207676_10817681
1023 Ga0207676_11085409
1024 Ga0207675_100016317
1025 Ga0207675_100149496
1026 Ga0207675_101073946
1027 Ga0207683_10004424
1028 Ga0207683_10005491
1029 Ga0207683_10111714
1030 Ga0207683_10400372
1031 Ga0207698_10485596
1032 Ga0207698_11285652
1033 Ga0209998_10011927
1034 Ga0207428_10006125
1035 Ga0207428_10064822
1036 Ga0207428_11046103
1037 Ga0268266_10152829
1038 Ga0268265_10083651
1039 Ga0268264_12595247
1040 Ga0265338_10110940
1041 Ga0265338_10264581
1042 Ga0265320_10212462
1043 Ga0265340_10175282
1044 Ga0265327_10055169
1045 Ga0265327_10367963
1046 Ga0265342_10223219
1047 Ga0307409_100071566
1048 Ga0307409_100271424
1049 Ga0307416_100125707
1050 Ga0307416_100877708
1051 Ga0307414_10192164
1052 Ga0307414_12313715
1053 Ga0307415_100697985
1054 Ga0307415_101284322
1055 Ga0373930_0055789
1056 Ga0373948_0106637
1057 Ga0373958_0095861
1058 Ga0373959_0002199
1059 Ga0373951_0022425
1060 Ga0373952_0038160
1061 Ga0373932_0018488
1062 Ga0373939_0011676
1063 Ga0373941_0069107
1064 Ga0373945_0025781
1065 Ga0373953_0486522
1066 Ga0373956_0106929
1067 Ga0373960_0006999
1068 Ga0373960_0106113
1069 Ga0373960_0195460
1070 Ga0373943_0226879
1071 Ga0373946_0115153
1072 Ga0373942_0041536
1073 Ga0373942_0096079
1074 Ga0373961_0005949
1075 Ga0373962_0069544
1076 Ga0373931_0013547
1077 Ga0373931_0186535
1078 Ga0373935_0054227
1079 Ga0373947_0000992
1080 Ga0373947_0087473
1081 Ga0373925_0021650
1082 Ga0373925_1067967
1083 Ga0395899_0046337
1084 Ga0395899_0064623
1085 Ga0395899_0804471
1086 Ga0395900_0036062
1087 Ga0395900_0076897
1088 Ga0395900_0288430
1089 Ga0395900_0454071
1090 Ga0395900_0711633
1091 Ga0395900_0925986
1092 Ga0395900_1047141
1093 Ga0395898_0006637
1094 Ga0395898_0540839
1095 Ga0395898_0749055
1096 Ga0395898_1318698
1097 Ga0395905_0006971
1098 Ga0395905_1878265
1099 Ga0395901_0029113
1100 Ga0395901_0086480
1101 Ga0395901_0197345
1102 Ga0395901_0202386
1103 Ga0395901_0932106
1104 Ga0395901_1320641
1105 Ga0395901_1415130
1106 Ga0395901_1570409
1107 Ga0395901_1791978
1108 Ga0436362_1069002
1109 Ga0451833_1023371
1110 Ga0451839_1202250
1111 Ga0451853_2887698
1112 Ga0439448_0014822
1113 Ga0439450_173768
1114 Ga0439463_020636
1115 Ga0466969_0001118
1116 Ga0466965_0067924
1117 Ga0466965_0166701
1118 Ga0466961_0001935
1119 Ga0466963_0004597
1120 Ga0466963_0004971
1121 Ga0466963_0014976
1122 Ga0466963_0066363
1123 Ga0466964_0005834
1124 Ga0466964_0014955
1125 Ga0466964_0022943
1126 Ga0466964_0044812
1127 Ga0466964_0245174
1128 Ga0466971_0054777
1129 Ga0466971_0070980
1130 Ga0466971_0090114
1131 Ga0466968_0001349
1132 Ga0466968_0094778
1133 Ga0466970_0021083
1134 Ga0466957_0016743
1135 Ga0466957_0026155
1136 Ga0466957_0125106
1137 Ga0466957_1219846
1138 Ga0466960_0264640
1139 Ga0466960_0726035
1140 Ga0466960_0800498
1141 Ga0466959_0042039
1142 Ga0451576_0167075
1143 Ga0451576_1156875
1144 Ga0451576_1218535
1145 Ga0466958_0192142
1146 Ga0466958_0398791
1147 Ga0466967_0004236
1148 Ga0466967_0060841
1149 Ga0466967_0063694
1150 Ga0466967_0077846
1151 Ga0466967_0091162
1152 Ga0466967_0107182
1153 Ga0466967_0119678
1154 Ga0466967_0190339
1155 Ga0466967_0192205
1156 Ga0466967_0262833
1157 Ga0466967_0278513
1158 Ga0466967_0528081
1159 Ga0466967_0762618
1160 Ga0466967_0784797
1161 Ga0495603_0001721
1162 Ga0495603_0062501
1163 Ga0495603_0253464
1164 Ga0495590_0237764
1165 Ga0495629_0668028
1166 Ga0495641_0001084
1167 Ga0495641_0021952
1168 Ga0495641_0055377
1169 Ga0495641_0201339
1170 Ga0495651_0538645
1171 Ga0495651_0650843
1172 Ga0495580_0131112
1173 Ga0495580_0424480
1174 Ga0495582_0007104
1175 Ga0495582_0077880
