F473022
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 277 | 1312 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300025906|Ga0207699_10483322|Ga0207699_104833222 |
| Length | 181 |
| Sequence | MNPEIQQRAARVRLLLMDVDGVLTDGLIYNVPSPAEPHIAETKGFNSQDGIALQWLTWCGIHTGIISGRVSKAAEVRAEQVGMTYVYQGHIEKLPILQDIIARSNLAADAIAYMGDDLTDVPVMRSVGLALATANARPEVKRVAHYVTLVSGGAGAVREVAELLLEAHGRWADILRKYGVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 183 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 192 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 258 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 261 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 262 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 271 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 272 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 273 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 274 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.66 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 94.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207699_10483322 | 3300025906 | Bacteria | 892 |
| 2 | Ga0070658_10006989 | 3300005327 | Bacteria | 9116 |
| 3 | Ga0070658_10016641 | 3300005327 | Bacteria | 5885 |
| 4 | Ga0070658_10909089 | 3300005327 | Bacteria | 765 |
| 5 | Ga0070683_100000311 | 3300005329 | Bacteria | 33501 |
| 6 | Ga0070683_100020847 | 3300005329 | Bacteria | 5841 |
| 7 | Ga0070683_100402661 | 3300005329 | Unclassified | 1305 |
| 8 | Ga0070670_100903434 | 3300005331 | Bacteria | 801 |
| 9 | Ga0070677_10257320 | 3300005333 | Unclassified | 869 |
| 10 | Ga0068869_100403166 | 3300005334 | Unclassified | 1125 |
| 11 | Ga0068869_100420981 | 3300005334 | Bacteria | 1102 |
| 12 | Ga0068869_101065409 | 3300005334 | Unclassified | 706 |
| 13 | Ga0070666_10003261 | 3300005335 | Bacteria | 9853 |
| 14 | Ga0070680_100002798 | 3300005336 | Bacteria | 12956 |
| 15 | Ga0070680_100044956 | 3300005336 | Bacteria | 3589 |
| 16 | Ga0070680_100259270 | 3300005336 | Bacteria | 1470 |
| 17 | Ga0068868_100042751 | 3300005338 | Bacteria | 3538 |
| 18 | Ga0068868_100123146 | 3300005338 | Bacteria | 2116 |
| 19 | Ga0068868_100472620 | 3300005338 | Unclassified | 1094 |
| 20 | Ga0068868_100606147 | 3300005338 | Bacteria | 971 |
| 21 | Ga0070660_100272182 | 3300005339 | Unclassified | 1384 |
| 22 | Ga0070689_100594305 | 3300005340 | Bacteria | 958 |
| 23 | Ga0070689_100890457 | 3300005340 | Unclassified | 787 |
| 24 | Ga0070668_100150643 | 3300005347 | Bacteria | 1881 |
| 25 | Ga0070675_100817145 | 3300005354 | Bacteria | 852 |
| 26 | Ga0070673_100056170 | 3300005364 | Unclassified | 3105 |
| 27 | Ga0070673_100110900 | 3300005364 | Bacteria | 2275 |
| 28 | Ga0070673_100641999 | 3300005364 | Bacteria | 971 |
| 29 | Ga0070688_100082121 | 3300005365 | Unclassified | 2088 |
| 30 | Ga0070667_100036409 | 3300005367 | Bacteria | 4126 |
| 31 | Ga0070667_100557917 | 3300005367 | Unclassified | 1053 |
| 32 | Ga0070714_100024195 | 3300005435 | Unclassified | 4996 |
| 33 | Ga0070713_100006862 | 3300005436 | Bacteria | 7937 |
| 34 | Ga0070713_100075625 | 3300005436 | Bacteria | 2857 |
| 35 | Ga0070701_10347955 | 3300005438 | Unclassified | 925 |
| 36 | Ga0070711_100230391 | 3300005439 | Unclassified | 1444 |
| 37 | Ga0070711_100403437 | 3300005439 | Unclassified | 1110 |
| 38 | Ga0070711_100503855 | 3300005439 | Unclassified | 999 |
| 39 | Ga0070705_100376293 | 3300005440 | Bacteria | 1044 |
| 40 | Ga0070705_100439978 | 3300005440 | Unclassified | 975 |
| 41 | Ga0070700_100062556 | 3300005441 | Bacteria | 2352 |
| 42 | Ga0070708_100256013 | 3300005445 | Unclassified | 1645 |
| 43 | Ga0070663_100983289 | 3300005455 | Bacteria | 733 |
| 44 | Ga0070678_100645484 | 3300005456 | Unclassified | 949 |
| 45 | Ga0070681_10003037 | 3300005458 | Bacteria | 15558 |
| 46 | Ga0070681_10028271 | 3300005458 | Bacteria | 5637 |
| 47 | Ga0070681_10171650 | 3300005458 | Bacteria | 2090 |
| 48 | Ga0070681_10259537 | 3300005458 | Bacteria | 1650 |
| 49 | Ga0070681_10289138 | 3300005458 | Unclassified | 1549 |
| 50 | Ga0070681_10396963 | 3300005458 | Unclassified | 1290 |
| 51 | Ga0068867_100104591 | 3300005459 | Bacteria | 2167 |
| 52 | Ga0068867_100201996 | 3300005459 | Bacteria | 1592 |
| 53 | Ga0068867_100855518 | 3300005459 | Bacteria | 815 |
| 54 | Ga0068867_100885719 | 3300005459 | Unclassified | 802 |
| 55 | Ga0070685_10353531 | 3300005466 | Bacteria | 1005 |
| 56 | Ga0070706_100589040 | 3300005467 | Bacteria | 1034 |
| 57 | Ga0070706_100611751 | 3300005467 | Unclassified | 1012 |
| 58 | Ga0070698_100839553 | 3300005471 | Bacteria | 863 |
| 59 | Ga0070699_100865263 | 3300005518 | Bacteria | 827 |
| 60 | Ga0070679_100000635 | 3300005530 | Bacteria | 29869 |
| 61 | Ga0070679_100733184 | 3300005530 | Unclassified | 931 |
| 62 | Ga0070684_100000083 | 3300005535 | Bacteria | 61611 |
| 63 | Ga0070684_100000654 | 3300005535 | Bacteria | 23885 |
| 64 | Ga0070684_100016124 | 3300005535 | Bacteria | 6104 |
| 65 | Ga0070684_100297767 | 3300005535 | Bacteria | 1480 |
| 66 | Ga0070684_100592227 | 3300005535 | Unclassified | 1031 |
| 67 | Ga0068853_100006617 | 3300005539 | Bacteria | 9227 |
| 68 | Ga0068853_100104391 | 3300005539 | Unclassified | 2509 |
| 69 | Ga0068853_100681178 | 3300005539 | Bacteria | 980 |
| 70 | Ga0068853_101797926 | 3300005539 | Unclassified | 594 |
| 71 | Ga0070672_100298771 | 3300005543 | Bacteria | 1364 |
| 72 | Ga0070672_100327314 | 3300005543 | Bacteria | 1303 |
| 73 | Ga0070672_100462048 | 3300005543 | Bacteria | 1094 |
| 74 | Ga0070696_100000050 | 3300005546 | Bacteria | 54623 |
| 75 | Ga0070696_100670936 | 3300005546 | Unclassified | 842 |
| 76 | Ga0070693_100334539 | 3300005547 | Unclassified | 1032 |
| 77 | Ga0070665_100019235 | 3300005548 | Bacteria | 6852 |
| 78 | Ga0070665_100693964 | 3300005548 | Unclassified | 1031 |
| 79 | Ga0070665_100771234 | 3300005548 | Bacteria | 974 |
| 80 | Ga0070665_100867957 | 3300005548 | Unclassified | 915 |
| 81 | Ga0070704_100025689 | 3300005549 | Bacteria | 3881 |
| 82 | Ga0068855_100004338 | 3300005563 | Bacteria | 17341 |
| 83 | Ga0068855_100004719 | 3300005563 | Bacteria | 16647 |
| 84 | Ga0068855_100004892 | 3300005563 | Bacteria | 16357 |
| 85 | Ga0068855_100015324 | 3300005563 | Bacteria | 9231 |
| 86 | Ga0068855_100042704 | 3300005563 | Bacteria | 5372 |
| 87 | Ga0068855_100211405 | 3300005563 | Bacteria | 2179 |
| 88 | Ga0068855_100731166 | 3300005563 | Unclassified | 1057 |
| 89 | Ga0070664_100311508 | 3300005564 | Bacteria | 1425 |
| 90 | Ga0068857_100000367 | 3300005577 | Bacteria | 31519 |
| 91 | Ga0068857_100068345 | 3300005577 | Bacteria | 3162 |
| 92 | Ga0068857_100138038 | 3300005577 | Bacteria | 2202 |
| 93 | Ga0068857_100166942 | 3300005577 | Unclassified | 1999 |
| 94 | Ga0068857_100396918 | 3300005577 | Bacteria | 1283 |
| 95 | Ga0068854_100770960 | 3300005578 | Bacteria | 836 |
| 96 | Ga0068856_100008120 | 3300005614 | Bacteria | 10244 |
| 97 | Ga0068856_100151499 | 3300005614 | Bacteria | 2328 |
| 98 | Ga0068856_100281711 | 3300005614 | Unclassified | 1679 |
| 99 | Ga0068856_100390235 | 3300005614 | Bacteria | 1412 |
| 100 | Ga0068856_100401359 | 3300005614 | Bacteria | 1391 |
| 101 | Ga0068856_100564756 | 3300005614 | Bacteria | 1159 |
| 102 | Ga0068856_101075052 | 3300005614 | Unclassified | 822 |
| 103 | Ga0068852_100006117 | 3300005616 | Bacteria | 8679 |
| 104 | Ga0068852_100027317 | 3300005616 | Bacteria | 4651 |
| 105 | Ga0068852_100054251 | 3300005616 | Bacteria | 3454 |
| 106 | Ga0068852_100149453 | 3300005616 | Unclassified | 2171 |
| 107 | Ga0068859_100111539 | 3300005617 | Unclassified | 2798 |
| 108 | Ga0068864_100059398 | 3300005618 | Bacteria | 3309 |
| 109 | Ga0068864_100416306 | 3300005618 | Bacteria | 1280 |
| 110 | Ga0068864_100971742 | 3300005618 | Unclassified | 841 |
| 111 | Ga0068866_10232888 | 3300005718 | Bacteria | 1118 |
| 112 | Ga0068851_10100425 | 3300005834 | Bacteria | 1535 |
| 113 | Ga0068851_10297001 | 3300005834 | Unclassified | 928 |
| 114 | Ga0068870_10508150 | 3300005840 | Bacteria | 804 |
| 115 | Ga0068863_100018498 | 3300005841 | Bacteria | 6669 |
