F473022

General Info

Members Datasets Scaffolds Average Seq Length
656 277 1312 184

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10483322|Ga0207699_104833222
Length 181
Sequence MNPEIQQRAARVRLLLMDVDGVLTDGLIYNVPSPAEPHIAETKGFNSQDGIALQWLTWCGIHTGIISGRVSKAAEVRAEQVGMTYVYQGHIEKLPILQDIIARSNLAADAIAYMGDDLTDVPVMRSVGLALATANARPEVKRVAHYVTLVSGGAGAVREVAELLLEAHGRWADILRKYGVE

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 0
Rhizoplane 0.46
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 24.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10483322 3300025906 Bacteria 892
2 Ga0070658_10006989 3300005327 Bacteria 9116
3 Ga0070658_10016641 3300005327 Bacteria 5885
4 Ga0070658_10909089 3300005327 Bacteria 765
5 Ga0070683_100000311 3300005329 Bacteria 33501
6 Ga0070683_100020847 3300005329 Bacteria 5841
7 Ga0070683_100402661 3300005329 Unclassified 1305
8 Ga0070670_100903434 3300005331 Bacteria 801
9 Ga0070677_10257320 3300005333 Unclassified 869
10 Ga0068869_100403166 3300005334 Unclassified 1125
11 Ga0068869_100420981 3300005334 Bacteria 1102
12 Ga0068869_101065409 3300005334 Unclassified 706
13 Ga0070666_10003261 3300005335 Bacteria 9853
14 Ga0070680_100002798 3300005336 Bacteria 12956
15 Ga0070680_100044956 3300005336 Bacteria 3589
16 Ga0070680_100259270 3300005336 Bacteria 1470
17 Ga0068868_100042751 3300005338 Bacteria 3538
18 Ga0068868_100123146 3300005338 Bacteria 2116
19 Ga0068868_100472620 3300005338 Unclassified 1094
20 Ga0068868_100606147 3300005338 Bacteria 971
21 Ga0070660_100272182 3300005339 Unclassified 1384
22 Ga0070689_100594305 3300005340 Bacteria 958
23 Ga0070689_100890457 3300005340 Unclassified 787
24 Ga0070668_100150643 3300005347 Bacteria 1881
25 Ga0070675_100817145 3300005354 Bacteria 852
26 Ga0070673_100056170 3300005364 Unclassified 3105
27 Ga0070673_100110900 3300005364 Bacteria 2275
28 Ga0070673_100641999 3300005364 Bacteria 971
29 Ga0070688_100082121 3300005365 Unclassified 2088
30 Ga0070667_100036409 3300005367 Bacteria 4126
31 Ga0070667_100557917 3300005367 Unclassified 1053
32 Ga0070714_100024195 3300005435 Unclassified 4996
33 Ga0070713_100006862 3300005436 Bacteria 7937
34 Ga0070713_100075625 3300005436 Bacteria 2857
35 Ga0070701_10347955 3300005438 Unclassified 925
36 Ga0070711_100230391 3300005439 Unclassified 1444
37 Ga0070711_100403437 3300005439 Unclassified 1110
38 Ga0070711_100503855 3300005439 Unclassified 999
39 Ga0070705_100376293 3300005440 Bacteria 1044
40 Ga0070705_100439978 3300005440 Unclassified 975
41 Ga0070700_100062556 3300005441 Bacteria 2352
42 Ga0070708_100256013 3300005445 Unclassified 1645
43 Ga0070663_100983289 3300005455 Bacteria 733
44 Ga0070678_100645484 3300005456 Unclassified 949
45 Ga0070681_10003037 3300005458 Bacteria 15558
46 Ga0070681_10028271 3300005458 Bacteria 5637
47 Ga0070681_10171650 3300005458 Bacteria 2090
48 Ga0070681_10259537 3300005458 Bacteria 1650
49 Ga0070681_10289138 3300005458 Unclassified 1549
50 Ga0070681_10396963 3300005458 Unclassified 1290
51 Ga0068867_100104591 3300005459 Bacteria 2167
52 Ga0068867_100201996 3300005459 Bacteria 1592
53 Ga0068867_100855518 3300005459 Bacteria 815
54 Ga0068867_100885719 3300005459 Unclassified 802
55 Ga0070685_10353531 3300005466 Bacteria 1005
56 Ga0070706_100589040 3300005467 Bacteria 1034
57 Ga0070706_100611751 3300005467 Unclassified 1012
58 Ga0070698_100839553 3300005471 Bacteria 863
59 Ga0070699_100865263 3300005518 Bacteria 827
60 Ga0070679_100000635 3300005530 Bacteria 29869
61 Ga0070679_100733184 3300005530 Unclassified 931
62 Ga0070684_100000083 3300005535 Bacteria 61611
63 Ga0070684_100000654 3300005535 Bacteria 23885
64 Ga0070684_100016124 3300005535 Bacteria 6104
65 Ga0070684_100297767 3300005535 Bacteria 1480
66 Ga0070684_100592227 3300005535 Unclassified 1031
67 Ga0068853_100006617 3300005539 Bacteria 9227
68 Ga0068853_100104391 3300005539 Unclassified 2509
69 Ga0068853_100681178 3300005539 Bacteria 980
70 Ga0068853_101797926 3300005539 Unclassified 594
71 Ga0070672_100298771 3300005543 Bacteria 1364
72 Ga0070672_100327314 3300005543 Bacteria 1303
73 Ga0070672_100462048 3300005543 Bacteria 1094
74 Ga0070696_100000050 3300005546 Bacteria 54623
75 Ga0070696_100670936 3300005546 Unclassified 842
76 Ga0070693_100334539 3300005547 Unclassified 1032
77 Ga0070665_100019235 3300005548 Bacteria 6852
78 Ga0070665_100693964 3300005548 Unclassified 1031
79 Ga0070665_100771234 3300005548 Bacteria 974
80 Ga0070665_100867957 3300005548 Unclassified 915
81 Ga0070704_100025689 3300005549 Bacteria 3881
82 Ga0068855_100004338 3300005563 Bacteria 17341
83 Ga0068855_100004719 3300005563 Bacteria 16647
84 Ga0068855_100004892 3300005563 Bacteria 16357
85 Ga0068855_100015324 3300005563 Bacteria 9231
86 Ga0068855_100042704 3300005563 Bacteria 5372
87 Ga0068855_100211405 3300005563 Bacteria 2179
88 Ga0068855_100731166 3300005563 Unclassified 1057
89 Ga0070664_100311508 3300005564 Bacteria 1425
90 Ga0068857_100000367 3300005577 Bacteria 31519
91 Ga0068857_100068345 3300005577 Bacteria 3162
92 Ga0068857_100138038 3300005577 Bacteria 2202
93 Ga0068857_100166942 3300005577 Unclassified 1999
94 Ga0068857_100396918 3300005577 Bacteria 1283
95 Ga0068854_100770960 3300005578 Bacteria 836
96 Ga0068856_100008120 3300005614 Bacteria 10244
97 Ga0068856_100151499 3300005614 Bacteria 2328
98 Ga0068856_100281711 3300005614 Unclassified 1679
99 Ga0068856_100390235 3300005614 Bacteria 1412
100 Ga0068856_100401359 3300005614 Bacteria 1391
101 Ga0068856_100564756 3300005614 Bacteria 1159
102 Ga0068856_101075052 3300005614 Unclassified 822
103 Ga0068852_100006117 3300005616 Bacteria 8679
104 Ga0068852_100027317 3300005616 Bacteria 4651
105 Ga0068852_100054251 3300005616 Bacteria 3454
106 Ga0068852_100149453 3300005616 Unclassified 2171
107 Ga0068859_100111539 3300005617 Unclassified 2798
108 Ga0068864_100059398 3300005618 Bacteria 3309
109 Ga0068864_100416306 3300005618 Bacteria 1280
110 Ga0068864_100971742 3300005618 Unclassified 841
111 Ga0068866_10232888 3300005718 Bacteria 1118
112 Ga0068851_10100425 3300005834 Bacteria 1535
113 Ga0068851_10297001 3300005834 Unclassified 928
114 Ga0068870_10508150 3300005840 Bacteria 804
115 Ga0068863_100018498 3300005841 Bacteria 6669