1176 Ga0495582_0104420
1177 Ga0495639_0057600
1178 Ga0495639_0225822
1179 Ga0495584_0224004
1180 Ga0495585_0091213
1181 Ga0495585_0383392
1182 Ga0495594_0016808
1183 Ga0495594_0107824
1184 Ga0495596_0261276
1185 Ga0495607_0202070
1186 Ga0495607_0289992
1187 Ga0495608_0558017
1188 Ga0495630_1219727
1189 Ga0495663_0038116
1190 Ga0495663_0229906
1191 Ga0495665_0623639
1192 Ga0495640_0485829
1193 Ga0495586_0204435
1194 Ga0495598_0382133
1195 Ga0495609_0102457
1196 Ga0495656_0230852
1197 Ga0495656_0368719
1198 Ga0495668_0615762
1199 Ga0495659_0209015
1200 Ga0495661_0141598
1201 Ga0495588_0000750
1202 Ga0495588_0121800
1203 Ga0495588_0138110
1204 Ga0495657_0749466
1205 Ga0495647_0071578
1206 Ga0495658_0039083
1207 Ga0495658_0116381
1208 Ga0495658_0889737
1209 Ga0495671_0652782
1210 Ga0495589_0157206
1211 Ga0495581_0010410
1212 Ga0495604_0330054
1213 Ga0495636_0542915
1214 Ga0495674_0358383
1215 Ga0495676_0001211
1216 Ga0495676_0069244
1217 Ga0495676_0086812
1218 Ga0495684_0171007
1219 Ga0495684_0542691
1220 Ga0496100_0002091
1221 Ga0496100_0073853
1222 Ga0496100_0667722
1223 Ga0496100_0781387
1224 Ga0496101_0007808
1225 Ga0496101_0110777
1226 Ga0496101_0176060
1227 Ga0496102_0007668
1228 Ga0496102_0008004
1229 Ga0496102_0049344
1230 Ga0496102_0075844
1231 Ga0496102_0676423
1232 Ga0496103_0001950
1233 Ga0496103_0011554
1234 Ga0496103_0013328
1235 Ga0496103_0016165
1236 Ga0496103_0125660
1237 Ga0496104_0137659
1238 Ga0496104_0423965
1239 Ga0496104_0510315
1240 Ga0496105_0031426
1241 Ga0496105_0229917
1242 Ga0496105_0371377
1243 Ga0496105_0407483
1244 Ga0496105_0833619
1245 Ga0496105_1284314
1246 Ga0496106_0019806
1247 Ga0496106_0072264
1248 Ga0496106_0295169
1249 Ga0496106_0798606
1250 Ga0496107_0004683
1251 Ga0496107_0043009
1252 Ga0496107_0053450
1253 Ga0496107_0056189
1254 Ga0496107_0092092
1255 Ga0496107_0201237
1256 Ga0496107_0425112
1257 Ga0496107_1287947
1258 Ga0496108_0003225
1259 Ga0496108_0019238
1260 Ga0496108_1398000
1261 Ga0496109_0003517
1262 Ga0496109_0047881
1263 Ga0496109_0065765
1264 Ga0496109_1196950
1265 Ga0496110_0009067
1266 Ga0496110_0040108
1267 Ga0496110_0212550
1268 Ga0496110_0531356
1269 Ga0496110_0803347
1270 Ga0496110_1245146
1271 Ga0496111_0005326
1272 Ga0496111_0031394
1273 Ga0496111_0042948
1274 Ga0496111_1016310
1275 Ga0496112_0004871
1276 Ga0496112_0060726
1277 Ga0496112_0082257
1278 Ga0496112_0093344
1279 Ga0496112_0222627
1280 Ga0496113_0047407
1281 Ga0496113_0660998
1282 Ga0496114_0001279
1283 Ga0496114_0331389
1284 Ga0496114_0444934
1285 Ga0496115_0008515
1286 Ga0496115_0180090
1287 Ga0496115_0181634
1288 Ga0496115_0275962
1289 Ga0496115_0284180
1290 Ga0496115_0713883
1291 Ga0496115_1210349
1292 Ga0501067_0010506
1293 Ga0501069_0044716
1294 Ga0501069_0211220
1295 Ga0501070_0486172
1296 nmdc:mga04h51_305385_c1
1297 nmdc:mga05p37_1143907_c1
1298 nmdc:mga09592_340539_c1
1299 nmdc:mga06r32_172321_c1
1300 nmdc:mga08y16_129259_c1
1301 nmdc:mga08y16_28704_c1
1302 nmdc:mga08y16_554487_c1
1303 nmdc:mga0n895_124533_c1
1304 nmdc:mga0n895_4355_c1
1305 nmdc:mga0n895_769780_c1
1306 nmdc:mga0n895_798995_c1
1307 nmdc:mga0rr50_17967_c1
1308 nmdc:mga0rr50_63024_c1
1309 nmdc:mga08x19_15363_c1
1310 nmdc:mga0a205_4902_c1
1311 nmdc:mga0a205_575505_c1
1312 Ga0466962_0004259
1313 Ga0466962_0172813
1314 Ga0530510_0057000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03459

TOBE

TOBE domain

76

139

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

22

69

0.97

PF00376

MerR

MerR family regulatory protein

23

59

0.95

PF12728

HTH_17

Helix-turn-helix domain

21

70

0.94

Map