| 116 | Ga0068863_100085404 | 3300005841 | Bacteria | 2991 |
| 117 | Ga0068858_100008758 | 3300005842 | Bacteria | 9709 |
| 118 | Ga0068858_100044408 | 3300005842 | Bacteria | 4119 |
| 119 | Ga0068858_100126717 | 3300005842 | Unclassified | 2391 |
| 120 | Ga0068858_100432435 | 3300005842 | Bacteria | 1267 |
| 121 | Ga0068858_101129314 | 3300005842 | Unclassified | 770 |
| 122 | Ga0068860_100010166 | 3300005843 | Bacteria | 9323 |
| 123 | Ga0068860_100475803 | 3300005843 | Bacteria | 1244 |
| 124 | Ga0068860_100805118 | 3300005843 | Bacteria | 953 |
| 125 | Ga0068862_100126840 | 3300005844 | Bacteria | 2254 |
| 126 | Ga0068862_100147334 | 3300005844 | Bacteria | 2093 |
| 127 | Ga0068862_101181698 | 3300005844 | Unclassified | 763 |
| 128 | Ga0070717_10012251 | 3300006028 | Bacteria | 6539 |
| 129 | Ga0070717_10667011 | 3300006028 | Bacteria | 944 |
| 130 | Ga0070717_10847212 | 3300006028 | Unclassified | 832 |
| 131 | Ga0070717_11106249 | 3300006028 | Unclassified | 722 |
| 132 | Ga0075365_10140235 | 3300006038 | Bacteria | 1678 |
| 133 | Ga0075368_10041349 | 3300006042 | Bacteria | 1811 |
| 134 | Ga0075363_100044016 | 3300006048 | Bacteria | 2363 |
| 135 | Ga0070712_100661921 | 3300006175 | Unclassified | 888 |
| 136 | Ga0070712_100903984 | 3300006175 | Unclassified | 761 |
| 137 | Ga0075367_10022665 | 3300006178 | Bacteria | 3525 |
| 138 | Ga0075366_10022552 | 3300006195 | Bacteria | 3663 |
| 139 | Ga0097621_100013303 | 3300006237 | Bacteria | 6130 |
| 140 | Ga0097621_100057243 | 3300006237 | Bacteria | 3187 |
| 141 | Ga0097621_100100157 | 3300006237 | Bacteria | 2437 |
| 142 | Ga0097621_100151277 | 3300006237 | Bacteria | 1990 |
| 143 | Ga0075370_10273694 | 3300006353 | Bacteria | 1002 |
| 144 | Ga0068871_100025726 | 3300006358 | Unclassified | 4583 |
| 145 | Ga0068871_100071576 | 3300006358 | Bacteria | 2852 |
| 146 | Ga0075428_100154107 | 3300006844 | Bacteria | 2496 |
| 147 | Ga0075428_100173427 | 3300006844 | Unclassified | 2337 |
| 148 | Ga0075428_100405707 | 3300006844 | Unclassified | 1460 |
| 149 | Ga0075428_100408245 | 3300006844 | Unclassified | 1455 |
| 150 | Ga0075428_101054087 | 3300006844 | Unclassified | 860 |
| 151 | Ga0075430_100003279 | 3300006846 | Bacteria | 13571 |
| 152 | Ga0075431_100055263 | 3300006847 | Bacteria | 4095 |
| 153 | Ga0075429_100098917 | 3300006880 | Bacteria | 2545 |
| 154 | Ga0075429_100159560 | 3300006880 | Unclassified | 1975 |
| 155 | Ga0068865_100060529 | 3300006881 | Bacteria | 2651 |
| 156 | Ga0068865_100569326 | 3300006881 | Unclassified | 954 |
| 157 | Ga0068865_100618766 | 3300006881 | Bacteria | 917 |
| 158 | Ga0068865_101164012 | 3300006881 | Bacteria | 681 |
| 159 | Ga0097620_100088218 | 3300006931 | Bacteria | 3151 |
| 160 | Ga0097620_100111540 | 3300006931 | Unclassified | 2798 |
| 161 | Ga0105240_10000425 | 3300009093 | Bacteria | 78173 |
| 162 | Ga0105240_10004013 | 3300009093 | Bacteria | 22665 |
| 163 | Ga0105240_10004427 | 3300009093 | Bacteria | 21416 |
| 164 | Ga0105240_10004590 | 3300009093 | Bacteria | 20936 |
| 165 | Ga0105240_10051759 | 3300009093 | Bacteria | 5166 |
| 166 | Ga0105240_10197424 | 3300009093 | Unclassified | 2361 |
| 167 | Ga0105240_10321264 | 3300009093 | Bacteria | 1764 |
| 168 | Ga0105240_10518989 | 3300009093 | Unclassified | 1322 |
| 169 | Ga0105240_11097154 | 3300009093 | Bacteria | 847 |
| 170 | Ga0105240_11355755 | 3300009093 | Bacteria | 749 |
| 171 | Ga0111539_10030828 | 3300009094 | Bacteria | 6518 |
| 172 | Ga0105245_10009493 | 3300009098 | Bacteria | 8485 |
| 173 | Ga0105245_10037377 | 3300009098 | Bacteria | 4315 |
| 174 | Ga0105245_10037757 | 3300009098 | Bacteria | 4295 |
| 175 | Ga0105245_10058855 | 3300009098 | Bacteria | 3459 |
| 176 | Ga0105245_10067091 | 3300009098 | Bacteria | 3249 |
| 177 | Ga0105245_10653562 | 3300009098 | Unclassified | 1082 |
| 178 | Ga0105245_11167889 | 3300009098 | Unclassified | 817 |
| 179 | Ga0105245_11501279 | 3300009098 | Bacteria | 725 |
| 180 | Ga0114129_10004072 | 3300009147 | Bacteria | 20643 |
| 181 | Ga0114129_10103657 | 3300009147 | Bacteria | 3933 |
| 182 | Ga0114129_11028867 | 3300009147 | Bacteria | 1035 |
| 183 | Ga0105243_10082795 | 3300009148 | Bacteria | 2623 |
| 184 | Ga0105243_10115942 | 3300009148 | Unclassified | 2250 |
| 185 | Ga0105243_10566441 | 3300009148 | Unclassified | 1088 |
| 186 | Ga0105241_10100728 | 3300009174 | Bacteria | 2296 |
| 187 | Ga0105241_10222366 | 3300009174 | Bacteria | 1588 |
| 188 | Ga0105241_10335867 | 3300009174 | Bacteria | 1307 |
| 189 | Ga0105241_10397582 | 3300009174 | Bacteria | 1208 |
| 190 | Ga0105241_10576353 | 3300009174 | Bacteria | 1014 |
| 191 | Ga0105242_10039448 | 3300009176 | Unclassified | 3801 |
| 192 | Ga0105242_10046600 | 3300009176 | Bacteria | 3517 |
| 193 | Ga0105242_10133520 | 3300009176 | Unclassified | 2146 |
| 194 | Ga0105242_10305572 | 3300009176 | Bacteria | 1453 |
| 195 | Ga0105248_10106725 | 3300009177 | Bacteria | 3157 |
| 196 | Ga0105248_10303561 | 3300009177 | Bacteria | 1798 |
| 197 | Ga0105248_10315432 | 3300009177 | Bacteria | 1761 |
| 198 | Ga0105248_10379429 | 3300009177 | Bacteria | 1592 |
| 199 | Ga0105237_10002573 | 3300009545 | Bacteria | 22369 |
| 200 | Ga0105237_10004735 | 3300009545 | Bacteria | 15648 |
| 201 | Ga0105237_10006074 | 3300009545 | Bacteria | 13509 |
| 202 | Ga0105237_10008630 | 3300009545 | Bacteria | 11017 |
| 203 | Ga0105237_10036751 | 3300009545 | Bacteria | 4955 |
| 204 | Ga0105237_10050310 | 3300009545 | Unclassified | 4187 |
| 205 | Ga0105237_10173606 | 3300009545 | Bacteria | 2156 |
| 206 | Ga0105237_10280551 | 3300009545 | Bacteria | 1668 |
| 207 | Ga0105238_10004596 | 3300009551 | Bacteria | 13651 |
| 208 | Ga0105238_10016508 | 3300009551 | Bacteria | 7473 |
| 209 | Ga0105238_10051413 | 3300009551 | Unclassified | 4145 |
| 210 | Ga0105238_10060232 | 3300009551 | Bacteria | 3801 |
| 211 | Ga0105238_10139192 | 3300009551 | Bacteria | 2404 |
| 212 | Ga0105238_10228567 | 3300009551 | Bacteria | 1837 |
| 213 | Ga0105249_10086522 | 3300009553 | Unclassified | 2923 |
| 214 | Ga0105239_10006098 | 3300010375 | Bacteria | 14036 |
| 215 | Ga0105239_10021394 | 3300010375 | Bacteria | 7131 |
| 216 | Ga0105239_10124479 | 3300010375 | Bacteria | 2864 |
| 217 | Ga0105239_11264077 | 3300010375 | Bacteria | 851 |
| 218 | Ga0105239_11439695 | 3300010375 | Bacteria | 796 |
| 219 | Ga0105239_11636383 | 3300010375 | Unclassified | 745 |
| 220 | Ga0105246_10167189 | 3300011119 | Unclassified | 1681 |
| 221 | Ga0105246_10666327 | 3300011119 | Unclassified | 908 |
| 222 | Ga0157370_10004065 | 3300013104 | Bacteria | 16962 |
| 223 | Ga0157370_10004342 | 3300013104 | Bacteria | 16282 |
| 224 | Ga0157370_10007561 | 3300013104 | Bacteria | 11804 |
| 225 | Ga0157370_10033773 | 3300013104 | Bacteria | 4986 |
| 226 | Ga0157369_10010818 | 3300013105 | Bacteria | 10391 |
| 227 | Ga0157369_10031617 | 3300013105 | Bacteria | 5827 |
| 228 | Ga0157369_10034595 | 3300013105 | Bacteria | 5542 |
| 229 | Ga0157369_10461466 | 3300013105 | Bacteria | 1315 |
| 230 | Ga0157369_10546428 | 3300013105 | Unclassified | 1197 |
| 231 | Ga0157374_10092956 | 3300013296 | Bacteria | 2879 |
| 232 | Ga0157374_10237206 | 3300013296 | Bacteria | 1793 |
| 233 | Ga0157374_10544079 | 3300013296 | Bacteria | 1168 |
| 234 | Ga0157378_10022676 | 3300013297 | Bacteria | 5526 |
| 235 | Ga0157378_10157708 | 3300013297 | Unclassified | 2120 |
| 236 | Ga0157378_11365319 | 3300013297 | Bacteria | 751 |
| 237 | Ga0163162_10210252 | 3300013306 | Bacteria | 2075 |
| 238 | Ga0163162_10279259 | 3300013306 | Bacteria | 1802 |
| 239 | Ga0157372_10022557 | 3300013307 | Bacteria | 6813 |
| 240 | Ga0157372_10023943 | 3300013307 | Bacteria | 6625 |
| 241 | Ga0157372_10050240 | 3300013307 | Unclassified | 4639 |
| 242 | Ga0157372_10252403 | 3300013307 | Unclassified | 2048 |
| 243 | Ga0157372_10304976 | 3300013307 | Bacteria | 1852 |
| 244 | Ga0157372_10520000 | 3300013307 | Bacteria | 1387 |
| 245 | Ga0157375_10006626 | 3300013308 | Bacteria | 10078 |
| 246 | Ga0157375_10079224 | 3300013308 | Unclassified | 3320 |
| 247 | Ga0157375_10105798 | 3300013308 | Bacteria | 2905 |