116 Ga0068863_100085404 3300005841 Bacteria 2991
117 Ga0068858_100008758 3300005842 Bacteria 9709
118 Ga0068858_100044408 3300005842 Bacteria 4119
119 Ga0068858_100126717 3300005842 Unclassified 2391
120 Ga0068858_100432435 3300005842 Bacteria 1267
121 Ga0068858_101129314 3300005842 Unclassified 770
122 Ga0068860_100010166 3300005843 Bacteria 9323
123 Ga0068860_100475803 3300005843 Bacteria 1244
124 Ga0068860_100805118 3300005843 Bacteria 953
125 Ga0068862_100126840 3300005844 Bacteria 2254
126 Ga0068862_100147334 3300005844 Bacteria 2093
127 Ga0068862_101181698 3300005844 Unclassified 763
128 Ga0070717_10012251 3300006028 Bacteria 6539
129 Ga0070717_10667011 3300006028 Bacteria 944
130 Ga0070717_10847212 3300006028 Unclassified 832
131 Ga0070717_11106249 3300006028 Unclassified 722
132 Ga0075365_10140235 3300006038 Bacteria 1678
133 Ga0075368_10041349 3300006042 Bacteria 1811
134 Ga0075363_100044016 3300006048 Bacteria 2363
135 Ga0070712_100661921 3300006175 Unclassified 888
136 Ga0070712_100903984 3300006175 Unclassified 761
137 Ga0075367_10022665 3300006178 Bacteria 3525
138 Ga0075366_10022552 3300006195 Bacteria 3663
139 Ga0097621_100013303 3300006237 Bacteria 6130
140 Ga0097621_100057243 3300006237 Bacteria 3187
141 Ga0097621_100100157 3300006237 Bacteria 2437
142 Ga0097621_100151277 3300006237 Bacteria 1990
143 Ga0075370_10273694 3300006353 Bacteria 1002
144 Ga0068871_100025726 3300006358 Unclassified 4583
145 Ga0068871_100071576 3300006358 Bacteria 2852
146 Ga0075428_100154107 3300006844 Bacteria 2496
147 Ga0075428_100173427 3300006844 Unclassified 2337
148 Ga0075428_100405707 3300006844 Unclassified 1460
149 Ga0075428_100408245 3300006844 Unclassified 1455
150 Ga0075428_101054087 3300006844 Unclassified 860
151 Ga0075430_100003279 3300006846 Bacteria 13571
152 Ga0075431_100055263 3300006847 Bacteria 4095
153 Ga0075429_100098917 3300006880 Bacteria 2545
154 Ga0075429_100159560 3300006880 Unclassified 1975
155 Ga0068865_100060529 3300006881 Bacteria 2651
156 Ga0068865_100569326 3300006881 Unclassified 954
157 Ga0068865_100618766 3300006881 Bacteria 917
158 Ga0068865_101164012 3300006881 Bacteria 681
159 Ga0097620_100088218 3300006931 Bacteria 3151
160 Ga0097620_100111540 3300006931 Unclassified 2798
161 Ga0105240_10000425 3300009093 Bacteria 78173
162 Ga0105240_10004013 3300009093 Bacteria 22665
163 Ga0105240_10004427 3300009093 Bacteria 21416
164 Ga0105240_10004590 3300009093 Bacteria 20936
165 Ga0105240_10051759 3300009093 Bacteria 5166
166 Ga0105240_10197424 3300009093 Unclassified 2361
167 Ga0105240_10321264 3300009093 Bacteria 1764
168 Ga0105240_10518989 3300009093 Unclassified 1322
169 Ga0105240_11097154 3300009093 Bacteria 847
170 Ga0105240_11355755 3300009093 Bacteria 749
171 Ga0111539_10030828 3300009094 Bacteria 6518
172 Ga0105245_10009493 3300009098 Bacteria 8485
173 Ga0105245_10037377 3300009098 Bacteria 4315
174 Ga0105245_10037757 3300009098 Bacteria 4295
175 Ga0105245_10058855 3300009098 Bacteria 3459
176 Ga0105245_10067091 3300009098 Bacteria 3249
177 Ga0105245_10653562 3300009098 Unclassified 1082
178 Ga0105245_11167889 3300009098 Unclassified 817
179 Ga0105245_11501279 3300009098 Bacteria 725
180 Ga0114129_10004072 3300009147 Bacteria 20643
181 Ga0114129_10103657 3300009147 Bacteria 3933
182 Ga0114129_11028867 3300009147 Bacteria 1035
183 Ga0105243_10082795 3300009148 Bacteria 2623
184 Ga0105243_10115942 3300009148 Unclassified 2250
185 Ga0105243_10566441 3300009148 Unclassified 1088
186 Ga0105241_10100728 3300009174 Bacteria 2296
187 Ga0105241_10222366 3300009174 Bacteria 1588
188 Ga0105241_10335867 3300009174 Bacteria 1307
189 Ga0105241_10397582 3300009174 Bacteria 1208
190 Ga0105241_10576353 3300009174 Bacteria 1014
191 Ga0105242_10039448 3300009176 Unclassified 3801
192 Ga0105242_10046600 3300009176 Bacteria 3517
193 Ga0105242_10133520 3300009176 Unclassified 2146
194 Ga0105242_10305572 3300009176 Bacteria 1453
195 Ga0105248_10106725 3300009177 Bacteria 3157
196 Ga0105248_10303561 3300009177 Bacteria 1798
197 Ga0105248_10315432 3300009177 Bacteria 1761
198 Ga0105248_10379429 3300009177 Bacteria 1592
199 Ga0105237_10002573 3300009545 Bacteria 22369
200 Ga0105237_10004735 3300009545 Bacteria 15648
201 Ga0105237_10006074 3300009545 Bacteria 13509
202 Ga0105237_10008630 3300009545 Bacteria 11017
203 Ga0105237_10036751 3300009545 Bacteria 4955
204 Ga0105237_10050310 3300009545 Unclassified 4187
205 Ga0105237_10173606 3300009545 Bacteria 2156
206 Ga0105237_10280551 3300009545 Bacteria 1668
207 Ga0105238_10004596 3300009551 Bacteria 13651
208 Ga0105238_10016508 3300009551 Bacteria 7473
209 Ga0105238_10051413 3300009551 Unclassified 4145
210 Ga0105238_10060232 3300009551 Bacteria 3801
211 Ga0105238_10139192 3300009551 Bacteria 2404
212 Ga0105238_10228567 3300009551 Bacteria 1837
213 Ga0105249_10086522 3300009553 Unclassified 2923
214 Ga0105239_10006098 3300010375 Bacteria 14036
215 Ga0105239_10021394 3300010375 Bacteria 7131
216 Ga0105239_10124479 3300010375 Bacteria 2864
217 Ga0105239_11264077 3300010375 Bacteria 851
218 Ga0105239_11439695 3300010375 Bacteria 796
219 Ga0105239_11636383 3300010375 Unclassified 745
220 Ga0105246_10167189 3300011119 Unclassified 1681
221 Ga0105246_10666327 3300011119 Unclassified 908
222 Ga0157370_10004065 3300013104 Bacteria 16962
223 Ga0157370_10004342 3300013104 Bacteria 16282
224 Ga0157370_10007561 3300013104 Bacteria 11804
225 Ga0157370_10033773 3300013104 Bacteria 4986
226 Ga0157369_10010818 3300013105 Bacteria 10391
227 Ga0157369_10031617 3300013105 Bacteria 5827
228 Ga0157369_10034595 3300013105 Bacteria 5542
229 Ga0157369_10461466 3300013105 Bacteria 1315
230 Ga0157369_10546428 3300013105 Unclassified 1197
231 Ga0157374_10092956 3300013296 Bacteria 2879
232 Ga0157374_10237206 3300013296 Bacteria 1793
233 Ga0157374_10544079 3300013296 Bacteria 1168
234 Ga0157378_10022676 3300013297 Bacteria 5526
235 Ga0157378_10157708 3300013297 Unclassified 2120
236 Ga0157378_11365319 3300013297 Bacteria 751
237 Ga0163162_10210252 3300013306 Bacteria 2075
238 Ga0163162_10279259 3300013306 Bacteria 1802
239 Ga0157372_10022557 3300013307 Bacteria 6813
240 Ga0157372_10023943 3300013307 Bacteria 6625
241 Ga0157372_10050240 3300013307 Unclassified 4639