| 248 | Ga0157375_10319899 | 3300013308 | Bacteria | 1716 |
| 249 | Ga0157375_11117991 | 3300013308 | Unclassified | 923 |
| 250 | Ga0157375_11701848 | 3300013308 | Bacteria | 747 |
| 251 | Ga0163163_10041459 | 3300014325 | Bacteria | 4501 |
| 252 | Ga0163163_10048599 | 3300014325 | Unclassified | 4173 |
| 253 | Ga0163163_10251178 | 3300014325 | Bacteria | 1819 |
| 254 | Ga0163163_10518031 | 3300014325 | Unclassified | 1255 |
| 255 | Ga0163163_10735745 | 3300014325 | Bacteria | 1050 |
| 256 | Ga0157380_10016887 | 3300014326 | Bacteria | 5390 |
| 257 | Ga0157379_10030883 | 3300014968 | Bacteria | 4772 |
| 258 | Ga0157379_10109114 | 3300014968 | Bacteria | 2485 |
| 259 | Ga0157379_10982526 | 3300014968 | Unclassified | 804 |
| 260 | Ga0157376_10090339 | 3300014969 | Bacteria | 2650 |
| 261 | Ga0157376_10251876 | 3300014969 | Bacteria | 1650 |
| 262 | Ga0157376_10273177 | 3300014969 | Bacteria | 1589 |
| 263 | Ga0157376_11305961 | 3300014969 | Bacteria | 756 |
| 264 | Ga0213875_10002156 | 3300021388 | Bacteria | 12008 |
| 265 | Ga0207642_10345694 | 3300025899 | Unclassified | 876 |
| 266 | Ga0207680_10117683 | 3300025903 | Bacteria | 1733 |
| 267 | Ga0207685_10151966 | 3300025905 | Bacteria | 1048 |
| 268 | Ga0207699_10118690 | 3300025906 | Unclassified | 1707 |
| 269 | Ga0207699_10173507 | 3300025906 | Bacteria | 1444 |
| 270 | Ga0207645_10466563 | 3300025907 | Unclassified | 853 |
| 271 | Ga0207643_10217219 | 3300025908 | Bacteria | 1169 |
| 272 | Ga0207705_10023248 | 3300025909 | Bacteria | 4423 |
| 273 | Ga0207705_10031840 | 3300025909 | Bacteria | 3767 |
| 274 | Ga0207705_10736850 | 3300025909 | Bacteria | 766 |
| 275 | Ga0207684_10261915 | 3300025910 | Bacteria | 1492 |
| 276 | Ga0207684_10566938 | 3300025910 | Unclassified | 971 |
| 277 | Ga0207654_10497306 | 3300025911 | Bacteria | 861 |
| 278 | Ga0207707_10002533 | 3300025912 | Bacteria | 16403 |
| 279 | Ga0207707_10119519 | 3300025912 | Bacteria | 2303 |
| 280 | Ga0207707_10342588 | 3300025912 | Unclassified | 1289 |
| 281 | Ga0207707_10884683 | 3300025912 | Unclassified | 739 |
| 282 | Ga0207695_10000770 | 3300025913 | Bacteria | 60994 |
| 283 | Ga0207695_10001974 | 3300025913 | Bacteria | 31730 |
| 284 | Ga0207695_10002883 | 3300025913 | Bacteria | 24934 |
| 285 | Ga0207695_10015601 | 3300025913 | Bacteria | 8935 |
| 286 | Ga0207695_10026708 | 3300025913 | Bacteria | 6442 |
| 287 | Ga0207695_10095725 | 3300025913 | Bacteria | 2972 |
| 288 | Ga0207695_10137834 | 3300025913 | Bacteria | 2392 |
| 289 | Ga0207695_10175197 | 3300025913 | Bacteria | 2068 |
| 290 | Ga0207695_10258355 | 3300025913 | Unclassified | 1640 |
| 291 | Ga0207695_10780919 | 3300025913 | Unclassified | 835 |
| 292 | Ga0207671_10037524 | 3300025914 | Unclassified | 3593 |
| 293 | Ga0207663_10462636 | 3300025916 | Bacteria | 980 |
| 294 | Ga0207660_10052665 | 3300025917 | Bacteria | 2898 |
| 295 | Ga0207660_10106744 | 3300025917 | Bacteria | 2100 |
| 296 | Ga0207660_10166878 | 3300025917 | Bacteria | 1702 |
| 297 | Ga0207657_10002248 | 3300025919 | Bacteria | 20932 |
| 298 | Ga0207657_10107771 | 3300025919 | Bacteria | 2304 |
| 299 | Ga0207649_10162490 | 3300025920 | Bacteria | 1549 |
| 300 | Ga0207649_10682028 | 3300025920 | Bacteria | 796 |
| 301 | Ga0207652_10244931 | 3300025921 | Bacteria | 1616 |
| 302 | Ga0207652_10983910 | 3300025921 | Unclassified | 742 |
| 303 | Ga0207694_10002949 | 3300025924 | Bacteria | 13660 |
| 304 | Ga0207694_10004275 | 3300025924 | Bacteria | 11180 |
| 305 | Ga0207694_10009667 | 3300025924 | Bacteria | 7269 |
| 306 | Ga0207694_10033095 | 3300025924 | Bacteria | 3959 |
| 307 | Ga0207694_10086845 | 3300025924 | Bacteria | 2463 |
| 308 | Ga0207694_10244086 | 3300025924 | Unclassified | 1468 |
| 309 | Ga0207694_10291360 | 3300025924 | Bacteria | 1342 |
| 310 | Ga0207694_10311951 | 3300025924 | Unclassified | 1297 |
| 311 | Ga0207694_10563250 | 3300025924 | Unclassified | 957 |
| 312 | Ga0207650_11170009 | 3300025925 | Bacteria | 655 |
| 313 | Ga0207659_10685823 | 3300025926 | Bacteria | 877 |
| 314 | Ga0207687_10000988 | 3300025927 | Bacteria | 19282 |
| 315 | Ga0207687_10012601 | 3300025927 | Bacteria | 5523 |
| 316 | Ga0207687_10055562 | 3300025927 | Bacteria | 2775 |
| 317 | Ga0207687_10899272 | 3300025927 | Unclassified | 757 |
| 318 | Ga0207700_10007610 | 3300025928 | Bacteria | 6642 |
| 319 | Ga0207700_10050923 | 3300025928 | Bacteria | 3088 |
| 320 | Ga0207700_10170346 | 3300025928 | Unclassified | 1816 |
| 321 | Ga0207700_10209818 | 3300025928 | Bacteria | 1646 |
| 322 | Ga0207700_11261143 | 3300025928 | Bacteria | 659 |
| 323 | Ga0207664_10034142 | 3300025929 | Unclassified | 3915 |
| 324 | Ga0207664_10070200 | 3300025929 | Bacteria | 2819 |
| 325 | Ga0207644_10104682 | 3300025931 | Bacteria | 2131 |
| 326 | Ga0207686_10009081 | 3300025934 | Bacteria | 5387 |
| 327 | Ga0207686_10020487 | 3300025934 | Unclassified | 3779 |
| 328 | Ga0207686_10027511 | 3300025934 | Unclassified | 3331 |
| 329 | Ga0207686_10157557 | 3300025934 | Bacteria | 1588 |
| 330 | Ga0207686_10180548 | 3300025934 | Unclassified | 1496 |
| 331 | Ga0207709_10307369 | 3300025935 | Unclassified | 1181 |
| 332 | Ga0207709_10402679 | 3300025935 | Bacteria | 1047 |
| 333 | Ga0207669_10223355 | 3300025937 | Unclassified | 1384 |
| 334 | Ga0207691_10302776 | 3300025940 | Bacteria | 1373 |
| 335 | Ga0207691_10331795 | 3300025940 | Bacteria | 1303 |
| 336 | Ga0207711_10001479 | 3300025941 | Bacteria | 21857 |
| 337 | Ga0207711_10109759 | 3300025941 | Bacteria | 2452 |
| 338 | Ga0207711_10254993 | 3300025941 | Bacteria | 1612 |
| 339 | Ga0207711_10284480 | 3300025941 | Bacteria | 1523 |
| 340 | Ga0207711_10339552 | 3300025941 | Bacteria | 1390 |
| 341 | Ga0207689_10116463 | 3300025942 | Bacteria | 2197 |
| 342 | Ga0207661_10000054 | 3300025944 | Bacteria | 88056 |
| 343 | Ga0207661_10019015 | 3300025944 | Bacteria | 5112 |
| 344 | Ga0207661_10037048 | 3300025944 | Bacteria | 3811 |
| 345 | Ga0207661_10154424 | 3300025944 | Bacteria | 1986 |
| 346 | Ga0207661_10188958 | 3300025944 | Unclassified | 1805 |
| 347 | Ga0207661_10285765 | 3300025944 | Unclassified | 1475 |
| 348 | Ga0207661_10585305 | 3300025944 | Unclassified | 1024 |
| 349 | Ga0207679_10315248 | 3300025945 | Bacteria | 1352 |
| 350 | Ga0207679_10379551 | 3300025945 | Bacteria | 1239 |
| 351 | Ga0207667_10001168 | 3300025949 | Bacteria | 32962 |
| 352 | Ga0207667_10012046 | 3300025949 | Bacteria | 10001 |
| 353 | Ga0207667_10020486 | 3300025949 | Bacteria | 7354 |
| 354 | Ga0207667_10078273 | 3300025949 | Bacteria | 3427 |
| 355 | Ga0207667_10190963 | 3300025949 | Bacteria | 2101 |
| 356 | Ga0207667_10200393 | 3300025949 | Unclassified | 2048 |
| 357 | Ga0207667_10234519 | 3300025949 | Unclassified | 1878 |
| 358 | Ga0207651_10042970 | 3300025960 | Bacteria | 3013 |
| 359 | Ga0207651_10101214 | 3300025960 | Bacteria | 2138 |
| 360 | Ga0207651_10500447 | 3300025960 | Unclassified | 1050 |
| 361 | Ga0207712_10033380 | 3300025961 | Unclassified | 3479 |
| 362 | Ga0207668_10105064 | 3300025972 | Bacteria | 2107 |
| 363 | Ga0207658_10294968 | 3300025986 | Unclassified | 1395 |
| 364 | Ga0207677_10261187 | 3300026023 | Unclassified | 1412 |
| 365 | Ga0207677_10331944 | 3300026023 | Bacteria | 1267 |
| 366 | Ga0207703_10006724 | 3300026035 | Bacteria | 9174 |
| 367 | Ga0207703_10064333 | 3300026035 | Bacteria | 3010 |
| 368 | Ga0207703_10257876 | 3300026035 | Bacteria | 1575 |
| 369 | Ga0207703_10271368 | 3300026035 | Unclassified | 1537 |
| 370 | Ga0207703_10315071 | 3300026035 | Bacteria | 1431 |
| 371 | Ga0207703_10362349 | 3300026035 | Bacteria | 1337 |
| 372 | Ga0207703_10740012 | 3300026035 | Bacteria | 936 |
| 373 | Ga0207639_10012287 | 3300026041 | Bacteria | 5962 |
| 374 | Ga0207678_10926558 | 3300026067 | Bacteria | 771 |
| 375 | Ga0207708_10020557 | 3300026075 | Bacteria | 4978 |
| 376 | Ga0207702_10015956 | 3300026078 | Bacteria | 6218 |
| 377 | Ga0207702_10076470 | 3300026078 | Bacteria | 2894 |
| 378 | Ga0207702_10153417 | 3300026078 | Bacteria | 2097 |
| 379 | Ga0207702_10736031 | 3300026078 | Unclassified | 973 |
| 380 | Ga0207641_10051467 | 3300026088 | Bacteria | 3488 |