242 Ga0157372_10252403 3300013307 Unclassified 2048
243 Ga0157372_10304976 3300013307 Bacteria 1852
244 Ga0157372_10520000 3300013307 Bacteria 1387
245 Ga0157375_10006626 3300013308 Bacteria 10078
246 Ga0157375_10079224 3300013308 Unclassified 3320
247 Ga0157375_10105798 3300013308 Bacteria 2905
248 Ga0157375_10319899 3300013308 Bacteria 1716
249 Ga0157375_11117991 3300013308 Unclassified 923
250 Ga0157375_11701848 3300013308 Bacteria 747
251 Ga0163163_10041459 3300014325 Bacteria 4501
252 Ga0163163_10048599 3300014325 Unclassified 4173
253 Ga0163163_10251178 3300014325 Bacteria 1819
254 Ga0163163_10518031 3300014325 Unclassified 1255
255 Ga0163163_10735745 3300014325 Bacteria 1050
256 Ga0157380_10016887 3300014326 Bacteria 5390
257 Ga0157379_10030883 3300014968 Bacteria 4772
258 Ga0157379_10109114 3300014968 Bacteria 2485
259 Ga0157379_10982526 3300014968 Unclassified 804
260 Ga0157376_10090339 3300014969 Bacteria 2650
261 Ga0157376_10251876 3300014969 Bacteria 1650
262 Ga0157376_10273177 3300014969 Bacteria 1589
263 Ga0157376_11305961 3300014969 Bacteria 756
264 Ga0213875_10002156 3300021388 Bacteria 12008
265 Ga0207642_10345694 3300025899 Unclassified 876
266 Ga0207680_10117683 3300025903 Bacteria 1733
267 Ga0207685_10151966 3300025905 Bacteria 1048
268 Ga0207699_10118690 3300025906 Unclassified 1707
269 Ga0207699_10173507 3300025906 Bacteria 1444
270 Ga0207645_10466563 3300025907 Unclassified 853
271 Ga0207643_10217219 3300025908 Bacteria 1169
272 Ga0207705_10023248 3300025909 Bacteria 4423
273 Ga0207705_10031840 3300025909 Bacteria 3767
274 Ga0207705_10736850 3300025909 Bacteria 766
275 Ga0207684_10261915 3300025910 Bacteria 1492
276 Ga0207684_10566938 3300025910 Unclassified 971
277 Ga0207654_10497306 3300025911 Bacteria 861
278 Ga0207707_10002533 3300025912 Bacteria 16403
279 Ga0207707_10119519 3300025912 Bacteria 2303
280 Ga0207707_10342588 3300025912 Unclassified 1289
281 Ga0207707_10884683 3300025912 Unclassified 739
282 Ga0207695_10000770 3300025913 Bacteria 60994
283 Ga0207695_10001974 3300025913 Bacteria 31730
284 Ga0207695_10002883 3300025913 Bacteria 24934
285 Ga0207695_10015601 3300025913 Bacteria 8935
286 Ga0207695_10026708 3300025913 Bacteria 6442
287 Ga0207695_10095725 3300025913 Bacteria 2972
288 Ga0207695_10137834 3300025913 Bacteria 2392
289 Ga0207695_10175197 3300025913 Bacteria 2068
290 Ga0207695_10258355 3300025913 Unclassified 1640
291 Ga0207695_10780919 3300025913 Unclassified 835
292 Ga0207671_10037524 3300025914 Unclassified 3593
293 Ga0207663_10462636 3300025916 Bacteria 980
294 Ga0207660_10052665 3300025917 Bacteria 2898
295 Ga0207660_10106744 3300025917 Bacteria 2100
296 Ga0207660_10166878 3300025917 Bacteria 1702
297 Ga0207657_10002248 3300025919 Bacteria 20932
298 Ga0207657_10107771 3300025919 Bacteria 2304
299 Ga0207649_10162490 3300025920 Bacteria 1549
300 Ga0207649_10682028 3300025920 Bacteria 796
301 Ga0207652_10244931 3300025921 Bacteria 1616
302 Ga0207652_10983910 3300025921 Unclassified 742
303 Ga0207694_10002949 3300025924 Bacteria 13660
304 Ga0207694_10004275 3300025924 Bacteria 11180
305 Ga0207694_10009667 3300025924 Bacteria 7269
306 Ga0207694_10033095 3300025924 Bacteria 3959
307 Ga0207694_10086845 3300025924 Bacteria 2463
308 Ga0207694_10244086 3300025924 Unclassified 1468
309 Ga0207694_10291360 3300025924 Bacteria 1342
310 Ga0207694_10311951 3300025924 Unclassified 1297
311 Ga0207694_10563250 3300025924 Unclassified 957
312 Ga0207650_11170009 3300025925 Bacteria 655
313 Ga0207659_10685823 3300025926 Bacteria 877
314 Ga0207687_10000988 3300025927 Bacteria 19282
315 Ga0207687_10012601 3300025927 Bacteria 5523
316 Ga0207687_10055562 3300025927 Bacteria 2775
317 Ga0207687_10899272 3300025927 Unclassified 757
318 Ga0207700_10007610 3300025928 Bacteria 6642
319 Ga0207700_10050923 3300025928 Bacteria 3088
320 Ga0207700_10170346 3300025928 Unclassified 1816
321 Ga0207700_10209818 3300025928 Bacteria 1646
322 Ga0207700_11261143 3300025928 Bacteria 659
323 Ga0207664_10034142 3300025929 Unclassified 3915
324 Ga0207664_10070200 3300025929 Bacteria 2819
325 Ga0207644_10104682 3300025931 Bacteria 2131
326 Ga0207686_10009081 3300025934 Bacteria 5387
327 Ga0207686_10020487 3300025934 Unclassified 3779
328 Ga0207686_10027511 3300025934 Unclassified 3331
329 Ga0207686_10157557 3300025934 Bacteria 1588
330 Ga0207686_10180548 3300025934 Unclassified 1496
331 Ga0207709_10307369 3300025935 Unclassified 1181
332 Ga0207709_10402679 3300025935 Bacteria 1047
333 Ga0207669_10223355 3300025937 Unclassified 1384
334 Ga0207691_10302776 3300025940 Bacteria 1373
335 Ga0207691_10331795 3300025940 Bacteria 1303
336 Ga0207711_10001479 3300025941 Bacteria 21857
337 Ga0207711_10109759 3300025941 Bacteria 2452
338 Ga0207711_10254993 3300025941 Bacteria 1612
339 Ga0207711_10284480 3300025941 Bacteria 1523
340 Ga0207711_10339552 3300025941 Bacteria 1390
341 Ga0207689_10116463 3300025942 Bacteria 2197
342 Ga0207661_10000054 3300025944 Bacteria 88056
343 Ga0207661_10019015 3300025944 Bacteria 5112
344 Ga0207661_10037048 3300025944 Bacteria 3811
345 Ga0207661_10154424 3300025944 Bacteria 1986
346 Ga0207661_10188958 3300025944 Unclassified 1805
347 Ga0207661_10285765 3300025944 Unclassified 1475
348 Ga0207661_10585305 3300025944 Unclassified 1024
349 Ga0207679_10315248 3300025945 Bacteria 1352
350 Ga0207679_10379551 3300025945 Bacteria 1239
351 Ga0207667_10001168 3300025949 Bacteria 32962
352 Ga0207667_10012046 3300025949 Bacteria 10001
353 Ga0207667_10020486 3300025949 Bacteria 7354
354 Ga0207667_10078273 3300025949 Bacteria 3427
355 Ga0207667_10190963 3300025949 Bacteria 2101
356 Ga0207667_10200393 3300025949 Unclassified 2048
357 Ga0207667_10234519 3300025949 Unclassified 1878
358 Ga0207651_10042970 3300025960 Bacteria 3013
359 Ga0207651_10101214 3300025960 Bacteria 2138
360 Ga0207651_10500447 3300025960 Unclassified 1050
361 Ga0207712_10033380 3300025961 Unclassified 3479
362 Ga0207668_10105064 3300025972 Bacteria 2107
363 Ga0207658_10294968 3300025986 Unclassified 1395
364 Ga0207677_10261187 3300026023 Unclassified 1412
365 Ga0207677_10331944 3300026023 Bacteria 1267
366 Ga0207703_10006724 3300026035 Bacteria 9174
367 Ga0207703_10064333 3300026035 Bacteria 3010
368 Ga0207703_10257876 3300026035 Bacteria 1575
369 Ga0207703_10271368 3300026035 Unclassified 1537
370 Ga0207703_10315071 3300026035 Bacteria 1431
371 Ga0207703_10362349 3300026035 Bacteria 1337
372 Ga0207703_10740012 3300026035 Bacteria 936
373 Ga0207639_10012287 3300026041 Bacteria 5962
374 Ga0207678_10926558 3300026067 Bacteria 771
375 Ga0207708_10020557 3300026075 Bacteria 4978
376 Ga0207702_10015956 3300026078 Bacteria 6218
377 Ga0207702_10076470 3300026078 Bacteria 2894
378 Ga0207702_10153417 3300026078 Bacteria 2097
379 Ga0207702_10736031 3300026078 Unclassified 973
380 Ga0207641_10051467 3300026088 Bacteria 3488
381 Ga0207641_10267831 3300026088 Bacteria 1602
382 Ga0207641_10553458 3300026088 Bacteria 1122
383 Ga0207648_10066223 3300026089 Bacteria 3150
384 Ga0207648_10126304 3300026089 Bacteria 2250
385 Ga0207648_10556417 3300026089 Unclassified 1054
386 Ga0207676_10205146 3300026095 Unclassified 1745
387 Ga0207676_10333942 3300026095 Bacteria 1396
388 Ga0207676_10844175 3300026095 Unclassified 896
389 Ga0207676_10879604 3300026095 Unclassified 878
390 Ga0207674_10000166 3300026116 Bacteria 79149
391 Ga0207674_10003073 3300026116 Bacteria 20649
392 Ga0207674_10003444 3300026116 Bacteria 19357
393 Ga0207674_10012353 3300026116 Bacteria 9547
394 Ga0207674_10047924 3300026116 Bacteria 4378
395 Ga0207674_11070232 3300026116 Bacteria 776
396 Ga0207675_100071065 3300026118 Bacteria 3254
397 Ga0207675_100166876 3300026118 Bacteria 2103
398 Ga0207675_100518920 3300026118 Bacteria 1187
399 Ga0207675_100975639 3300026118 Bacteria 865
400 Ga0207683_10026033 3300026121 Bacteria 5051
401 Ga0207698_10161858 3300026142 Bacteria 1958
402 Ga0207698_10253223 3300026142 Unclassified 1613
403 Ga0207698_10293548 3300026142 Bacteria 1510
404 Ga0207698_11180959 3300026142 Bacteria 779
405 Ga0209813_10095185 3300027866 Bacteria 1006
406 Ga0209813_10105144 3300027866 Bacteria 965
407 Ga0207428_10004926 3300027907 Bacteria 12581
408 Ga0268266_10375212 3300028379 Bacteria 1340
409 Ga0268266_10654255 3300028379 Unclassified 1011
410 Ga0268266_10762458 3300028379 Unclassified 934
411 Ga0268265_10131581 3300028380 Bacteria 2080
412 Ga0268265_10410637 3300028380 Bacteria 1254
413 Ga0268264_10006848 3300028381 Bacteria 9568
414 Ga0268264_10364502 3300028381 Bacteria 1379
415 Ga0268264_10940952 3300028381 Unclassified 869
416 Ga0268264_11011223 3300028381 Bacteria 838
417 Ga0265336_10033052 3300028666 Unclassified 1603
418 Ga0265338_10114625 3300028800 Bacteria 2162
419 Ga0265338_10328095 3300028800 Bacteria 1106
420 Ga0265338_10417462 3300028800 Unclassified 954
421 Ga0265324_10045389 3300029957 Unclassified 1513
422 Ga0265332_10174804 3300031238 Bacteria 896
423 Ga0265320_10080044 3300031240 Bacteria 1526
424 Ga0265325_10094325 3300031241 Unclassified 1472
425 Ga0265339_10012490 3300031249 Bacteria 5184
426 Ga0265331_10138557 3300031250 Unclassified 1107
427 Ga0265331_10325346 3300031250 Unclassified 688
428 Ga0265316_10104256 3300031344 Bacteria 2152
429 Ga0265316_10575382 3300031344 Unclassified 800
430 Ga0307408_100677181 3300031548 Bacteria 925
431 Ga0316579_10025905 3300031691 Bacteria 2651
432 Ga0265314_10007557 3300031711 Bacteria 9418
433 Ga0265314_10046025 3300031711 Bacteria 3080
434 Ga0265314_10127645 3300031711 Bacteria 1591
435 Ga0265342_10139536 3300031712 Bacteria 1353
436 Ga0316577_10013187 3300031733 Bacteria 4513
437 Ga0373934_0059793 3300035086 Bacteria 1517
438 Ga0373923_0011897 3300035111 Bacteria 3204
439 Ga0373923_0021138 3300035111 Unclassified 2537
440 Ga0373932_0300162 3300035112 Bacteria 599
441 Ga0373945_0127005 3300035116 Bacteria 1019
442 Ga0373953_0011892 3300035117 Unclassified 3067
443 Ga0373953_0128148 3300035117 Bacteria 1081
444 Ga0373954_0010358 3300035118 Unclassified 4114
445 Ga0373954_0075680 3300035118 Bacteria 1603
446 Ga0373954_0092489 3300035118 Unclassified 1453
447 Ga0373956_0045432 3300035119 Bacteria 1960
448 Ga0373956_0108234 3300035119 Bacteria 1293
449 Ga0373957_0124923 3300035120 Bacteria 1044
450 Ga0373957_0148175 3300035120 Bacteria 962
451 Ga0373943_0006889 3300035170 Bacteria 5098
452 Ga0373943_0315571 3300035170 Unclassified 890
453 Ga0373946_0043217 3300035171 Bacteria 1856
454 Ga0373955_0004130 3300035172 Bacteria 6407
455 Ga0373955_0020349 3300035172 Unclassified 3335
456 Ga0373955_0050553 3300035172 Bacteria 2261
457 Ga0373955_0118827 3300035172 Bacteria 1535
458 Ga0373942_0218400 3300035207 Unclassified 638
459 Ga0316574_0164373 3300035398 Bacteria 1429
460 Ga0316574_0355006 3300035398 Bacteria 927
461 Ga0373935_0017968 3300035692 Bacteria 4298
462 Ga0373935_0074109 3300035692 Bacteria 2200
463 Ga0373935_0431415 3300035692 Bacteria 950
464 Ga0373935_0632110 3300035692 Bacteria 784
465 Ga0373927_0000450 3300035695 Bacteria 31454
466 Ga0373927_0003519 3300035695 Bacteria 11202
467 Ga0373927_0004539 3300035695 Bacteria 9701
468 Ga0373927_0020232 3300035695 Bacteria 4364
469 Ga0373933_0042127 3300035724 Unclassified 2698
470 Ga0373933_0116332 3300035724 Bacteria 1671
471 Ga0373933_0228111 3300035724 Unclassified 1196
472 Ga0373933_0371849 3300035724 Unclassified 930
473 Ga0373933_0386703 3300035724 Unclassified 912
474 Ga0373933_0452234 3300035724 Unclassified 840
475 Ga0373947_0000644 3300035725 Bacteria 20644
476 Ga0373947_0005809 3300035725 Bacteria 7194
477 Ga0373937_0005609 3300036401 Bacteria 10775
478 Ga0373937_0009413 3300036401 Bacteria 8492
479 Ga0373937_0216311 3300036401 Bacteria 1803
480 Ga0373937_0234044 3300036401 Bacteria 1730
481 Ga0316582_0010835 3300036647 Bacteria 5013
482 Ga0316584_0047845 3300036712 Bacteria 3195
483 Ga0316584_0128985 3300036712 Bacteria 1889
484 Ga0373925_0002306 3300037068 Bacteria 15394
485 Ga0373925_0020341 3300037068 Bacteria 4831
486 Ga0373925_0195584 3300037068 Bacteria 1606
487 Ga0395899_0255044 3300037312 Bacteria 1202
488 Ga0395900_1152031 3300037418 Unclassified 692
489 Ga0395898_0138332 3300037466 Bacteria 2332
490 Ga0436364_0540469 3300037853 Unclassified 1987
491 Ga0436364_0812157 3300037853 Bacteria 6873
492 Ga0436364_0824849 3300037853 Bacteria 4170
493 Ga0436364_1028841 3300037853 Bacteria 1272
494 Ga0395901_1360216 3300038443 Bacteria 670
495 Ga0436365_1106491 3300039437 Bacteria 2198