| 381 | Ga0207641_10267831 | 3300026088 | Bacteria | 1602 |
| 382 | Ga0207641_10553458 | 3300026088 | Bacteria | 1122 |
| 383 | Ga0207648_10066223 | 3300026089 | Bacteria | 3150 |
| 384 | Ga0207648_10126304 | 3300026089 | Bacteria | 2250 |
| 385 | Ga0207648_10556417 | 3300026089 | Unclassified | 1054 |
| 386 | Ga0207676_10205146 | 3300026095 | Unclassified | 1745 |
| 387 | Ga0207676_10333942 | 3300026095 | Bacteria | 1396 |
| 388 | Ga0207676_10844175 | 3300026095 | Unclassified | 896 |
| 389 | Ga0207676_10879604 | 3300026095 | Unclassified | 878 |
| 390 | Ga0207674_10000166 | 3300026116 | Bacteria | 79149 |
| 391 | Ga0207674_10003073 | 3300026116 | Bacteria | 20649 |
| 392 | Ga0207674_10003444 | 3300026116 | Bacteria | 19357 |
| 393 | Ga0207674_10012353 | 3300026116 | Bacteria | 9547 |
| 394 | Ga0207674_10047924 | 3300026116 | Bacteria | 4378 |
| 395 | Ga0207674_11070232 | 3300026116 | Bacteria | 776 |
| 396 | Ga0207675_100071065 | 3300026118 | Bacteria | 3254 |
| 397 | Ga0207675_100166876 | 3300026118 | Bacteria | 2103 |
| 398 | Ga0207675_100518920 | 3300026118 | Bacteria | 1187 |
| 399 | Ga0207675_100975639 | 3300026118 | Bacteria | 865 |
| 400 | Ga0207683_10026033 | 3300026121 | Bacteria | 5051 |
| 401 | Ga0207698_10161858 | 3300026142 | Bacteria | 1958 |
| 402 | Ga0207698_10253223 | 3300026142 | Unclassified | 1613 |
| 403 | Ga0207698_10293548 | 3300026142 | Bacteria | 1510 |
| 404 | Ga0207698_11180959 | 3300026142 | Bacteria | 779 |
| 405 | Ga0209813_10095185 | 3300027866 | Bacteria | 1006 |
| 406 | Ga0209813_10105144 | 3300027866 | Bacteria | 965 |
| 407 | Ga0207428_10004926 | 3300027907 | Bacteria | 12581 |
| 408 | Ga0268266_10375212 | 3300028379 | Bacteria | 1340 |
| 409 | Ga0268266_10654255 | 3300028379 | Unclassified | 1011 |
| 410 | Ga0268266_10762458 | 3300028379 | Unclassified | 934 |
| 411 | Ga0268265_10131581 | 3300028380 | Bacteria | 2080 |
| 412 | Ga0268265_10410637 | 3300028380 | Bacteria | 1254 |
| 413 | Ga0268264_10006848 | 3300028381 | Bacteria | 9568 |
| 414 | Ga0268264_10364502 | 3300028381 | Bacteria | 1379 |
| 415 | Ga0268264_10940952 | 3300028381 | Unclassified | 869 |
| 416 | Ga0268264_11011223 | 3300028381 | Bacteria | 838 |
| 417 | Ga0265336_10033052 | 3300028666 | Unclassified | 1603 |
| 418 | Ga0265338_10114625 | 3300028800 | Bacteria | 2162 |
| 419 | Ga0265338_10328095 | 3300028800 | Bacteria | 1106 |
| 420 | Ga0265338_10417462 | 3300028800 | Unclassified | 954 |
| 421 | Ga0265324_10045389 | 3300029957 | Unclassified | 1513 |
| 422 | Ga0265332_10174804 | 3300031238 | Bacteria | 896 |
| 423 | Ga0265320_10080044 | 3300031240 | Bacteria | 1526 |
| 424 | Ga0265325_10094325 | 3300031241 | Unclassified | 1472 |
| 425 | Ga0265339_10012490 | 3300031249 | Bacteria | 5184 |
| 426 | Ga0265331_10138557 | 3300031250 | Unclassified | 1107 |
| 427 | Ga0265331_10325346 | 3300031250 | Unclassified | 688 |
| 428 | Ga0265316_10104256 | 3300031344 | Bacteria | 2152 |
| 429 | Ga0265316_10575382 | 3300031344 | Unclassified | 800 |
| 430 | Ga0307408_100677181 | 3300031548 | Bacteria | 925 |
| 431 | Ga0316579_10025905 | 3300031691 | Bacteria | 2651 |
| 432 | Ga0265314_10007557 | 3300031711 | Bacteria | 9418 |
| 433 | Ga0265314_10046025 | 3300031711 | Bacteria | 3080 |
| 434 | Ga0265314_10127645 | 3300031711 | Bacteria | 1591 |
| 435 | Ga0265342_10139536 | 3300031712 | Bacteria | 1353 |
| 436 | Ga0316577_10013187 | 3300031733 | Bacteria | 4513 |
| 437 | Ga0373934_0059793 | 3300035086 | Bacteria | 1517 |
| 438 | Ga0373923_0011897 | 3300035111 | Bacteria | 3204 |
| 439 | Ga0373923_0021138 | 3300035111 | Unclassified | 2537 |
| 440 | Ga0373932_0300162 | 3300035112 | Bacteria | 599 |
| 441 | Ga0373945_0127005 | 3300035116 | Bacteria | 1019 |
| 442 | Ga0373953_0011892 | 3300035117 | Unclassified | 3067 |
| 443 | Ga0373953_0128148 | 3300035117 | Bacteria | 1081 |
| 444 | Ga0373954_0010358 | 3300035118 | Unclassified | 4114 |
| 445 | Ga0373954_0075680 | 3300035118 | Bacteria | 1603 |
| 446 | Ga0373954_0092489 | 3300035118 | Unclassified | 1453 |
| 447 | Ga0373956_0045432 | 3300035119 | Bacteria | 1960 |
| 448 | Ga0373956_0108234 | 3300035119 | Bacteria | 1293 |
| 449 | Ga0373957_0124923 | 3300035120 | Bacteria | 1044 |
| 450 | Ga0373957_0148175 | 3300035120 | Bacteria | 962 |
| 451 | Ga0373943_0006889 | 3300035170 | Bacteria | 5098 |
| 452 | Ga0373943_0315571 | 3300035170 | Unclassified | 890 |
| 453 | Ga0373946_0043217 | 3300035171 | Bacteria | 1856 |
| 454 | Ga0373955_0004130 | 3300035172 | Bacteria | 6407 |
| 455 | Ga0373955_0020349 | 3300035172 | Unclassified | 3335 |
| 456 | Ga0373955_0050553 | 3300035172 | Bacteria | 2261 |
| 457 | Ga0373955_0118827 | 3300035172 | Bacteria | 1535 |
| 458 | Ga0373942_0218400 | 3300035207 | Unclassified | 638 |
| 459 | Ga0316574_0164373 | 3300035398 | Bacteria | 1429 |
| 460 | Ga0316574_0355006 | 3300035398 | Bacteria | 927 |
| 461 | Ga0373935_0017968 | 3300035692 | Bacteria | 4298 |
| 462 | Ga0373935_0074109 | 3300035692 | Bacteria | 2200 |
| 463 | Ga0373935_0431415 | 3300035692 | Bacteria | 950 |
| 464 | Ga0373935_0632110 | 3300035692 | Bacteria | 784 |
| 465 | Ga0373927_0000450 | 3300035695 | Bacteria | 31454 |
| 466 | Ga0373927_0003519 | 3300035695 | Bacteria | 11202 |
| 467 | Ga0373927_0004539 | 3300035695 | Bacteria | 9701 |
| 468 | Ga0373927_0020232 | 3300035695 | Bacteria | 4364 |
| 469 | Ga0373933_0042127 | 3300035724 | Unclassified | 2698 |
| 470 | Ga0373933_0116332 | 3300035724 | Bacteria | 1671 |
| 471 | Ga0373933_0228111 | 3300035724 | Unclassified | 1196 |
| 472 | Ga0373933_0371849 | 3300035724 | Unclassified | 930 |
| 473 | Ga0373933_0386703 | 3300035724 | Unclassified | 912 |
| 474 | Ga0373933_0452234 | 3300035724 | Unclassified | 840 |
| 475 | Ga0373947_0000644 | 3300035725 | Bacteria | 20644 |
| 476 | Ga0373947_0005809 | 3300035725 | Bacteria | 7194 |
| 477 | Ga0373937_0005609 | 3300036401 | Bacteria | 10775 |
| 478 | Ga0373937_0009413 | 3300036401 | Bacteria | 8492 |
| 479 | Ga0373937_0216311 | 3300036401 | Bacteria | 1803 |
| 480 | Ga0373937_0234044 | 3300036401 | Bacteria | 1730 |
| 481 | Ga0316582_0010835 | 3300036647 | Bacteria | 5013 |
| 482 | Ga0316584_0047845 | 3300036712 | Bacteria | 3195 |
| 483 | Ga0316584_0128985 | 3300036712 | Bacteria | 1889 |
| 484 | Ga0373925_0002306 | 3300037068 | Bacteria | 15394 |
| 485 | Ga0373925_0020341 | 3300037068 | Bacteria | 4831 |
| 486 | Ga0373925_0195584 | 3300037068 | Bacteria | 1606 |
| 487 | Ga0395899_0255044 | 3300037312 | Bacteria | 1202 |
| 488 | Ga0395900_1152031 | 3300037418 | Unclassified | 692 |
| 489 | Ga0395898_0138332 | 3300037466 | Bacteria | 2332 |
| 490 | Ga0436364_0540469 | 3300037853 | Unclassified | 1987 |
| 491 | Ga0436364_0812157 | 3300037853 | Bacteria | 6873 |
| 492 | Ga0436364_0824849 | 3300037853 | Bacteria | 4170 |
| 493 | Ga0436364_1028841 | 3300037853 | Bacteria | 1272 |
| 494 | Ga0395901_1360216 | 3300038443 | Bacteria | 670 |
| 495 | Ga0436365_1106491 | 3300039437 | Bacteria | 2198 |
| 496 | Ga0436365_1136015 | 3300039437 | Unclassified | 1238 |
| 497 | Ga0436360_1162206 | 3300039438 | Bacteria | 638 |
| 498 | Ga0439445_0081811 | 3300042004 | Bacteria | 903 |
| 499 | Ga0453684_0231718 | 3300044712 | Bacteria | 2132 |
| 500 | Ga0466957_0491157 | 3300044842 | Bacteria | 850 |
| 501 | Ga0466967_0320344 | 3300045976 | Bacteria | 1495 |
| 502 | Ga0466967_0424203 | 3300045976 | Bacteria | 1297 |
| 503 | Ga0495592_0022811 | 3300046454 | Bacteria | 4761 |
| 504 | Ga0495629_0177534 | 3300046459 | Bacteria | 1477 |
| 505 | Ga0495651_0121424 | 3300046462 | Bacteria | 1919 |
| 506 | Ga0495651_0229967 | 3300046462 | Unclassified | 1278 |
| 507 | Ga0495650_0035327 | 3300046471 | Bacteria | 2201 |
| 508 | Ga0495580_0002878 | 3300046472 | Bacteria | 14816 |
| 509 | Ga0495580_0155608 | 3300046472 | Bacteria | 1583 |
| 510 | Ga0495580_0218087 | 3300046472 | Unclassified | 1311 |
| 511 | Ga0495582_0008922 | 3300046473 | Bacteria | 5534 |
| 512 | Ga0495664_0162722 | 3300046477 | Bacteria | 1354 |
| 513 | Ga0495664_0311386 | 3300046477 | Bacteria | 950 |
| 514 | Ga0495594_0554171 | 3300046499 | Bacteria | 652 |
| 515 | Ga0495608_0102763 | 3300046511 | Bacteria | 1842 |