496 Ga0436365_1136015 3300039437 Unclassified 1238
497 Ga0436360_1162206 3300039438 Bacteria 638
498 Ga0439445_0081811 3300042004 Bacteria 903
499 Ga0453684_0231718 3300044712 Bacteria 2132
500 Ga0466957_0491157 3300044842 Bacteria 850
501 Ga0466967_0320344 3300045976 Bacteria 1495
502 Ga0466967_0424203 3300045976 Bacteria 1297
503 Ga0495592_0022811 3300046454 Bacteria 4761
504 Ga0495629_0177534 3300046459 Bacteria 1477
505 Ga0495651_0121424 3300046462 Bacteria 1919
506 Ga0495651_0229967 3300046462 Unclassified 1278
507 Ga0495650_0035327 3300046471 Bacteria 2201
508 Ga0495580_0002878 3300046472 Bacteria 14816
509 Ga0495580_0155608 3300046472 Bacteria 1583
510 Ga0495580_0218087 3300046472 Unclassified 1311
511 Ga0495582_0008922 3300046473 Bacteria 5534
512 Ga0495664_0162722 3300046477 Bacteria 1354
513 Ga0495664_0311386 3300046477 Bacteria 950
514 Ga0495594_0554171 3300046499 Bacteria 652
515 Ga0495608_0102763 3300046511 Bacteria 1842
516 Ga0495630_0321500 3300046517 Bacteria 1183
517 Ga0495652_0038883 3300046529 Bacteria 4118
518 Ga0495652_0251625 3300046529 Bacteria 1309
519 Ga0495652_0806228 3300046529 Unclassified 625
520 Ga0495665_0032837 3300046531 Bacteria 2777
521 Ga0495665_0327226 3300046531 Unclassified 782
522 Ga0495640_0745419 3300046533 Bacteria 586
523 Ga0495586_0193849 3300046535 Bacteria 1151
524 Ga0495587_0001029 3300046536 Bacteria 18348
525 Ga0495645_0158553 3300046543 Unclassified 1566
526 Ga0495667_0029952 3300046559 Bacteria 3660
527 Ga0495635_0260280 3300046663 Bacteria 1168
528 Ga0495599_0002515 3300046678 Bacteria 10658
529 Ga0495599_0135491 3300046678 Bacteria 1529
530 Ga0495658_0376517 3300046683 Bacteria 904
531 Ga0495613_0099922 3300046689 Unclassified 2096
532 Ga0495624_0194872 3300046690 Bacteria 1232
533 Ga0495581_0106336 3300047315 Unclassified 1631
534 Ga0495636_0135824 3300047318 Bacteria 1096
535 Ga0495674_0034128 3300047319 Bacteria 4603
536 Ga0495684_0004783 3300047471 Bacteria 10572
537 Ga0495684_0079052 3300047471 Bacteria 2497
538 Ga0495684_0090423 3300047471 Bacteria 2319
539 Ga0495684_0117255 3300047471 Bacteria 2007
540 Ga0495602_0004860 3300048088 Bacteria 14073
541 Ga0496104_0093893 3300048907 Bacteria 2870
542 Ga0496104_0220678 3300048907 Bacteria 1808
543 Ga0496112_0710138 3300048915 Bacteria 933
544 Ga0501031_0024958 3300049568 Bacteria 3898
545 Ga0501032_0002829 3300049569 Bacteria 13499
546 Ga0501033_0173387 3300049570 Unclassified 1548
547 Ga0501033_0240372 3300049570 Bacteria 1285
548 Ga0501036_0016136 3300049572 Bacteria 6242
549 Ga0501036_0064791 3300049572 Unclassified 3092
550 Ga0501036_0101175 3300049572 Bacteria 2438
551 Ga0501036_0110437 3300049572 Bacteria 2323
552 Ga0501036_0652251 3300049572 Bacteria 871
553 Ga0501037_0002336 3300049573 Bacteria 13697
554 Ga0501037_0328485 3300049573 Bacteria 1058
555 Ga0501038_0058202 3300049574 Bacteria 3314
556 Ga0501039_0010138 3300049575 Bacteria 7178
557 Ga0501039_0054920 3300049575 Bacteria 3084
558 Ga0501040_0017997 3300049576 Bacteria 4691
559 Ga0501040_0095332 3300049576 Bacteria 2071
560 Ga0501040_0120689 3300049576 Bacteria 1839
561 Ga0501040_0355681 3300049576 Unclassified 1049
562 Ga0501041_0028576 3300049577 Bacteria 3364
563 Ga0501042_0190730 3300049578 Bacteria 1478
564 Ga0501042_0383643 3300049578 Bacteria 1017
565 Ga0501042_0394771 3300049578 Bacteria 1002
566 Ga0501043_0002869 3300049579 Bacteria 14392
567 Ga0501043_0542922 3300049579 Bacteria 864
568 Ga0501046_0000891 3300049580 Bacteria 29094
569 Ga0501047_0053769 3300049581 Bacteria 3895
570 Ga0501047_0072541 3300049581 Bacteria 3314
571 Ga0501047_0089907 3300049581 Bacteria 2947
572 Ga0501047_0616195 3300049581 Unclassified 906
573 Ga0501048_0019755 3300049582 Unclassified 4941
574 Ga0501048_0063589 3300049582 Bacteria 2610
575 Ga0501048_0181961 3300049582 Bacteria 1490
576 Ga0501067_0005450 3300049583 Bacteria 7062
577 Ga0501068_0000705 3300049584 Bacteria 17137
578 Ga0501069_0008380 3300049585 Bacteria 5429
579 Ga0501070_0035723 3300049586 Bacteria 4150
580 Ga0501070_0042195 3300049586 Bacteria 3800
581 Ga0501070_0382014 3300049586 Bacteria 1141
582 Ga0501071_0026669 3300049587 Bacteria 4058
583 Ga0501071_0031859 3300049587 Bacteria 3741
584 Ga0501072_0000736 3300049588 Bacteria 23875
585 Ga0501072_0040100 3300049588 Bacteria 3677
586 Ga0501072_0205945 3300049588 Bacteria 1568
587 Ga0501072_0354652 3300049588 Bacteria 1164
588 Ga0501073_0033404 3300049589 Bacteria 3663
589 Ga0501074_0025747 3300049590 Bacteria 4268
590 Ga0501075_0012252 3300049591 Bacteria 6088
591 Ga0501075_0088179 3300049591 Bacteria 2352
592 Ga0501075_0584164 3300049591 Bacteria 852
593 Ga0501076_0010220 3300049592 Bacteria 6955
594 Ga0501076_0019825 3300049592 Bacteria 5144
595 Ga0501076_0032029 3300049592 Bacteria 4103
596 Ga0501076_0044155 3300049592 Bacteria 3514
597 Ga0501076_0063692 3300049592 Bacteria 2938
598 Ga0501077_0009195 3300049593 Bacteria 6136
599 Ga0501079_0015464 3300049741 Bacteria 5823
600 Ga0501079_0041449 3300049741 Bacteria 3554
601 Ga0501079_0042054 3300049741 Bacteria 3529
602 Ga0501080_0000530 3300049742 Bacteria 29994
603 Ga0501080_0086204 3300049742 Bacteria 2918
604 Ga0501081_0078835 3300049743 Bacteria 2303
605 Ga0501081_0427789 3300049743 Bacteria 982
606 Ga0501083_0348670 3300049744 Bacteria 962
607 Ga0501083_0580982 3300049744 Unclassified 729
608 Ga0501035_0035479 3300049822 Bacteria 4525
609 Ga0501044_0037084 3300049823 Bacteria 5097
610 Ga0501044_0101739 3300049823 Bacteria 2890
611 Ga0501044_0140181 3300049823 Unclassified 2407
612 Ga0501045_0002984 3300049824 Bacteria 11576
613 Ga0501045_0030224 3300049824 Bacteria 3920
614 Ga0501045_0154063 3300049824 Bacteria 1710
615 Ga0501045_0272038 3300049824 Bacteria 1261
616 Ga0501045_0566515 3300049824 Unclassified 842
617 nmdc:mga03n38_42649_c1 3300050490 Bacteria 1984
618 nmdc:mga00v17_11698_c1 3300050491 Bacteria 4827
619 nmdc:mga00v17_45696_c1 3300050491 Bacteria 2647
620 nmdc:mga0yw44_198827_c1 3300050492 Bacteria 1323
621 nmdc:mga0k408_138701_c1 3300050493 Bacteria 1446
622 nmdc:mga04h51_148517_c1 3300050495 Unclassified 894
623 nmdc:mga04h51_202134_c1 3300050495 Bacteria 781
624 nmdc:mga07m45_15297_c1 3300050496 Bacteria 4096
625 nmdc:mga07m45_85741_c1 3300050496 Bacteria 1801
626 nmdc:mga05p37_117639_c1 3300050507 Bacteria 3266
627 nmdc:mga05p37_302792_c1 3300050507 Bacteria 1898
628 nmdc:mga05p37_326841_c1 3300050507 Unclassified 1813
629 nmdc:mga09592_403103_c1 3300050508 Unclassified 1182
630 nmdc:mga09592_437005_c1 3300050508 Unclassified 1129
631 nmdc:mga09592_76103_c1 3300050508 Bacteria 2854
632 nmdc:mga0qj67_126426_c1 3300050509 Unclassified 2069
633 nmdc:mga06r32_118139_c1 3300050510 Unclassified 2614
634 nmdc:mga06r32_77023_c1 3300050510 Unclassified 3239
635 nmdc:mga08y16_29507_c1 3300050511 Bacteria 5779
636 nmdc:mga0n895_1560156_c1 3300050512 Bacteria 625
637 nmdc:mga0a205_1070824_c1 3300050515 Bacteria 653
638 Ga0500641_0316892 3300053096 Bacteria 636
639 Ga0500594_0039642 3300053118 Bacteria 1282
640 Ga0500568_0053423 3300053139 Bacteria 1583
641 Ga0500568_0167241 3300053139 Bacteria 810
642 Ga0500577_0214328 3300053142 Bacteria 833
643 Ga0500616_0000064 3300053153 Bacteria 243072
644 Ga0500616_0007872 3300053153 Bacteria 6701
645 Ga0501084_0000777 3300054114 Bacteria 24287
646 Ga0501084_0195849 3300054114 Bacteria 1705
647 Ga0501084_0211262 3300054114 Bacteria 1637
648 Ga0501084_0320976 3300054114 Bacteria 1308
649 Ga0501082_0018816 3300060353 Bacteria 5950
650 Ga0501082_0085469 3300060353 Bacteria 2721
651 Ga0501082_0108191 3300060353 Bacteria 2406
652 Ga0501082_0143537 3300060353 Bacteria 2072
653 Ga0501082_0167978 3300060353 Bacteria 1907
654 Ga0501082_0555665 3300060353 Bacteria 1004
655 Ga0530510_0100097 3300061734 Bacteria 2119
656 Ga0530510_1101544 3300061734 Unclassified 608
657 Ga0207699_10483322
658 Ga0070658_10006989
659 Ga0070658_10016641
660 Ga0070658_10909089
661 Ga0070683_100000311
662 Ga0070683_100020847
663 Ga0070683_100402661
664 Ga0070670_100903434
665 Ga0070677_10257320
666 Ga0068869_100403166
667 Ga0068869_100420981
668 Ga0068869_101065409
669 Ga0070666_10003261
670 Ga0070680_100002798
671 Ga0070680_100044956
672 Ga0070680_100259270
673 Ga0068868_100042751
674 Ga0068868_100123146
675 Ga0068868_100472620
676 Ga0068868_100606147
677 Ga0070660_100272182
678 Ga0070689_100594305
679 Ga0070689_100890457
680 Ga0070668_100150643
681 Ga0070675_100817145
682 Ga0070673_100056170
683 Ga0070673_100110900
684 Ga0070673_100641999
685 Ga0070688_100082121
686 Ga0070667_100036409
687 Ga0070667_100557917
688 Ga0070714_100024195
689 Ga0070713_100006862
690 Ga0070713_100075625
691 Ga0070701_10347955
692 Ga0070711_100230391
693 Ga0070711_100403437
694 Ga0070711_100503855
695 Ga0070705_100376293
696 Ga0070705_100439978
697 Ga0070700_100062556
698 Ga0070708_100256013
699 Ga0070663_100983289
700 Ga0070678_100645484
701 Ga0070681_10003037
702 Ga0070681_10028271
703 Ga0070681_10171650
704 Ga0070681_10259537
705 Ga0070681_10289138
706 Ga0070681_10396963
707 Ga0068867_100104591
708 Ga0068867_100201996
709 Ga0068867_100855518
710 Ga0068867_100885719
711 Ga0070685_10353531
712 Ga0070706_100589040
713 Ga0070706_100611751
714 Ga0070698_100839553
715 Ga0070699_100865263
716 Ga0070679_100000635
717 Ga0070679_100733184
718 Ga0070684_100000083
719 Ga0070684_100000654
720 Ga0070684_100016124
721 Ga0070684_100297767
722 Ga0070684_100592227
723 Ga0068853_100006617
724 Ga0068853_100104391
725 Ga0068853_100681178
726 Ga0068853_101797926
727 Ga0070672_100298771
728 Ga0070672_100327314
729 Ga0070672_100462048
730 Ga0070696_100000050
731 Ga0070696_100670936
732 Ga0070693_100334539
733 Ga0070665_100019235
734 Ga0070665_100693964
735 Ga0070665_100771234
736 Ga0070665_100867957
737 Ga0070704_100025689
738 Ga0068855_100004338
739 Ga0068855_100004719
740 Ga0068855_100004892
741 Ga0068855_100015324
742 Ga0068855_100042704
743 Ga0068855_100211405
744 Ga0068855_100731166
745 Ga0070664_100311508
746 Ga0068857_100000367
747 Ga0068857_100068345
748 Ga0068857_100138038
749 Ga0068857_100166942
750 Ga0068857_100396918
751 Ga0068854_100770960
752 Ga0068856_100008120
753 Ga0068856_100151499
754 Ga0068856_100281711
755 Ga0068856_100390235
756 Ga0068856_100401359
757 Ga0068856_100564756
758 Ga0068856_101075052
759 Ga0068852_100006117
760 Ga0068852_100027317
761 Ga0068852_100054251
762 Ga0068852_100149453
763 Ga0068859_100111539
764 Ga0068864_100059398
765 Ga0068864_100416306
766 Ga0068864_100971742
767 Ga0068866_10232888
768 Ga0068851_10100425
769 Ga0068851_10297001
770 Ga0068870_10508150
771 Ga0068863_100018498
772 Ga0068863_100085404
773 Ga0068858_100008758
774 Ga0068858_100044408
775 Ga0068858_100126717
776 Ga0068858_100432435
777 Ga0068858_101129314
778 Ga0068860_100010166
779 Ga0068860_100475803
780 Ga0068860_100805118
781 Ga0068862_100126840
782 Ga0068862_100147334
783 Ga0068862_101181698
784 Ga0070717_10012251
785 Ga0070717_10667011
786 Ga0070717_10847212
787 Ga0070717_11106249
788 Ga0075365_10140235
789 Ga0075368_10041349
790 Ga0075363_100044016
791 Ga0070712_100661921
792 Ga0070712_100903984
793 Ga0075367_10022665
794 Ga0075366_10022552
795 Ga0097621_100013303
796 Ga0097621_100057243
797 Ga0097621_100100157
798 Ga0097621_100151277
799 Ga0075370_10273694
800 Ga0068871_100025726
801 Ga0068871_100071576
802 Ga0075428_100154107
803 Ga0075428_100173427
804 Ga0075428_100405707
805 Ga0075428_100408245
806 Ga0075428_101054087
807 Ga0075430_100003279
808 Ga0075431_100055263
809 Ga0075429_100098917
810 Ga0075429_100159560
811 Ga0068865_100060529
812 Ga0068865_100569326
813 Ga0068865_100618766
814 Ga0068865_101164012
815 Ga0097620_100088218
816 Ga0097620_100111540
817 Ga0105240_10000425
818 Ga0105240_10004013
819 Ga0105240_10004427
820 Ga0105240_10004590
821 Ga0105240_10051759
822 Ga0105240_10197424
823 Ga0105240_10321264
824 Ga0105240_10518989
825 Ga0105240_11097154
826 Ga0105240_11355755
827 Ga0111539_10030828
828 Ga0105245_10009493
829 Ga0105245_10037377
830 Ga0105245_10037757
831 Ga0105245_10058855
832 Ga0105245_10067091
833 Ga0105245_10653562
834 Ga0105245_11167889
835 Ga0105245_11501279
836 Ga0114129_10004072
837 Ga0114129_10103657
838 Ga0114129_11028867
839 Ga0105243_10082795
840 Ga0105243_10115942
841 Ga0105243_10566441
842 Ga0105241_10100728
843 Ga0105241_10222366
844 Ga0105241_10335867
845 Ga0105241_10397582
846 Ga0105241_10576353
847 Ga0105242_10039448
848 Ga0105242_10046600
849 Ga0105242_10133520
850 Ga0105242_10305572