| 516 | Ga0495630_0321500 | 3300046517 | Bacteria | 1183 |
| 517 | Ga0495652_0038883 | 3300046529 | Bacteria | 4118 |
| 518 | Ga0495652_0251625 | 3300046529 | Bacteria | 1309 |
| 519 | Ga0495652_0806228 | 3300046529 | Unclassified | 625 |
| 520 | Ga0495665_0032837 | 3300046531 | Bacteria | 2777 |
| 521 | Ga0495665_0327226 | 3300046531 | Unclassified | 782 |
| 522 | Ga0495640_0745419 | 3300046533 | Bacteria | 586 |
| 523 | Ga0495586_0193849 | 3300046535 | Bacteria | 1151 |
| 524 | Ga0495587_0001029 | 3300046536 | Bacteria | 18348 |
| 525 | Ga0495645_0158553 | 3300046543 | Unclassified | 1566 |
| 526 | Ga0495667_0029952 | 3300046559 | Bacteria | 3660 |
| 527 | Ga0495635_0260280 | 3300046663 | Bacteria | 1168 |
| 528 | Ga0495599_0002515 | 3300046678 | Bacteria | 10658 |
| 529 | Ga0495599_0135491 | 3300046678 | Bacteria | 1529 |
| 530 | Ga0495658_0376517 | 3300046683 | Bacteria | 904 |
| 531 | Ga0495613_0099922 | 3300046689 | Unclassified | 2096 |
| 532 | Ga0495624_0194872 | 3300046690 | Bacteria | 1232 |
| 533 | Ga0495581_0106336 | 3300047315 | Unclassified | 1631 |
| 534 | Ga0495636_0135824 | 3300047318 | Bacteria | 1096 |
| 535 | Ga0495674_0034128 | 3300047319 | Bacteria | 4603 |
| 536 | Ga0495684_0004783 | 3300047471 | Bacteria | 10572 |
| 537 | Ga0495684_0079052 | 3300047471 | Bacteria | 2497 |
| 538 | Ga0495684_0090423 | 3300047471 | Bacteria | 2319 |
| 539 | Ga0495684_0117255 | 3300047471 | Bacteria | 2007 |
| 540 | Ga0495602_0004860 | 3300048088 | Bacteria | 14073 |
| 541 | Ga0496104_0093893 | 3300048907 | Bacteria | 2870 |
| 542 | Ga0496104_0220678 | 3300048907 | Bacteria | 1808 |
| 543 | Ga0496112_0710138 | 3300048915 | Bacteria | 933 |
| 544 | Ga0501031_0024958 | 3300049568 | Bacteria | 3898 |
| 545 | Ga0501032_0002829 | 3300049569 | Bacteria | 13499 |
| 546 | Ga0501033_0173387 | 3300049570 | Unclassified | 1548 |
| 547 | Ga0501033_0240372 | 3300049570 | Bacteria | 1285 |
| 548 | Ga0501036_0016136 | 3300049572 | Bacteria | 6242 |
| 549 | Ga0501036_0064791 | 3300049572 | Unclassified | 3092 |
| 550 | Ga0501036_0101175 | 3300049572 | Bacteria | 2438 |
| 551 | Ga0501036_0110437 | 3300049572 | Bacteria | 2323 |
| 552 | Ga0501036_0652251 | 3300049572 | Bacteria | 871 |
| 553 | Ga0501037_0002336 | 3300049573 | Bacteria | 13697 |
| 554 | Ga0501037_0328485 | 3300049573 | Bacteria | 1058 |
| 555 | Ga0501038_0058202 | 3300049574 | Bacteria | 3314 |
| 556 | Ga0501039_0010138 | 3300049575 | Bacteria | 7178 |
| 557 | Ga0501039_0054920 | 3300049575 | Bacteria | 3084 |
| 558 | Ga0501040_0017997 | 3300049576 | Bacteria | 4691 |
| 559 | Ga0501040_0095332 | 3300049576 | Bacteria | 2071 |
| 560 | Ga0501040_0120689 | 3300049576 | Bacteria | 1839 |
| 561 | Ga0501040_0355681 | 3300049576 | Unclassified | 1049 |
| 562 | Ga0501041_0028576 | 3300049577 | Bacteria | 3364 |
| 563 | Ga0501042_0190730 | 3300049578 | Bacteria | 1478 |
| 564 | Ga0501042_0383643 | 3300049578 | Bacteria | 1017 |
| 565 | Ga0501042_0394771 | 3300049578 | Bacteria | 1002 |
| 566 | Ga0501043_0002869 | 3300049579 | Bacteria | 14392 |
| 567 | Ga0501043_0542922 | 3300049579 | Bacteria | 864 |
| 568 | Ga0501046_0000891 | 3300049580 | Bacteria | 29094 |
| 569 | Ga0501047_0053769 | 3300049581 | Bacteria | 3895 |
| 570 | Ga0501047_0072541 | 3300049581 | Bacteria | 3314 |
| 571 | Ga0501047_0089907 | 3300049581 | Bacteria | 2947 |
| 572 | Ga0501047_0616195 | 3300049581 | Unclassified | 906 |
| 573 | Ga0501048_0019755 | 3300049582 | Unclassified | 4941 |
| 574 | Ga0501048_0063589 | 3300049582 | Bacteria | 2610 |
| 575 | Ga0501048_0181961 | 3300049582 | Bacteria | 1490 |
| 576 | Ga0501067_0005450 | 3300049583 | Bacteria | 7062 |
| 577 | Ga0501068_0000705 | 3300049584 | Bacteria | 17137 |
| 578 | Ga0501069_0008380 | 3300049585 | Bacteria | 5429 |
| 579 | Ga0501070_0035723 | 3300049586 | Bacteria | 4150 |
| 580 | Ga0501070_0042195 | 3300049586 | Bacteria | 3800 |
| 581 | Ga0501070_0382014 | 3300049586 | Bacteria | 1141 |
| 582 | Ga0501071_0026669 | 3300049587 | Bacteria | 4058 |
| 583 | Ga0501071_0031859 | 3300049587 | Bacteria | 3741 |
| 584 | Ga0501072_0000736 | 3300049588 | Bacteria | 23875 |
| 585 | Ga0501072_0040100 | 3300049588 | Bacteria | 3677 |
| 586 | Ga0501072_0205945 | 3300049588 | Bacteria | 1568 |
| 587 | Ga0501072_0354652 | 3300049588 | Bacteria | 1164 |
| 588 | Ga0501073_0033404 | 3300049589 | Bacteria | 3663 |
| 589 | Ga0501074_0025747 | 3300049590 | Bacteria | 4268 |
| 590 | Ga0501075_0012252 | 3300049591 | Bacteria | 6088 |
| 591 | Ga0501075_0088179 | 3300049591 | Bacteria | 2352 |
| 592 | Ga0501075_0584164 | 3300049591 | Bacteria | 852 |
| 593 | Ga0501076_0010220 | 3300049592 | Bacteria | 6955 |
| 594 | Ga0501076_0019825 | 3300049592 | Bacteria | 5144 |
| 595 | Ga0501076_0032029 | 3300049592 | Bacteria | 4103 |
| 596 | Ga0501076_0044155 | 3300049592 | Bacteria | 3514 |
| 597 | Ga0501076_0063692 | 3300049592 | Bacteria | 2938 |
| 598 | Ga0501077_0009195 | 3300049593 | Bacteria | 6136 |
| 599 | Ga0501079_0015464 | 3300049741 | Bacteria | 5823 |
| 600 | Ga0501079_0041449 | 3300049741 | Bacteria | 3554 |
| 601 | Ga0501079_0042054 | 3300049741 | Bacteria | 3529 |
| 602 | Ga0501080_0000530 | 3300049742 | Bacteria | 29994 |
| 603 | Ga0501080_0086204 | 3300049742 | Bacteria | 2918 |
| 604 | Ga0501081_0078835 | 3300049743 | Bacteria | 2303 |
| 605 | Ga0501081_0427789 | 3300049743 | Bacteria | 982 |
| 606 | Ga0501083_0348670 | 3300049744 | Bacteria | 962 |
| 607 | Ga0501083_0580982 | 3300049744 | Unclassified | 729 |
| 608 | Ga0501035_0035479 | 3300049822 | Bacteria | 4525 |
| 609 | Ga0501044_0037084 | 3300049823 | Bacteria | 5097 |
| 610 | Ga0501044_0101739 | 3300049823 | Bacteria | 2890 |
| 611 | Ga0501044_0140181 | 3300049823 | Unclassified | 2407 |
| 612 | Ga0501045_0002984 | 3300049824 | Bacteria | 11576 |
| 613 | Ga0501045_0030224 | 3300049824 | Bacteria | 3920 |
| 614 | Ga0501045_0154063 | 3300049824 | Bacteria | 1710 |
| 615 | Ga0501045_0272038 | 3300049824 | Bacteria | 1261 |
| 616 | Ga0501045_0566515 | 3300049824 | Unclassified | 842 |
| 617 | nmdc:mga03n38_42649_c1 | 3300050490 | Bacteria | 1984 |
| 618 | nmdc:mga00v17_11698_c1 | 3300050491 | Bacteria | 4827 |
| 619 | nmdc:mga00v17_45696_c1 | 3300050491 | Bacteria | 2647 |
| 620 | nmdc:mga0yw44_198827_c1 | 3300050492 | Bacteria | 1323 |
| 621 | nmdc:mga0k408_138701_c1 | 3300050493 | Bacteria | 1446 |
| 622 | nmdc:mga04h51_148517_c1 | 3300050495 | Unclassified | 894 |
| 623 | nmdc:mga04h51_202134_c1 | 3300050495 | Bacteria | 781 |
| 624 | nmdc:mga07m45_15297_c1 | 3300050496 | Bacteria | 4096 |
| 625 | nmdc:mga07m45_85741_c1 | 3300050496 | Bacteria | 1801 |
| 626 | nmdc:mga05p37_117639_c1 | 3300050507 | Bacteria | 3266 |
| 627 | nmdc:mga05p37_302792_c1 | 3300050507 | Bacteria | 1898 |
| 628 | nmdc:mga05p37_326841_c1 | 3300050507 | Unclassified | 1813 |
| 629 | nmdc:mga09592_403103_c1 | 3300050508 | Unclassified | 1182 |
| 630 | nmdc:mga09592_437005_c1 | 3300050508 | Unclassified | 1129 |
| 631 | nmdc:mga09592_76103_c1 | 3300050508 | Bacteria | 2854 |
| 632 | nmdc:mga0qj67_126426_c1 | 3300050509 | Unclassified | 2069 |
| 633 | nmdc:mga06r32_118139_c1 | 3300050510 | Unclassified | 2614 |
| 634 | nmdc:mga06r32_77023_c1 | 3300050510 | Unclassified | 3239 |
| 635 | nmdc:mga08y16_29507_c1 | 3300050511 | Bacteria | 5779 |
| 636 | nmdc:mga0n895_1560156_c1 | 3300050512 | Bacteria | 625 |
| 637 | nmdc:mga0a205_1070824_c1 | 3300050515 | Bacteria | 653 |
| 638 | Ga0500641_0316892 | 3300053096 | Bacteria | 636 |
| 639 | Ga0500594_0039642 | 3300053118 | Bacteria | 1282 |
| 640 | Ga0500568_0053423 | 3300053139 | Bacteria | 1583 |
| 641 | Ga0500568_0167241 | 3300053139 | Bacteria | 810 |
| 642 | Ga0500577_0214328 | 3300053142 | Bacteria | 833 |
| 643 | Ga0500616_0000064 | 3300053153 | Bacteria | 243072 |
| 644 | Ga0500616_0007872 | 3300053153 | Bacteria | 6701 |
| 645 | Ga0501084_0000777 | 3300054114 | Bacteria | 24287 |
| 646 | Ga0501084_0195849 | 3300054114 | Bacteria | 1705 |
| 647 | Ga0501084_0211262 | 3300054114 | Bacteria | 1637 |
| 648 | Ga0501084_0320976 | 3300054114 | Bacteria | 1308 |
| 649 | Ga0501082_0018816 | 3300060353 | Bacteria | 5950 |