851 Ga0105248_10106725
852 Ga0105248_10303561
853 Ga0105248_10315432
854 Ga0105248_10379429
855 Ga0105237_10002573
856 Ga0105237_10004735
857 Ga0105237_10006074
858 Ga0105237_10008630
859 Ga0105237_10036751
860 Ga0105237_10050310
861 Ga0105237_10173606
862 Ga0105237_10280551
863 Ga0105238_10004596
864 Ga0105238_10016508
865 Ga0105238_10051413
866 Ga0105238_10060232
867 Ga0105238_10139192
868 Ga0105238_10228567
869 Ga0105249_10086522
870 Ga0105239_10006098
871 Ga0105239_10021394
872 Ga0105239_10124479
873 Ga0105239_11264077
874 Ga0105239_11439695
875 Ga0105239_11636383
876 Ga0105246_10167189
877 Ga0105246_10666327
878 Ga0157370_10004065
879 Ga0157370_10004342
880 Ga0157370_10007561
881 Ga0157370_10033773
882 Ga0157369_10010818
883 Ga0157369_10031617
884 Ga0157369_10034595
885 Ga0157369_10461466
886 Ga0157369_10546428
887 Ga0157374_10092956
888 Ga0157374_10237206
889 Ga0157374_10544079
890 Ga0157378_10022676
891 Ga0157378_10157708
892 Ga0157378_11365319
893 Ga0163162_10210252
894 Ga0163162_10279259
895 Ga0157372_10022557
896 Ga0157372_10023943
897 Ga0157372_10050240
898 Ga0157372_10252403
899 Ga0157372_10304976
900 Ga0157372_10520000
901 Ga0157375_10006626
902 Ga0157375_10079224
903 Ga0157375_10105798
904 Ga0157375_10319899
905 Ga0157375_11117991
906 Ga0157375_11701848
907 Ga0163163_10041459
908 Ga0163163_10048599
909 Ga0163163_10251178
910 Ga0163163_10518031
911 Ga0163163_10735745
912 Ga0157380_10016887
913 Ga0157379_10030883
914 Ga0157379_10109114
915 Ga0157379_10982526
916 Ga0157376_10090339
917 Ga0157376_10251876
918 Ga0157376_10273177
919 Ga0157376_11305961
920 Ga0213875_10002156
921 Ga0207642_10345694
922 Ga0207680_10117683
923 Ga0207685_10151966
924 Ga0207699_10118690
925 Ga0207699_10173507
926 Ga0207645_10466563
927 Ga0207643_10217219
928 Ga0207705_10023248
929 Ga0207705_10031840
930 Ga0207705_10736850
931 Ga0207684_10261915
932 Ga0207684_10566938
933 Ga0207654_10497306
934 Ga0207707_10002533
935 Ga0207707_10119519
936 Ga0207707_10342588
937 Ga0207707_10884683
938 Ga0207695_10000770
939 Ga0207695_10001974
940 Ga0207695_10002883
941 Ga0207695_10015601
942 Ga0207695_10026708
943 Ga0207695_10095725
944 Ga0207695_10137834
945 Ga0207695_10175197
946 Ga0207695_10258355
947 Ga0207695_10780919
948 Ga0207671_10037524
949 Ga0207663_10462636
950 Ga0207660_10052665
951 Ga0207660_10106744
952 Ga0207660_10166878
953 Ga0207657_10002248
954 Ga0207657_10107771
955 Ga0207649_10162490
956 Ga0207649_10682028
957 Ga0207652_10244931
958 Ga0207652_10983910
959 Ga0207694_10002949
960 Ga0207694_10004275
961 Ga0207694_10009667
962 Ga0207694_10033095
963 Ga0207694_10086845
964 Ga0207694_10244086
965 Ga0207694_10291360
966 Ga0207694_10311951
967 Ga0207694_10563250
968 Ga0207650_11170009
969 Ga0207659_10685823
970 Ga0207687_10000988
971 Ga0207687_10012601
972 Ga0207687_10055562
973 Ga0207687_10899272
974 Ga0207700_10007610
975 Ga0207700_10050923
976 Ga0207700_10170346
977 Ga0207700_10209818
978 Ga0207700_11261143
979 Ga0207664_10034142
980 Ga0207664_10070200
981 Ga0207644_10104682
982 Ga0207686_10009081
983 Ga0207686_10020487
984 Ga0207686_10027511
985 Ga0207686_10157557
986 Ga0207686_10180548
987 Ga0207709_10307369
988 Ga0207709_10402679
989 Ga0207669_10223355
990 Ga0207691_10302776
991 Ga0207691_10331795
992 Ga0207711_10001479
993 Ga0207711_10109759
994 Ga0207711_10254993
995 Ga0207711_10284480
996 Ga0207711_10339552
997 Ga0207689_10116463
998 Ga0207661_10000054
999 Ga0207661_10019015
1000 Ga0207661_10037048
1001 Ga0207661_10154424
1002 Ga0207661_10188958
1003 Ga0207661_10285765
1004 Ga0207661_10585305
1005 Ga0207679_10315248
1006 Ga0207679_10379551
1007 Ga0207667_10001168
1008 Ga0207667_10012046
1009 Ga0207667_10020486
1010 Ga0207667_10078273
1011 Ga0207667_10190963
1012 Ga0207667_10200393
1013 Ga0207667_10234519
1014 Ga0207651_10042970
1015 Ga0207651_10101214
1016 Ga0207651_10500447
1017 Ga0207712_10033380
1018 Ga0207668_10105064
1019 Ga0207658_10294968
1020 Ga0207677_10261187
1021 Ga0207677_10331944
1022 Ga0207703_10006724
1023 Ga0207703_10064333
1024 Ga0207703_10257876
1025 Ga0207703_10271368
1026 Ga0207703_10315071
1027 Ga0207703_10362349
1028 Ga0207703_10740012
1029 Ga0207639_10012287
1030 Ga0207678_10926558
1031 Ga0207708_10020557
1032 Ga0207702_10015956
1033 Ga0207702_10076470
1034 Ga0207702_10153417
1035 Ga0207702_10736031
1036 Ga0207641_10051467
1037 Ga0207641_10267831
1038 Ga0207641_10553458
1039 Ga0207648_10066223
1040 Ga0207648_10126304
1041 Ga0207648_10556417
1042 Ga0207676_10205146
1043 Ga0207676_10333942
1044 Ga0207676_10844175
1045 Ga0207676_10879604
1046 Ga0207674_10000166
1047 Ga0207674_10003073
1048 Ga0207674_10003444
1049 Ga0207674_10012353
1050 Ga0207674_10047924
1051 Ga0207674_11070232
1052 Ga0207675_100071065
1053 Ga0207675_100166876
1054 Ga0207675_100518920
1055 Ga0207675_100975639
1056 Ga0207683_10026033
1057 Ga0207698_10161858
1058 Ga0207698_10253223
1059 Ga0207698_10293548
1060 Ga0207698_11180959
1061 Ga0209813_10095185
1062 Ga0209813_10105144
1063 Ga0207428_10004926
1064 Ga0268266_10375212
1065 Ga0268266_10654255
1066 Ga0268266_10762458
1067 Ga0268265_10131581
1068 Ga0268265_10410637
1069 Ga0268264_10006848
1070 Ga0268264_10364502
1071 Ga0268264_10940952
1072 Ga0268264_11011223
1073 Ga0265336_10033052
1074 Ga0265338_10114625
1075 Ga0265338_10328095
1076 Ga0265338_10417462
1077 Ga0265324_10045389
1078 Ga0265332_10174804
1079 Ga0265320_10080044
1080 Ga0265325_10094325
1081 Ga0265339_10012490
1082 Ga0265331_10138557
1083 Ga0265331_10325346
1084 Ga0265316_10104256
1085 Ga0265316_10575382
1086 Ga0307408_100677181
1087 Ga0316579_10025905
1088 Ga0265314_10007557
1089 Ga0265314_10046025
1090 Ga0265314_10127645
1091 Ga0265342_10139536
1092 Ga0316577_10013187
1093 Ga0373934_0059793
1094 Ga0373923_0011897
1095 Ga0373923_0021138
1096 Ga0373932_0300162
1097 Ga0373945_0127005
1098 Ga0373953_0011892
1099 Ga0373953_0128148
1100 Ga0373954_0010358
1101 Ga0373954_0075680
1102 Ga0373954_0092489
1103 Ga0373956_0045432
1104 Ga0373956_0108234
1105 Ga0373957_0124923
1106 Ga0373957_0148175
1107 Ga0373943_0006889
1108 Ga0373943_0315571
1109 Ga0373946_0043217
1110 Ga0373955_0004130
1111 Ga0373955_0020349
1112 Ga0373955_0050553
1113 Ga0373955_0118827
1114 Ga0373942_0218400
1115 Ga0316574_0164373