| 650 | Ga0501082_0085469 | 3300060353 | Bacteria | 2721 |
| 651 | Ga0501082_0108191 | 3300060353 | Bacteria | 2406 |
| 652 | Ga0501082_0143537 | 3300060353 | Bacteria | 2072 |
| 653 | Ga0501082_0167978 | 3300060353 | Bacteria | 1907 |
| 654 | Ga0501082_0555665 | 3300060353 | Bacteria | 1004 |
| 655 | Ga0530510_0100097 | 3300061734 | Bacteria | 2119 |
| 656 | Ga0530510_1101544 | 3300061734 | Unclassified | 608 |
| 657 | Ga0207699_10483322 | |||
| 658 | Ga0070658_10006989 | |||
| 659 | Ga0070658_10016641 | |||
| 660 | Ga0070658_10909089 | |||
| 661 | Ga0070683_100000311 | |||
| 662 | Ga0070683_100020847 | |||
| 663 | Ga0070683_100402661 | |||
| 664 | Ga0070670_100903434 | |||
| 665 | Ga0070677_10257320 | |||
| 666 | Ga0068869_100403166 | |||
| 667 | Ga0068869_100420981 | |||
| 668 | Ga0068869_101065409 | |||
| 669 | Ga0070666_10003261 | |||
| 670 | Ga0070680_100002798 | |||
| 671 | Ga0070680_100044956 | |||
| 672 | Ga0070680_100259270 | |||
| 673 | Ga0068868_100042751 | |||
| 674 | Ga0068868_100123146 | |||
| 675 | Ga0068868_100472620 | |||
| 676 | Ga0068868_100606147 | |||
| 677 | Ga0070660_100272182 | |||
| 678 | Ga0070689_100594305 | |||
| 679 | Ga0070689_100890457 | |||
| 680 | Ga0070668_100150643 | |||
| 681 | Ga0070675_100817145 | |||
| 682 | Ga0070673_100056170 | |||
| 683 | Ga0070673_100110900 | |||
| 684 | Ga0070673_100641999 | |||
| 685 | Ga0070688_100082121 | |||
| 686 | Ga0070667_100036409 | |||
| 687 | Ga0070667_100557917 | |||
| 688 | Ga0070714_100024195 | |||
| 689 | Ga0070713_100006862 | |||
| 690 | Ga0070713_100075625 | |||
| 691 | Ga0070701_10347955 | |||
| 692 | Ga0070711_100230391 | |||
| 693 | Ga0070711_100403437 | |||
| 694 | Ga0070711_100503855 | |||
| 695 | Ga0070705_100376293 | |||
| 696 | Ga0070705_100439978 | |||
| 697 | Ga0070700_100062556 | |||
| 698 | Ga0070708_100256013 | |||
| 699 | Ga0070663_100983289 | |||
| 700 | Ga0070678_100645484 | |||
| 701 | Ga0070681_10003037 | |||
| 702 | Ga0070681_10028271 | |||
| 703 | Ga0070681_10171650 | |||
| 704 | Ga0070681_10259537 | |||
| 705 | Ga0070681_10289138 | |||
| 706 | Ga0070681_10396963 | |||
| 707 | Ga0068867_100104591 | |||
| 708 | Ga0068867_100201996 | |||
| 709 | Ga0068867_100855518 | |||
| 710 | Ga0068867_100885719 | |||
| 711 | Ga0070685_10353531 | |||
| 712 | Ga0070706_100589040 | |||
| 713 | Ga0070706_100611751 | |||
| 714 | Ga0070698_100839553 | |||
| 715 | Ga0070699_100865263 | |||
| 716 | Ga0070679_100000635 | |||
| 717 | Ga0070679_100733184 | |||
| 718 | Ga0070684_100000083 | |||
| 719 | Ga0070684_100000654 | |||
| 720 | Ga0070684_100016124 | |||
| 721 | Ga0070684_100297767 | |||
| 722 | Ga0070684_100592227 | |||
| 723 | Ga0068853_100006617 | |||
| 724 | Ga0068853_100104391 | |||
| 725 | Ga0068853_100681178 | |||
| 726 | Ga0068853_101797926 | |||
| 727 | Ga0070672_100298771 | |||
| 728 | Ga0070672_100327314 | |||
| 729 | Ga0070672_100462048 | |||
| 730 | Ga0070696_100000050 | |||
| 731 | Ga0070696_100670936 | |||
| 732 | Ga0070693_100334539 | |||
| 733 | Ga0070665_100019235 | |||
| 734 | Ga0070665_100693964 | |||
| 735 | Ga0070665_100771234 | |||
| 736 | Ga0070665_100867957 | |||
| 737 | Ga0070704_100025689 | |||
| 738 | Ga0068855_100004338 | |||
| 739 | Ga0068855_100004719 | |||
| 740 | Ga0068855_100004892 | |||
| 741 | Ga0068855_100015324 | |||
| 742 | Ga0068855_100042704 | |||
| 743 | Ga0068855_100211405 | |||
| 744 | Ga0068855_100731166 | |||
| 745 | Ga0070664_100311508 | |||
| 746 | Ga0068857_100000367 | |||
| 747 | Ga0068857_100068345 | |||
| 748 | Ga0068857_100138038 | |||
| 749 | Ga0068857_100166942 | |||
| 750 | Ga0068857_100396918 | |||
| 751 | Ga0068854_100770960 | |||
| 752 | Ga0068856_100008120 | |||
| 753 | Ga0068856_100151499 | |||
| 754 | Ga0068856_100281711 | |||
| 755 | Ga0068856_100390235 | |||
| 756 | Ga0068856_100401359 | |||
| 757 | Ga0068856_100564756 | |||
| 758 | Ga0068856_101075052 | |||
| 759 | Ga0068852_100006117 | |||
| 760 | Ga0068852_100027317 | |||
| 761 | Ga0068852_100054251 | |||
| 762 | Ga0068852_100149453 | |||
| 763 | Ga0068859_100111539 | |||
| 764 | Ga0068864_100059398 | |||
| 765 | Ga0068864_100416306 | |||
| 766 | Ga0068864_100971742 | |||
| 767 | Ga0068866_10232888 | |||
| 768 | Ga0068851_10100425 | |||
| 769 | Ga0068851_10297001 | |||
| 770 | Ga0068870_10508150 | |||
| 771 | Ga0068863_100018498 | |||
| 772 | Ga0068863_100085404 | |||
| 773 | Ga0068858_100008758 | |||
| 774 | Ga0068858_100044408 | |||
| 775 | Ga0068858_100126717 | |||
| 776 | Ga0068858_100432435 | |||
| 777 | Ga0068858_101129314 | |||
| 778 | Ga0068860_100010166 | |||
| 779 | Ga0068860_100475803 | |||
| 780 | Ga0068860_100805118 | |||
| 781 | Ga0068862_100126840 | |||
| 782 | Ga0068862_100147334 | |||
| 783 | Ga0068862_101181698 | |||
| 784 | Ga0070717_10012251 | |||
| 785 | Ga0070717_10667011 | |||
| 786 | Ga0070717_10847212 | |||
| 787 | Ga0070717_11106249 | |||
| 788 | Ga0075365_10140235 | |||
| 789 | Ga0075368_10041349 | |||
| 790 | Ga0075363_100044016 | |||
| 791 | Ga0070712_100661921 | |||
| 792 | Ga0070712_100903984 | |||
| 793 | Ga0075367_10022665 | |||
| 794 | Ga0075366_10022552 | |||
| 795 | Ga0097621_100013303 | |||
| 796 | Ga0097621_100057243 | |||
| 797 | Ga0097621_100100157 | |||
| 798 | Ga0097621_100151277 | |||
| 799 | Ga0075370_10273694 | |||
| 800 | Ga0068871_100025726 | |||
| 801 | Ga0068871_100071576 | |||
| 802 | Ga0075428_100154107 | |||
| 803 | Ga0075428_100173427 | |||
| 804 | Ga0075428_100405707 | |||
| 805 | Ga0075428_100408245 | |||
| 806 | Ga0075428_101054087 | |||
| 807 | Ga0075430_100003279 | |||
| 808 | Ga0075431_100055263 | |||
| 809 | Ga0075429_100098917 | |||
| 810 | Ga0075429_100159560 | |||
| 811 | Ga0068865_100060529 | |||
| 812 | Ga0068865_100569326 | |||
| 813 | Ga0068865_100618766 | |||
| 814 | Ga0068865_101164012 | |||
| 815 | Ga0097620_100088218 | |||
| 816 | Ga0097620_100111540 | |||
| 817 | Ga0105240_10000425 | |||
| 818 | Ga0105240_10004013 | |||
| 819 | Ga0105240_10004427 | |||
| 820 | Ga0105240_10004590 | |||
| 821 | Ga0105240_10051759 | |||
| 822 | Ga0105240_10197424 | |||
| 823 | Ga0105240_10321264 | |||
| 824 | Ga0105240_10518989 | |||
| 825 | Ga0105240_11097154 | |||
| 826 | Ga0105240_11355755 | |||
| 827 | Ga0111539_10030828 | |||
| 828 | Ga0105245_10009493 | |||
| 829 | Ga0105245_10037377 | |||
| 830 | Ga0105245_10037757 | |||
| 831 | Ga0105245_10058855 | |||
| 832 | Ga0105245_10067091 | |||
| 833 | Ga0105245_10653562 | |||
| 834 | Ga0105245_11167889 | |||
| 835 | Ga0105245_11501279 | |||
| 836 | Ga0114129_10004072 | |||
| 837 | Ga0114129_10103657 | |||
| 838 | Ga0114129_11028867 | |||
| 839 | Ga0105243_10082795 | |||
| 840 | Ga0105243_10115942 | |||
| 841 | Ga0105243_10566441 | |||
| 842 | Ga0105241_10100728 | |||
| 843 | Ga0105241_10222366 | |||
| 844 | Ga0105241_10335867 | |||
| 845 | Ga0105241_10397582 | |||
| 846 | Ga0105241_10576353 | |||
| 847 | Ga0105242_10039448 | |||
| 848 | Ga0105242_10046600 | |||
| 849 | Ga0105242_10133520 | |||
| 850 | Ga0105242_10305572 | |||
| 851 | Ga0105248_10106725 | |||
| 852 | Ga0105248_10303561 | |||
| 853 | Ga0105248_10315432 | |||
| 854 | Ga0105248_10379429 | |||
| 855 | Ga0105237_10002573 | |||
| 856 | Ga0105237_10004735 | |||
| 857 | Ga0105237_10006074 | |||
| 858 | Ga0105237_10008630 | |||
| 859 | Ga0105237_10036751 | |||
| 860 | Ga0105237_10050310 | |||
| 861 | Ga0105237_10173606 | |||
| 862 | Ga0105237_10280551 | |||
| 863 | Ga0105238_10004596 | |||
| 864 | Ga0105238_10016508 | |||
| 865 | Ga0105238_10051413 | |||
| 866 | Ga0105238_10060232 | |||
| 867 | Ga0105238_10139192 | |||
| 868 | Ga0105238_10228567 | |||
| 869 | Ga0105249_10086522 | |||
| 870 | Ga0105239_10006098 | |||
| 871 | Ga0105239_10021394 | |||
| 872 | Ga0105239_10124479 | |||
| 873 | Ga0105239_11264077 | |||
| 874 | Ga0105239_11439695 | |||
| 875 | Ga0105239_11636383 | |||
| 876 | Ga0105246_10167189 | |||
| 877 | Ga0105246_10666327 | |||
| 878 | Ga0157370_10004065 | |||
| 879 | Ga0157370_10004342 | |||
| 880 | Ga0157370_10007561 | |||
| 881 | Ga0157370_10033773 | |||
| 882 | Ga0157369_10010818 | |||
| 883 | Ga0157369_10031617 | |||
| 884 | Ga0157369_10034595 | |||