1116 Ga0316574_0355006
1117 Ga0373935_0017968
1118 Ga0373935_0074109
1119 Ga0373935_0431415
1120 Ga0373935_0632110
1121 Ga0373927_0000450
1122 Ga0373927_0003519
1123 Ga0373927_0004539
1124 Ga0373927_0020232
1125 Ga0373933_0042127
1126 Ga0373933_0116332
1127 Ga0373933_0228111
1128 Ga0373933_0371849
1129 Ga0373933_0386703
1130 Ga0373933_0452234
1131 Ga0373947_0000644
1132 Ga0373947_0005809
1133 Ga0373937_0005609
1134 Ga0373937_0009413
1135 Ga0373937_0216311
1136 Ga0373937_0234044
1137 Ga0316582_0010835
1138 Ga0316584_0047845
1139 Ga0316584_0128985
1140 Ga0373925_0002306
1141 Ga0373925_0020341
1142 Ga0373925_0195584
1143 Ga0395899_0255044
1144 Ga0395900_1152031
1145 Ga0395898_0138332
1146 Ga0436364_0540469
1147 Ga0436364_0812157
1148 Ga0436364_0824849
1149 Ga0436364_1028841
1150 Ga0395901_1360216
1151 Ga0436365_1106491
1152 Ga0436365_1136015
1153 Ga0436360_1162206
1154 Ga0439445_0081811
1155 Ga0453684_0231718
1156 Ga0466957_0491157
1157 Ga0466967_0320344
1158 Ga0466967_0424203
1159 Ga0495592_0022811
1160 Ga0495629_0177534
1161 Ga0495651_0121424
1162 Ga0495651_0229967
1163 Ga0495650_0035327
1164 Ga0495580_0002878
1165 Ga0495580_0155608
1166 Ga0495580_0218087
1167 Ga0495582_0008922
1168 Ga0495664_0162722
1169 Ga0495664_0311386
1170 Ga0495594_0554171
1171 Ga0495608_0102763
1172 Ga0495630_0321500
1173 Ga0495652_0038883
1174 Ga0495652_0251625
1175 Ga0495652_0806228
1176 Ga0495665_0032837
1177 Ga0495665_0327226
1178 Ga0495640_0745419
1179 Ga0495586_0193849
1180 Ga0495587_0001029
1181 Ga0495645_0158553
1182 Ga0495667_0029952
1183 Ga0495635_0260280
1184 Ga0495599_0002515
1185 Ga0495599_0135491
1186 Ga0495658_0376517
1187 Ga0495613_0099922
1188 Ga0495624_0194872
1189 Ga0495581_0106336
1190 Ga0495636_0135824
1191 Ga0495674_0034128
1192 Ga0495684_0004783
1193 Ga0495684_0079052
1194 Ga0495684_0090423
1195 Ga0495684_0117255
1196 Ga0495602_0004860
1197 Ga0496104_0093893
1198 Ga0496104_0220678
1199 Ga0496112_0710138
1200 Ga0501031_0024958
1201 Ga0501032_0002829
1202 Ga0501033_0173387
1203 Ga0501033_0240372
1204 Ga0501036_0016136
1205 Ga0501036_0064791
1206 Ga0501036_0101175
1207 Ga0501036_0110437
1208 Ga0501036_0652251
1209 Ga0501037_0002336
1210 Ga0501037_0328485
1211 Ga0501038_0058202
1212 Ga0501039_0010138
1213 Ga0501039_0054920
1214 Ga0501040_0017997
1215 Ga0501040_0095332
1216 Ga0501040_0120689
1217 Ga0501040_0355681
1218 Ga0501041_0028576
1219 Ga0501042_0190730
1220 Ga0501042_0383643
1221 Ga0501042_0394771
1222 Ga0501043_0002869
1223 Ga0501043_0542922
1224 Ga0501046_0000891
1225 Ga0501047_0053769
1226 Ga0501047_0072541
1227 Ga0501047_0089907
1228 Ga0501047_0616195
1229 Ga0501048_0019755
1230 Ga0501048_0063589
1231 Ga0501048_0181961
1232 Ga0501067_0005450
1233 Ga0501068_0000705
1234 Ga0501069_0008380
1235 Ga0501070_0035723
1236 Ga0501070_0042195
1237 Ga0501070_0382014
1238 Ga0501071_0026669
1239 Ga0501071_0031859
1240 Ga0501072_0000736
1241 Ga0501072_0040100
1242 Ga0501072_0205945
1243 Ga0501072_0354652
1244 Ga0501073_0033404
1245 Ga0501074_0025747
1246 Ga0501075_0012252
1247 Ga0501075_0088179
1248 Ga0501075_0584164
1249 Ga0501076_0010220
1250 Ga0501076_0019825
1251 Ga0501076_0032029
1252 Ga0501076_0044155
1253 Ga0501076_0063692
1254 Ga0501077_0009195
1255 Ga0501079_0015464
1256 Ga0501079_0041449
1257 Ga0501079_0042054
1258 Ga0501080_0000530
1259 Ga0501080_0086204
1260 Ga0501081_0078835
1261 Ga0501081_0427789
1262 Ga0501083_0348670
1263 Ga0501083_0580982
1264 Ga0501035_0035479
1265 Ga0501044_0037084
1266 Ga0501044_0101739
1267 Ga0501044_0140181
1268 Ga0501045_0002984
1269 Ga0501045_0030224
1270 Ga0501045_0154063
1271 Ga0501045_0272038
1272 Ga0501045_0566515
1273 nmdc:mga03n38_42649_c1
1274 nmdc:mga00v17_11698_c1
1275 nmdc:mga00v17_45696_c1
1276 nmdc:mga0yw44_198827_c1
1277 nmdc:mga0k408_138701_c1
1278 nmdc:mga04h51_148517_c1
1279 nmdc:mga04h51_202134_c1
1280 nmdc:mga07m45_15297_c1
1281 nmdc:mga07m45_85741_c1
1282 nmdc:mga05p37_117639_c1
1283 nmdc:mga05p37_302792_c1
1284 nmdc:mga05p37_326841_c1
1285 nmdc:mga09592_403103_c1
1286 nmdc:mga09592_437005_c1
1287 nmdc:mga09592_76103_c1
1288 nmdc:mga0qj67_126426_c1
1289 nmdc:mga06r32_118139_c1
1290 nmdc:mga06r32_77023_c1
1291 nmdc:mga08y16_29507_c1
1292 nmdc:mga0n895_1560156_c1
1293 nmdc:mga0a205_1070824_c1
1294 Ga0500641_0316892
1295 Ga0500594_0039642
1296 Ga0500568_0053423
1297 Ga0500568_0167241
1298 Ga0500577_0214328
1299 Ga0500616_0000064
1300 Ga0500616_0007872
1301 Ga0501084_0000777
1302 Ga0501084_0195849
1303 Ga0501084_0211262
1304 Ga0501084_0320976
1305 Ga0501082_0018816
1306 Ga0501082_0085469
1307 Ga0501082_0108191
1308 Ga0501082_0143537
1309 Ga0501082_0167978
1310 Ga0501082_0555665
1311 Ga0530510_0100097
1312 Ga0530510_1101544

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

47

159

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.9553 41 210
3nrj-assembly3.cif.gz_I crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium 0.9544 44 216
4umf-assembly1.cif.gz_C crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule 0.9514 44 217
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9505 40 211
4nav-assembly1.cif.gz_D crystal structure of hypothetical protein xcc2798 from xanthomonas campestris, target efi-508608 0.9426 38 217
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9522 41 211 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9488 44 217 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9461 39 217 3.40.50.1000
2p9jF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9307 46 206 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9226 44 217 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7C3GH99-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9918 41 219 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A3D1N6Z1-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9894 41 217 GO:0008781
GO:0009103
GO:0016788
AF-A0A7V8DCC6-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) 0.988 44 217 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A317IC72-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9877 41 220 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A1F9ZK86-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9872 42 217 GO:0008781
GO:0009103
GO:0016788
GO:0046872

Map