| 885 | Ga0157369_10461466 | |||
| 886 | Ga0157369_10546428 | |||
| 887 | Ga0157374_10092956 | |||
| 888 | Ga0157374_10237206 | |||
| 889 | Ga0157374_10544079 | |||
| 890 | Ga0157378_10022676 | |||
| 891 | Ga0157378_10157708 | |||
| 892 | Ga0157378_11365319 | |||
| 893 | Ga0163162_10210252 | |||
| 894 | Ga0163162_10279259 | |||
| 895 | Ga0157372_10022557 | |||
| 896 | Ga0157372_10023943 | |||
| 897 | Ga0157372_10050240 | |||
| 898 | Ga0157372_10252403 | |||
| 899 | Ga0157372_10304976 | |||
| 900 | Ga0157372_10520000 | |||
| 901 | Ga0157375_10006626 | |||
| 902 | Ga0157375_10079224 | |||
| 903 | Ga0157375_10105798 | |||
| 904 | Ga0157375_10319899 | |||
| 905 | Ga0157375_11117991 | |||
| 906 | Ga0157375_11701848 | |||
| 907 | Ga0163163_10041459 | |||
| 908 | Ga0163163_10048599 | |||
| 909 | Ga0163163_10251178 | |||
| 910 | Ga0163163_10518031 | |||
| 911 | Ga0163163_10735745 | |||
| 912 | Ga0157380_10016887 | |||
| 913 | Ga0157379_10030883 | |||
| 914 | Ga0157379_10109114 | |||
| 915 | Ga0157379_10982526 | |||
| 916 | Ga0157376_10090339 | |||
| 917 | Ga0157376_10251876 | |||
| 918 | Ga0157376_10273177 | |||
| 919 | Ga0157376_11305961 | |||
| 920 | Ga0213875_10002156 | |||
| 921 | Ga0207642_10345694 | |||
| 922 | Ga0207680_10117683 | |||
| 923 | Ga0207685_10151966 | |||
| 924 | Ga0207699_10118690 | |||
| 925 | Ga0207699_10173507 | |||
| 926 | Ga0207645_10466563 | |||
| 927 | Ga0207643_10217219 | |||
| 928 | Ga0207705_10023248 | |||
| 929 | Ga0207705_10031840 | |||
| 930 | Ga0207705_10736850 | |||
| 931 | Ga0207684_10261915 | |||
| 932 | Ga0207684_10566938 | |||
| 933 | Ga0207654_10497306 | |||
| 934 | Ga0207707_10002533 | |||
| 935 | Ga0207707_10119519 | |||
| 936 | Ga0207707_10342588 | |||
| 937 | Ga0207707_10884683 | |||
| 938 | Ga0207695_10000770 | |||
| 939 | Ga0207695_10001974 | |||
| 940 | Ga0207695_10002883 | |||
| 941 | Ga0207695_10015601 | |||
| 942 | Ga0207695_10026708 | |||
| 943 | Ga0207695_10095725 | |||
| 944 | Ga0207695_10137834 | |||
| 945 | Ga0207695_10175197 | |||
| 946 | Ga0207695_10258355 | |||
| 947 | Ga0207695_10780919 | |||
| 948 | Ga0207671_10037524 | |||
| 949 | Ga0207663_10462636 | |||
| 950 | Ga0207660_10052665 | |||
| 951 | Ga0207660_10106744 | |||
| 952 | Ga0207660_10166878 | |||
| 953 | Ga0207657_10002248 | |||
| 954 | Ga0207657_10107771 | |||
| 955 | Ga0207649_10162490 | |||
| 956 | Ga0207649_10682028 | |||
| 957 | Ga0207652_10244931 | |||
| 958 | Ga0207652_10983910 | |||
| 959 | Ga0207694_10002949 | |||
| 960 | Ga0207694_10004275 | |||
| 961 | Ga0207694_10009667 | |||
| 962 | Ga0207694_10033095 | |||
| 963 | Ga0207694_10086845 | |||
| 964 | Ga0207694_10244086 | |||
| 965 | Ga0207694_10291360 | |||
| 966 | Ga0207694_10311951 | |||
| 967 | Ga0207694_10563250 | |||
| 968 | Ga0207650_11170009 | |||
| 969 | Ga0207659_10685823 | |||
| 970 | Ga0207687_10000988 | |||
| 971 | Ga0207687_10012601 | |||
| 972 | Ga0207687_10055562 | |||
| 973 | Ga0207687_10899272 | |||
| 974 | Ga0207700_10007610 | |||
| 975 | Ga0207700_10050923 | |||
| 976 | Ga0207700_10170346 | |||
| 977 | Ga0207700_10209818 | |||
| 978 | Ga0207700_11261143 | |||
| 979 | Ga0207664_10034142 | |||
| 980 | Ga0207664_10070200 | |||
| 981 | Ga0207644_10104682 | |||
| 982 | Ga0207686_10009081 | |||
| 983 | Ga0207686_10020487 | |||
| 984 | Ga0207686_10027511 | |||
| 985 | Ga0207686_10157557 | |||
| 986 | Ga0207686_10180548 | |||
| 987 | Ga0207709_10307369 | |||
| 988 | Ga0207709_10402679 | |||
| 989 | Ga0207669_10223355 | |||
| 990 | Ga0207691_10302776 | |||
| 991 | Ga0207691_10331795 | |||
| 992 | Ga0207711_10001479 | |||
| 993 | Ga0207711_10109759 | |||
| 994 | Ga0207711_10254993 | |||
| 995 | Ga0207711_10284480 | |||
| 996 | Ga0207711_10339552 | |||
| 997 | Ga0207689_10116463 | |||
| 998 | Ga0207661_10000054 | |||
| 999 | Ga0207661_10019015 | |||
| 1000 | Ga0207661_10037048 | |||
| 1001 | Ga0207661_10154424 | |||
| 1002 | Ga0207661_10188958 | |||
| 1003 | Ga0207661_10285765 | |||
| 1004 | Ga0207661_10585305 | |||
| 1005 | Ga0207679_10315248 | |||
| 1006 | Ga0207679_10379551 | |||
| 1007 | Ga0207667_10001168 | |||
| 1008 | Ga0207667_10012046 | |||
| 1009 | Ga0207667_10020486 | |||
| 1010 | Ga0207667_10078273 | |||
| 1011 | Ga0207667_10190963 | |||
| 1012 | Ga0207667_10200393 | |||
| 1013 | Ga0207667_10234519 | |||
| 1014 | Ga0207651_10042970 | |||
| 1015 | Ga0207651_10101214 | |||
| 1016 | Ga0207651_10500447 | |||
| 1017 | Ga0207712_10033380 | |||
| 1018 | Ga0207668_10105064 | |||
| 1019 | Ga0207658_10294968 | |||
| 1020 | Ga0207677_10261187 | |||
| 1021 | Ga0207677_10331944 | |||
| 1022 | Ga0207703_10006724 | |||
| 1023 | Ga0207703_10064333 | |||
| 1024 | Ga0207703_10257876 | |||
| 1025 | Ga0207703_10271368 | |||
| 1026 | Ga0207703_10315071 | |||
| 1027 | Ga0207703_10362349 | |||
| 1028 | Ga0207703_10740012 | |||
| 1029 | Ga0207639_10012287 | |||
| 1030 | Ga0207678_10926558 | |||
| 1031 | Ga0207708_10020557 | |||
| 1032 | Ga0207702_10015956 | |||
| 1033 | Ga0207702_10076470 | |||
| 1034 | Ga0207702_10153417 | |||
| 1035 | Ga0207702_10736031 | |||
| 1036 | Ga0207641_10051467 | |||
| 1037 | Ga0207641_10267831 | |||
| 1038 | Ga0207641_10553458 | |||
| 1039 | Ga0207648_10066223 | |||
| 1040 | Ga0207648_10126304 | |||
| 1041 | Ga0207648_10556417 | |||
| 1042 | Ga0207676_10205146 | |||
| 1043 | Ga0207676_10333942 | |||
| 1044 | Ga0207676_10844175 | |||
| 1045 | Ga0207676_10879604 | |||
| 1046 | Ga0207674_10000166 | |||
| 1047 | Ga0207674_10003073 | |||
| 1048 | Ga0207674_10003444 | |||
| 1049 | Ga0207674_10012353 | |||
| 1050 | Ga0207674_10047924 | |||
| 1051 | Ga0207674_11070232 | |||
| 1052 | Ga0207675_100071065 | |||
| 1053 | Ga0207675_100166876 | |||
| 1054 | Ga0207675_100518920 | |||
| 1055 | Ga0207675_100975639 | |||
| 1056 | Ga0207683_10026033 | |||
| 1057 | Ga0207698_10161858 | |||
| 1058 | Ga0207698_10253223 | |||
| 1059 | Ga0207698_10293548 | |||
| 1060 | Ga0207698_11180959 | |||
| 1061 | Ga0209813_10095185 | |||
| 1062 | Ga0209813_10105144 | |||
| 1063 | Ga0207428_10004926 | |||
| 1064 | Ga0268266_10375212 | |||
| 1065 | Ga0268266_10654255 | |||
| 1066 | Ga0268266_10762458 | |||
| 1067 | Ga0268265_10131581 | |||
| 1068 | Ga0268265_10410637 | |||
| 1069 | Ga0268264_10006848 | |||
| 1070 | Ga0268264_10364502 | |||
| 1071 | Ga0268264_10940952 | |||
| 1072 | Ga0268264_11011223 | |||
| 1073 | Ga0265336_10033052 | |||
| 1074 | Ga0265338_10114625 | |||
| 1075 | Ga0265338_10328095 | |||
| 1076 | Ga0265338_10417462 | |||
| 1077 | Ga0265324_10045389 | |||
| 1078 | Ga0265332_10174804 | |||
| 1079 | Ga0265320_10080044 | |||
| 1080 | Ga0265325_10094325 | |||
| 1081 | Ga0265339_10012490 | |||
| 1082 | Ga0265331_10138557 | |||
| 1083 | Ga0265331_10325346 | |||
| 1084 | Ga0265316_10104256 | |||
| 1085 | Ga0265316_10575382 | |||
| 1086 | Ga0307408_100677181 | |||
| 1087 | Ga0316579_10025905 | |||
| 1088 | Ga0265314_10007557 | |||
| 1089 | Ga0265314_10046025 | |||
| 1090 | Ga0265314_10127645 | |||
| 1091 | Ga0265342_10139536 | |||
| 1092 | Ga0316577_10013187 | |||
| 1093 | Ga0373934_0059793 | |||
| 1094 | Ga0373923_0011897 | |||
| 1095 | Ga0373923_0021138 | |||
| 1096 | Ga0373932_0300162 | |||
| 1097 | Ga0373945_0127005 | |||
| 1098 | Ga0373953_0011892 | |||
| 1099 | Ga0373953_0128148 | |||
| 1100 | Ga0373954_0010358 | |||
| 1101 | Ga0373954_0075680 | |||
| 1102 | Ga0373954_0092489 | |||
| 1103 | Ga0373956_0045432 | |||
| 1104 | Ga0373956_0108234 | |||
| 1105 | Ga0373957_0124923 | |||
| 1106 | Ga0373957_0148175 | |||
| 1107 | Ga0373943_0006889 | |||
| 1108 | Ga0373943_0315571 | |||
| 1109 | Ga0373946_0043217 | |||
| 1110 | Ga0373955_0004130 | |||
| 1111 | Ga0373955_0020349 | |||
| 1112 | Ga0373955_0050553 | |||
| 1113 | Ga0373955_0118827 | |||
| 1114 | Ga0373942_0218400 | |||
| 1115 | Ga0316574_0164373 | |||
| 1116 | Ga0316574_0355006 | |||
| 1117 | Ga0373935_0017968 | |||
| 1118 | Ga0373935_0074109 | |||
| 1119 | Ga0373935_0431415 | |||
| 1120 | Ga0373935_0632110 | |||
| 1121 | Ga0373927_0000450 | |||
| 1122 | Ga0373927_0003519 | |||
| 1123 | Ga0373927_0004539 | |||
| 1124 | Ga0373927_0020232 | |||
| 1125 | Ga0373933_0042127 | |||
| 1126 | Ga0373933_0116332 | |||
| 1127 | Ga0373933_0228111 | |||
| 1128 | Ga0373933_0371849 | |||
| 1129 | Ga0373933_0386703 | |||
| 1130 | Ga0373933_0452234 | |||
| 1131 | Ga0373947_0000644 | |||
| 1132 | Ga0373947_0005809 | |||
| 1133 | Ga0373937_0005609 | |||
| 1134 | Ga0373937_0009413 | |||
| 1135 | Ga0373937_0216311 | |||
| 1136 | Ga0373937_0234044 | |||
| 1137 | Ga0316582_0010835 | |||
| 1138 | Ga0316584_0047845 | |||
| 1139 | Ga0316584_0128985 | |||
| 1140 | Ga0373925_0002306 | |||
| 1141 | Ga0373925_0020341 | |||
| 1142 | Ga0373925_0195584 | |||
| 1143 | Ga0395899_0255044 | |||
| 1144 | Ga0395900_1152031 | |||
| 1145 | Ga0395898_0138332 | |||
| 1146 | Ga0436364_0540469 | |||
| 1147 | Ga0436364_0812157 | |||
| 1148 | Ga0436364_0824849 | |||
| 1149 | Ga0436364_1028841 | |||
| 1150 | Ga0395901_1360216 | |||
| 1151 | Ga0436365_1106491 | |||
| 1152 | Ga0436365_1136015 | |||
| 1153 | Ga0436360_1162206 | |||
| 1154 | Ga0439445_0081811 | |||
| 1155 | Ga0453684_0231718 | |||
| 1156 | Ga0466957_0491157 | |||
| 1157 | Ga0466967_0320344 | |||
| 1158 | Ga0466967_0424203 | |||
| 1159 | Ga0495592_0022811 | |||
| 1160 | Ga0495629_0177534 | |||
| 1161 | Ga0495651_0121424 | |||
| 1162 | Ga0495651_0229967 | |||
| 1163 | Ga0495650_0035327 | |||
| 1164 | Ga0495580_0002878 | |||
| 1165 | Ga0495580_0155608 | |||
| 1166 | Ga0495580_0218087 | |||
| 1167 | Ga0495582_0008922 | |||
| 1168 | Ga0495664_0162722 | |||
| 1169 | Ga0495664_0311386 | |||
| 1170 | Ga0495594_0554171 | |||
| 1171 | Ga0495608_0102763 | |||
| 1172 | Ga0495630_0321500 | |||
| 1173 | Ga0495652_0038883 | |||
| 1174 | Ga0495652_0251625 | |||
| 1175 | Ga0495652_0806228 | |||
| 1176 | Ga0495665_0032837 | |||
| 1177 | Ga0495665_0327226 | |||
| 1178 | Ga0495640_0745419 | |||
| 1179 | Ga0495586_0193849 | |||
| 1180 | Ga0495587_0001029 | |||
| 1181 | Ga0495645_0158553 | |||
| 1182 | Ga0495667_0029952 | |||
| 1183 | Ga0495635_0260280 | |||
| 1184 | Ga0495599_0002515 | |||
| 1185 | Ga0495599_0135491 | |||
| 1186 | Ga0495658_0376517 | |||
| 1187 | Ga0495613_0099922 | |||
| 1188 | Ga0495624_0194872 | |||
| 1189 | Ga0495581_0106336 | |||
| 1190 | Ga0495636_0135824 | |||
| 1191 | Ga0495674_0034128 | |||
| 1192 | Ga0495684_0004783 | |||
| 1193 | Ga0495684_0079052 | |||
| 1194 | Ga0495684_0090423 | |||
| 1195 | Ga0495684_0117255 | |||
| 1196 | Ga0495602_0004860 | |||
| 1197 | Ga0496104_0093893 | |||
| 1198 | Ga0496104_0220678 | |||
| 1199 | Ga0496112_0710138 | |||
| 1200 | Ga0501031_0024958 | |||
| 1201 | Ga0501032_0002829 | |||
| 1202 | Ga0501033_0173387 | |||
| 1203 | Ga0501033_0240372 | |||
| 1204 | Ga0501036_0016136 | |||
| 1205 | Ga0501036_0064791 | |||
| 1206 | Ga0501036_0101175 | |||
| 1207 | Ga0501036_0110437 | |||
| 1208 | Ga0501036_0652251 | |||
| 1209 | Ga0501037_0002336 | |||
| 1210 | Ga0501037_0328485 | |||
| 1211 | Ga0501038_0058202 | |||
| 1212 | Ga0501039_0010138 | |||
| 1213 | Ga0501039_0054920 | |||
| 1214 | Ga0501040_0017997 | |||
| 1215 | Ga0501040_0095332 | |||
| 1216 | Ga0501040_0120689 | |||
| 1217 | Ga0501040_0355681 | |||
| 1218 | Ga0501041_0028576 | |||
| 1219 | Ga0501042_0190730 | |||
| 1220 | Ga0501042_0383643 | |||
| 1221 | Ga0501042_0394771 | |||
| 1222 | Ga0501043_0002869 | |||
| 1223 | Ga0501043_0542922 | |||
| 1224 | Ga0501046_0000891 | |||
| 1225 | Ga0501047_0053769 | |||
| 1226 | Ga0501047_0072541 | |||
| 1227 | Ga0501047_0089907 | |||
| 1228 | Ga0501047_0616195 | |||
| 1229 | Ga0501048_0019755 | |||
| 1230 | Ga0501048_0063589 | |||
| 1231 | Ga0501048_0181961 | |||
| 1232 | Ga0501067_0005450 | |||
| 1233 | Ga0501068_0000705 | |||
| 1234 | Ga0501069_0008380 | |||
| 1235 | Ga0501070_0035723 | |||
| 1236 | Ga0501070_0042195 | |||
| 1237 | Ga0501070_0382014 | |||
| 1238 | Ga0501071_0026669 | |||
| 1239 | Ga0501071_0031859 | |||
| 1240 | Ga0501072_0000736 | |||
| 1241 | Ga0501072_0040100 | |||
| 1242 | Ga0501072_0205945 | |||
| 1243 | Ga0501072_0354652 | |||
| 1244 | Ga0501073_0033404 | |||
| 1245 | Ga0501074_0025747 | |||
| 1246 | Ga0501075_0012252 | |||
| 1247 | Ga0501075_0088179 | |||
| 1248 | Ga0501075_0584164 | |||
| 1249 | Ga0501076_0010220 | |||
| 1250 | Ga0501076_0019825 | |||
| 1251 | Ga0501076_0032029 | |||
| 1252 | Ga0501076_0044155 | |||
| 1253 | Ga0501076_0063692 | |||
| 1254 | Ga0501077_0009195 | |||
| 1255 | Ga0501079_0015464 | |||
| 1256 | Ga0501079_0041449 | |||
| 1257 | Ga0501079_0042054 | |||
| 1258 | Ga0501080_0000530 | |||
| 1259 | Ga0501080_0086204 | |||
| 1260 | Ga0501081_0078835 | |||
| 1261 | Ga0501081_0427789 | |||
| 1262 | Ga0501083_0348670 | |||
| 1263 | Ga0501083_0580982 | |||
| 1264 | Ga0501035_0035479 | |||
| 1265 | Ga0501044_0037084 | |||
| 1266 | Ga0501044_0101739 | |||
| 1267 | Ga0501044_0140181 | |||
| 1268 | Ga0501045_0002984 | |||
| 1269 | Ga0501045_0030224 | |||
| 1270 | Ga0501045_0154063 | |||
| 1271 | Ga0501045_0272038 | |||
| 1272 | Ga0501045_0566515 | |||
| 1273 | nmdc:mga03n38_42649_c1 | |||
| 1274 | nmdc:mga00v17_11698_c1 | |||
| 1275 | nmdc:mga00v17_45696_c1 | |||
| 1276 | nmdc:mga0yw44_198827_c1 | |||
| 1277 | nmdc:mga0k408_138701_c1 | |||
| 1278 | nmdc:mga04h51_148517_c1 | |||
| 1279 | nmdc:mga04h51_202134_c1 | |||
| 1280 | nmdc:mga07m45_15297_c1 | |||
| 1281 | nmdc:mga07m45_85741_c1 | |||
| 1282 | nmdc:mga05p37_117639_c1 | |||
| 1283 | nmdc:mga05p37_302792_c1 | |||
| 1284 | nmdc:mga05p37_326841_c1 | |||
| 1285 | nmdc:mga09592_403103_c1 | |||
| 1286 | nmdc:mga09592_437005_c1 | |||
| 1287 | nmdc:mga09592_76103_c1 | |||
| 1288 | nmdc:mga0qj67_126426_c1 | |||
| 1289 | nmdc:mga06r32_118139_c1 | |||
| 1290 | nmdc:mga06r32_77023_c1 | |||
| 1291 | nmdc:mga08y16_29507_c1 | |||
| 1292 | nmdc:mga0n895_1560156_c1 | |||
| 1293 | nmdc:mga0a205_1070824_c1 | |||
| 1294 | Ga0500641_0316892 | |||
| 1295 | Ga0500594_0039642 | |||
| 1296 | Ga0500568_0053423 | |||
| 1297 | Ga0500568_0167241 | |||
| 1298 | Ga0500577_0214328 | |||
| 1299 | Ga0500616_0000064 | |||
| 1300 | Ga0500616_0007872 | |||
| 1301 | Ga0501084_0000777 | |||
| 1302 | Ga0501084_0195849 | |||
| 1303 | Ga0501084_0211262 | |||
| 1304 | Ga0501084_0320976 | |||
| 1305 | Ga0501082_0018816 | |||
| 1306 | Ga0501082_0085469 | |||
| 1307 | Ga0501082_0108191 | |||
| 1308 | Ga0501082_0143537 | |||
| 1309 | Ga0501082_0167978 | |||
| 1310 | Ga0501082_0555665 | |||
| 1311 | Ga0530510_0100097 | |||
| 1312 | Ga0530510_1101544 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ij5-assembly1.cif.gz_A | 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis | 0.9553 | 41 | 210 |
| 3nrj-assembly3.cif.gz_I | crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium | 0.9544 | 44 | 216 |
| 4umf-assembly1.cif.gz_C | crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule | 0.9514 | 44 | 217 |
| 3hyc-assembly3.cif.gz_E | crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form | 0.9505 | 40 | 211 |
| 4nav-assembly1.cif.gz_D | crystal structure of hypothetical protein xcc2798 from xanthomonas campestris, target efi-508608 | 0.9426 | 38 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ij5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9522 | 41 | 211 | 3.40.50.1000 |
| 4um7A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9488 | 44 | 217 | 3.40.50.1000 |
| 4navA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9461 | 39 | 217 | 3.40.50.1000 |
| 2p9jF00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9307 | 46 | 206 | 3.40.50.1000 |
| 4um7A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9226 | 44 | 217 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3GH99-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase | 0.9918 | 41 | 219 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
| AF-A0A3D1N6Z1-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase | 0.9894 | 41 | 217 |
GO:0008781
GO:0009103 GO:0016788 |
| AF-A0A7V8DCC6-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) | 0.988 | 44 | 217 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
| AF-A0A317IC72-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) | 0.9877 | 41 | 220 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
| AF-A0A1F9ZK86-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase | 0.9872 | 42 | 217 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |