F473010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 488 | 474 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10014358|Ga0105240_100143588 |
| Length | 292 |
| Sequence | VITIIDDDMSTLDIDTVQAFLLVAELQSFTRTAEALGTTQASVSLKLQRLEAVVGRRLVERSPRSVGLTADGAAFLHHARALMEAHDRALSGETPAQQILSLGISDHAGGPELVPLLERLHAMSSQLALNVTIGLSREIVDAYDGGELDAIVVRQEGSRRGGEKLTVDQFGWFAAKRFVWRRGEPLRLATLAPPCGVRAIAVRALDKAGIAWNETFVGGGVTAVAAAALAGLAVAPLARRIAPAGLIDIGASSRLPDLGSSKVMLHSRVSDPAKLAALRTLAATFRSVAAVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 12 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 13 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 14 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 15 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 18 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 19 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 20 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 21 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 22 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 23 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 24 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 25 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 26 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 27 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 28 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 29 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 30 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 31 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 32 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 33 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 34 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 35 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 36 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 37 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 38 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 39 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 40 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 41 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 42 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 43 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 44 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 45 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 46 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 47 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 48 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 49 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 50 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 51 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 52 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 53 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 54 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 55 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 56 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 57 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 58 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 59 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 60 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 61 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 62 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 63 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 64 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 65 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 66 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 67 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 68 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 69 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 70 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 71 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 72 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 73 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 74 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 75 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 76 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 77 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 78 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 79 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 80 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 81 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 82 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 83 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 84 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 85 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 86 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 87 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 88 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 89 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 90 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 91 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 92 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 93 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 94 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 95 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 96 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 97 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 98 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 99 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 100 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 101 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 102 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 103 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 104 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 105 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 106 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 107 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 108 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 109 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 110 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 111 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 112 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 113 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 114 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 115 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 116 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 117 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 118 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 119 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 120 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 121 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 122 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 123 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 124 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 125 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 126 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 127 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 128 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 129 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 130 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 131 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 132 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 133 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 134 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 135 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 136 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 137 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 138 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 139 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 140 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 141 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 142 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 143 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 144 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 145 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 146 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 147 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 148 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 149 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 150 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 151 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 152 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 153 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 154 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 155 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 156 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 157 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 158 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 159 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 160 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 161 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 162 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 164 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 166 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 167 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 168 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 169 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 182 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 183 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 184 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 187 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 188 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 189 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 191 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 192 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 193 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 194 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 195 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 196 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 197 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 198 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 199 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 200 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 201 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 202 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 203 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 204 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 205 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 206 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 207 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 208 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 209 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 210 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 211 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 230 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 231 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 232 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 233 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 234 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 239 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 241 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 277 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 281 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 282 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 283 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 284 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 285 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 286 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 287 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 289 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 290 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 291 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 292 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 293 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 294 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 295 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 301 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 302 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 303 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 304 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 305 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 307 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 308 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 309 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 312 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 313 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 314 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 315 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 316 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 320 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 321 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 385 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 386 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 387 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 388 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 389 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 390 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 391 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 392 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 393 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 394 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 395 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 421 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 424 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 425 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 428 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 432 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 433 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 434 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 436 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 437 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 438 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 439 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 440 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 441 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 442 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 443 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 444 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 445 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 446 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 447 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 448 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 449 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 450 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 451 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 452 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 453 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 454 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 456 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 457 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 458 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 459 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 461 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 463 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 464 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 465 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 466 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 467 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 468 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 469 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 470 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 471 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 472 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 473 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 474 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 475 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 476 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 477 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 478 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 479 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 480 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 481 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 482 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 483 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 484 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 485 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 486 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 487 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 488 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.26 |
| Metatranscriptomes | 0 |
| Isolates | 27.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.8 |
| Nodule | 22.71 |
| Rhizoplane | 6.55 |
| Rhizosphere | 46.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000736 | 3300003215 | Bacteria | 20062 |
| 2 | JGI25153J46596_10003376 | 3300003215 | Bacteria | 8959 |
| 3 | JGI25153J46596_10006961 | 3300003215 | Bacteria | 5633 |
| 4 | JGI25153J46596_10008512 | 3300003215 | Bacteria | 4894 |
| 5 | JGI25160J50197_1000905 | 3300003354 | Bacteria | 15612 |
| 6 | JGI25404J52841_10002894 | 3300003659 | Bacteria | 3323 |
| 7 | JGI25404J52841_10003223 | 3300003659 | Bacteria | 3200 |
| 8 | Ga0055531_10004515 | 3300003794 | Bacteria | 8451 |
| 9 | Ga0058692_1001780 | 3300003856 | Bacteria | 7627 |
| 10 | Ga0065165_1001028 | 3300005262 | Bacteria | 33815 |
| 11 | Ga0065165_1007319 | 3300005262 | Bacteria | 5468 |
| 12 | Ga0070658_10034773 | 3300005327 | Bacteria | 4055 |
| 13 | Ga0070690_100088734 | 3300005330 | Bacteria | 2033 |
| 14 | Ga0070670_100470625 | 3300005331 | Bacteria | 1115 |
| 15 | Ga0068869_100208365 | 3300005334 | Bacteria | 1544 |
| 16 | Ga0068869_100330321 | 3300005334 | Bacteria | 1239 |
| 17 | Ga0070680_100021933 | 3300005336 | Bacteria | 5079 |
| 18 | Ga0070682_100028792 | 3300005337 | Bacteria | 3343 |
| 19 | Ga0068868_100238346 | 3300005338 | Bacteria | 1527 |
| 20 | Ga0070660_100278355 | 3300005339 | Bacteria | 1369 |
| 21 | Ga0070661_100082424 | 3300005344 | Bacteria | 2375 |
| 22 | Ga0070668_100043973 | 3300005347 | Bacteria | 3425 |
| 23 | Ga0070668_100316959 | 3300005347 | Bacteria | 1312 |
| 24 | Ga0070669_100073111 | 3300005353 | Bacteria | 2540 |
| 25 | Ga0070671_100162390 | 3300005355 | Bacteria | 1888 |
| 26 | Ga0070671_100576015 | 3300005355 | Bacteria | 972 |
| 27 | Ga0070674_100078654 | 3300005356 | Bacteria | 2350 |
| 28 | Ga0070667_100083036 | 3300005367 | Bacteria | 2744 |
| 29 | Ga0070667_100319097 | 3300005367 | Bacteria | 1402 |
| 30 | Ga0070710_10207543 | 3300005437 | Bacteria | 1240 |
| 31 | Ga0070711_100036328 | 3300005439 | Bacteria | 3301 |
| 32 | Ga0070663_100163602 | 3300005455 | Bacteria | 1714 |
| 33 | Ga0070678_100027050 | 3300005456 | Bacteria | 3888 |
| 34 | Ga0070678_100045195 | 3300005456 | Bacteria | 3149 |
| 35 | Ga0070678_100177730 | 3300005456 | Bacteria | 1739 |
| 36 | Ga0070662_100067123 | 3300005457 | Bacteria | 2633 |
| 37 | Ga0070681_10031595 | 3300005458 | Bacteria | 5315 |
| 38 | Ga0070681_10458902 | 3300005458 | Bacteria | 1186 |
| 39 | Ga0068867_100057924 | 3300005459 | Bacteria | 2870 |
| 40 | Ga0070679_100039899 | 3300005530 | Bacteria | 4667 |
| 41 | Ga0070679_100381448 | 3300005530 | Bacteria | 1356 |
| 42 | Ga0070686_100277052 | 3300005544 | Bacteria | 1235 |
| 43 | Ga0070665_100001701 | 3300005548 | Bacteria | 25284 |
| 44 | Ga0070665_100118347 | 3300005548 | Bacteria | 2651 |
| 45 | Ga0070665_100187103 | 3300005548 | Bacteria | 2072 |
| 46 | Ga0070665_100298797 | 3300005548 | Bacteria | 1613 |
| 47 | Ga0068855_100007283 | 3300005563 | Bacteria | 13412 |
| 48 | Ga0068854_100457000 | 3300005578 | Bacteria | 1068 |
| 49 | Ga0068856_100230154 | 3300005614 | Bacteria | 1869 |
| 50 | Ga0070702_100036568 | 3300005615 | Bacteria | 2721 |
| 51 | Ga0068852_100184832 | 3300005616 | Bacteria | 1962 |
| 52 | Ga0068852_100247985 | 3300005616 | Bacteria | 1705 |
| 53 | Ga0068864_100174430 | 3300005618 | Bacteria | 1962 |
| 54 | Ga0068866_10009098 | 3300005718 | Bacteria | 4210 |
| 55 | Ga0068861_100108112 | 3300005719 | Bacteria | 2224 |
| 56 | Ga0068851_10037343 | 3300005834 | Bacteria | 2435 |
| 57 | Ga0068858_100043318 | 3300005842 | Bacteria | 4173 |
| 58 | Ga0068858_100172896 | 3300005842 | Bacteria | 2038 |
| 59 | Ga0068858_100441824 | 3300005842 | Bacteria | 1253 |
| 60 | Ga0068860_100209491 | 3300005843 | Bacteria | 1890 |
| 61 | Ga0068862_100289654 | 3300005844 | Bacteria | 1503 |
| 62 | Ga0081455_10024950 | 3300005937 | Bacteria | 5525 |
| 63 | Ga0081540_1001804 | 3300005983 | Bacteria | 17954 |
| 64 | Ga0081540_1002740 | 3300005983 | Bacteria | 14339 |
| 65 | Ga0081540_1005400 | 3300005983 | Bacteria | 9545 |
| 66 | Ga0081540_1014532 | 3300005983 | Bacteria | 5035 |
| 67 | Ga0081540_1023099 | 3300005983 | Bacteria | 3650 |
| 68 | Ga0075365_10270007 | 3300006038 | Bacteria | 1196 |
| 69 | Ga0075368_10011581 | 3300006042 | Bacteria | 3211 |
| 70 | Ga0075363_100019050 | 3300006048 | Bacteria | 3426 |
| 71 | Ga0075364_10016062 | 3300006051 | Bacteria | 4651 |
| 72 | Ga0075367_10058261 | 3300006178 | Bacteria | 2298 |
| 73 | Ga0075369_10034742 | 3300006186 | Bacteria | 2141 |
| 74 | Ga0075369_10042410 | 3300006186 | Bacteria | 1951 |
| 75 | Ga0075369_10127811 | 3300006186 | Bacteria | 1153 |
| 76 | Ga0075366_10066306 | 3300006195 | Bacteria | 2147 |
| 77 | Ga0075370_10029883 | 3300006353 | Bacteria | 3037 |
| 78 | Ga0075370_10110496 | 3300006353 | Bacteria | 1596 |
| 79 | Ga0068865_100127894 | 3300006881 | Bacteria | 1899 |
| 80 | Ga0068865_100278141 | 3300006881 | Bacteria | 1331 |
| 81 | Ga0099824_1015940 | 3300006942 | Bacteria | 6951 |
| 82 | Ga0099826_10000112 | 3300006948 | Bacteria | 37415 |
| 83 | Ga0105240_10014358 | 3300009093 | Bacteria | 10814 |
| 84 | Ga0105240_10100189 | 3300009093 | Bacteria | 3525 |
| 85 | Ga0111539_10665928 | 3300009094 | Bacteria | 1212 |
| 86 | Ga0105245_10046076 | 3300009098 | Bacteria | 3896 |
| 87 | Ga0105247_10013642 | 3300009101 | Bacteria | 4873 |
| 88 | Ga0105241_10017103 | 3300009174 | Bacteria | 5325 |
| 89 | Ga0105241_10244892 | 3300009174 | Bacteria | 1517 |
| 90 | Ga0105242_10018046 | 3300009176 | Bacteria | 5511 |
| 91 | Ga0105248_10020793 | 3300009177 | Bacteria | 7271 |
| 92 | Ga0105248_10297604 | 3300009177 | Bacteria | 1817 |
| 93 | Ga0105248_10451111 | 3300009177 | Bacteria | 1449 |
| 94 | Ga0105237_10001286 | 3300009545 | Bacteria | 33400 |
| 95 | Ga0105237_10181614 | 3300009545 | Bacteria | 2104 |
| 96 | Ga0105238_10294831 | 3300009551 | Bacteria | 1605 |
| 97 | Ga0105239_10037102 | 3300010375 | Bacteria | 5346 |
| 98 | Ga0105239_10071160 | 3300010375 | Bacteria | 3821 |
| 99 | Ga0105239_10078807 | 3300010375 | Bacteria | 3625 |
| 100 | Ga0105239_10361252 | 3300010375 | Bacteria | 1640 |
| 101 | Ga0105239_10443703 | 3300010375 | Bacteria | 1472 |
| 102 | Ga0157370_10093335 | 3300013104 | Bacteria | 2824 |
| 103 | Ga0157370_10130206 | 3300013104 | Bacteria | 2347 |
| 104 | Ga0157378_10117046 | 3300013297 | Bacteria | 2451 |
| 105 | Ga0157378_10187660 | 3300013297 | Bacteria | 1948 |
| 106 | Ga0163162_10033761 | 3300013306 | Bacteria | 5086 |
| 107 | Ga0163162_10063332 | 3300013306 | Bacteria | 3740 |
| 108 | Ga0163162_10208206 | 3300013306 | Bacteria | 2085 |
| 109 | Ga0157375_10046937 | 3300013308 | Bacteria | 4214 |
| 110 | Ga0157375_10115950 | 3300013308 | Bacteria | 2782 |
| 111 | Ga0163163_10228158 | 3300014325 | Bacteria | 1911 |
| 112 | Ga0163163_10423821 | 3300014325 | Bacteria | 1390 |
| 113 | Ga0157377_10257589 | 3300014745 | Bacteria | 1134 |
| 114 | Ga0157379_10064141 | 3300014968 | Bacteria | 3283 |
| 115 | Ga0157379_10273599 | 3300014968 | Bacteria | 1536 |
| 116 | Ga0157376_10077055 | 3300014969 | Bacteria | 2851 |
| 117 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 118 | Ga0214544_1024721 | 3300021320 | Bacteria | 3050 |
| 119 | Ga0214544_1026300 | 3300021320 | Bacteria | 2616 |
| 120 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 121 | Ga0214542_1025576 | 3300021321 | Bacteria | 3050 |
| 122 | Ga0214542_1027390 | 3300021321 | Bacteria | 2616 |
| 123 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 124 | Ga0214545_1014661 | 3300021324 | Bacteria | 8985 |
| 125 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 126 | Ga0214543_1015282 | 3300021327 | Bacteria | 8564 |
| 127 | Ga0213872_10028780 | 3300021361 | Bacteria | 2548 |
| 128 | Ga0209563_101399 | 3300025230 | Bacteria | 6449 |
| 129 | Ga0209677_106909 | 3300025253 | Bacteria | 2561 |
| 130 | Ga0209148_1000803 | 3300025254 | Bacteria | 22974 |
| 131 | Ga0209233_1012089 | 3300025261 | Bacteria | 2516 |
| 132 | Ga0209564_1024380 | 3300025295 | Bacteria | 2069 |
| 133 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 134 | Ga0209758_1000164 | 3300025297 | Bacteria | 151759 |
| 135 | Ga0209758_1003244 | 3300025297 | Bacteria | 15090 |
| 136 | Ga0209758_1017486 | 3300025297 | Bacteria | 3566 |
| 137 | Ga0209758_1028045 | 3300025297 | Bacteria | 2391 |
| 138 | Ga0209758_1040304 | 3300025297 | Bacteria | 1763 |
| 139 | Ga0209256_1004118 | 3300025299 | Bacteria | 9414 |
| 140 | Ga0209256_1017604 | 3300025299 | Bacteria | 2363 |
| 141 | Ga0207426_1000611 | 3300025302 | Bacteria | 46127 |
| 142 | Ga0207426_1003966 | 3300025302 | Bacteria | 7550 |
| 143 | Ga0209257_1002068 | 3300025304 | Bacteria | 21183 |
| 144 | Ga0209257_1015471 | 3300025304 | Bacteria | 3171 |
| 145 | Ga0209257_1067879 | 3300025304 | Bacteria | 949 |
| 146 | Ga0207688_10071945 | 3300025901 | Bacteria | 1964 |
| 147 | Ga0207688_10115869 | 3300025901 | Bacteria | 1559 |
| 148 | Ga0207647_10001716 | 3300025904 | Bacteria | 16822 |
| 149 | Ga0207654_10148107 | 3300025911 | Bacteria | 1504 |
| 150 | Ga0207654_10239056 | 3300025911 | Bacteria | 1213 |
| 151 | Ga0207707_10013378 | 3300025912 | Bacteria | 7154 |
| 152 | Ga0207695_10000342 | 3300025913 | Bacteria | 108393 |
| 153 | Ga0207671_10177156 | 3300025914 | Bacteria | 1658 |
| 154 | Ga0207671_10204795 | 3300025914 | Bacteria | 1542 |
| 155 | Ga0207663_10017284 | 3300025916 | Bacteria | 4015 |
| 156 | Ga0207649_10060007 | 3300025920 | Bacteria | 2388 |
| 157 | Ga0207652_10040794 | 3300025921 | Bacteria | 3943 |
| 158 | Ga0207694_10382544 | 3300025924 | Bacteria | 1168 |
| 159 | Ga0207687_10003408 | 3300025927 | Bacteria | 10725 |
| 160 | Ga0207687_10204035 | 3300025927 | Bacteria | 1547 |
| 161 | Ga0207644_10033049 | 3300025931 | Bacteria | 3613 |
| 162 | Ga0207706_10064171 | 3300025933 | Bacteria | 3233 |
| 163 | Ga0207706_10296568 | 3300025933 | Bacteria | 1409 |
| 164 | Ga0207709_10042880 | 3300025935 | Bacteria | 2724 |
| 165 | Ga0207670_10178969 | 3300025936 | Bacteria | 1596 |
| 166 | Ga0207669_10025136 | 3300025937 | Bacteria | 3212 |
| 167 | Ga0207691_10155260 | 3300025940 | Bacteria | 2010 |
| 168 | Ga0207691_10195025 | 3300025940 | Bacteria | 1765 |
| 169 | Ga0207711_10109061 | 3300025941 | Bacteria | 2460 |
| 170 | Ga0207689_10027549 | 3300025942 | Bacteria | 4755 |
| 171 | Ga0207689_10105820 | 3300025942 | Bacteria | 2311 |
| 172 | Ga0207689_10422718 | 3300025942 | Bacteria | 1112 |
| 173 | Ga0207679_10142733 | 3300025945 | Bacteria | 1938 |
| 174 | Ga0207667_10119577 | 3300025949 | Bacteria | 2715 |
| 175 | Ga0207712_10088257 | 3300025961 | Bacteria | 2277 |
| 176 | Ga0207658_10166343 | 3300025986 | Bacteria | 1812 |
| 177 | Ga0207658_10249368 | 3300025986 | Bacteria | 1508 |
| 178 | Ga0207658_10440323 | 3300025986 | Bacteria | 1152 |
| 179 | Ga0207677_10020731 | 3300026023 | Bacteria | 3998 |
| 180 | Ga0207677_10183437 | 3300026023 | Bacteria | 1648 |
| 181 | Ga0207703_10120003 | 3300026035 | Bacteria | 2256 |
| 182 | Ga0207703_10203043 | 3300026035 | Bacteria | 1762 |
| 183 | Ga0207678_10004710 | 3300026067 | Bacteria | 12244 |
| 184 | Ga0207678_10008126 | 3300026067 | Bacteria | 9249 |
| 185 | Ga0207678_10032622 | 3300026067 | Bacteria | 4539 |
| 186 | Ga0207678_10071735 | 3300026067 | Bacteria | 2969 |
| 187 | Ga0207678_10139735 | 3300026067 | Bacteria | 2067 |
| 188 | Ga0207678_10197066 | 3300026067 | Bacteria | 1722 |
| 189 | Ga0207708_10031505 | 3300026075 | Bacteria | 4025 |
| 190 | Ga0207702_10176424 | 3300026078 | Bacteria | 1964 |
| 191 | Ga0207648_10006225 | 3300026089 | Bacteria | 11885 |
| 192 | Ga0207648_10172158 | 3300026089 | Bacteria | 1914 |
| 193 | Ga0207675_100227369 | 3300026118 | Bacteria | 1799 |
| 194 | Ga0207683_10018785 | 3300026121 | Bacteria | 5898 |
| 195 | Ga0207683_10105956 | 3300026121 | Bacteria | 2513 |
| 196 | Ga0207698_10539632 | 3300026142 | Bacteria | 1141 |
| 197 | Ga0207698_10579948 | 3300026142 | Bacteria | 1103 |
| 198 | Ga0209371_1002460 | 3300027312 | Bacteria | 10323 |
| 199 | Ga0209282_1002045 | 3300027666 | Bacteria | 11478 |
| 200 | Ga0268266_10002227 | 3300028379 | Bacteria | 21177 |
| 201 | Ga0268266_10068682 | 3300028379 | Bacteria | 3069 |
| 202 | Ga0268266_10618418 | 3300028379 | Bacteria | 1041 |
| 203 | Ga0268265_10404340 | 3300028380 | Bacteria | 1263 |
| 204 | Ga0268265_10494238 | 3300028380 | Bacteria | 1151 |
| 205 | Ga0268264_10143647 | 3300028381 | Bacteria | 2131 |
| 206 | Ga0268264_10350275 | 3300028381 | Bacteria | 1405 |
| 207 | Ga0265326_10013527 | 3300028558 | Bacteria | 2385 |
| 208 | Ga0265334_10028087 | 3300028573 | Unclassified | 2263 |
| 209 | Ga0265323_10041960 | 3300028653 | Bacteria | 1658 |
| 210 | Ga0307517_10000125 | 3300028786 | Bacteria | 115466 |
| 211 | Ga0307515_10049435 | 3300028794 | Bacteria | 6327 |
| 212 | Ga0265338_10001338 | 3300028800 | Bacteria | 40180 |
| 213 | Ga0268256_1003711 | 3300030500 | Bacteria | 6724 |
| 214 | Ga0265330_10041339 | 3300031235 | Bacteria | 2044 |
| 215 | Ga0265325_10147802 | 3300031241 | Bacteria | 1113 |
| 216 | Ga0265339_10052409 | 3300031249 | Bacteria | 2223 |
| 217 | Ga0265331_10009277 | 3300031250 | Bacteria | 5537 |
| 218 | Ga0265331_10082265 | 3300031250 | Bacteria | 1494 |
| 219 | Ga0265316_10158531 | 3300031344 | Bacteria | 1693 |
| 220 | Ga0307508_10083434 | 3300031616 | Bacteria | 2778 |
| 221 | Ga0265314_10032234 | 3300031711 | Bacteria | 3856 |
| 222 | Ga0265342_10062243 | 3300031712 | Bacteria | 2197 |
| 223 | Ga0307409_100530039 | 3300031995 | Bacteria | 1152 |
| 224 | Ga0307510_10004259 | 3300033180 | Bacteria | 16815 |
| 225 | Ga0373934_0009278 | 3300035086 | Bacteria | 3683 |
| 226 | Ga0373923_0000728 | 3300035111 | Bacteria | 8477 |
| 227 | Ga0373936_0004786 | 3300035113 | Bacteria | 5109 |
| 228 | Ga0373953_0004226 | 3300035117 | Bacteria | 4557 |
| 229 | Ga0373954_0006955 | 3300035118 | Bacteria | 4938 |
| 230 | Ga0373954_0030384 | 3300035118 | Bacteria | 2491 |
| 231 | Ga0373957_0000700 | 3300035120 | Bacteria | 8682 |
| 232 | Ga0373957_0037987 | 3300035120 | Bacteria | 1801 |
| 233 | Ga0373943_0149158 | 3300035170 | Bacteria | 1266 |
| 234 | Ga0373955_0000624 | 3300035172 | Bacteria | 15179 |
| 235 | Ga0373924_0014572 | 3300035410 | Bacteria | 2974 |
| 236 | Ga0373931_0048659 | 3300035691 | Bacteria | 2248 |
| 237 | Ga0373931_0306123 | 3300035691 | Bacteria | 983 |
| 238 | Ga0373927_0014344 | 3300035695 | Bacteria | 5248 |
| 239 | Ga0373927_0019200 | 3300035695 | Bacteria | 4483 |
| 240 | Ga0373927_0031030 | 3300035695 | Bacteria | 3486 |
| 241 | Ga0373933_0002551 | 3300035724 | Bacteria | 10216 |
| 242 | Ga0373933_0200425 | 3300035724 | Bacteria | 1277 |
| 243 | Ga0373937_0007814 | 3300036401 | Bacteria | 9272 |
| 244 | Ga0373937_0041702 | 3300036401 | Bacteria | 4187 |
| 245 | Ga0373925_0133808 | 3300037068 | Bacteria | 1935 |
| 246 | Ga0395900_0000601 | 3300037418 | Bacteria | 49219 |
| 247 | Ga0395898_0010480 | 3300037466 | Bacteria | 9689 |
| 248 | Ga0395905_0014881 | 3300037471 | Bacteria | 7422 |
| 249 | Ga0395905_0522626 | 3300037471 | Bacteria | 1087 |
| 250 | Ga0395901_0154042 | 3300038443 | Bacteria | 2414 |
| 251 | Ga0466972_0000149 | 3300044658 | Bacteria | 56799 |
| 252 | Ga0466972_0021294 | 3300044658 | Bacteria | 3233 |
| 253 | Ga0466965_0110999 | 3300044683 | Bacteria | 1409 |
| 254 | Ga0466966_0002474 | 3300044684 | Bacteria | 12086 |
| 255 | Ga0466961_0000082 | 3300044693 | Bacteria | 59328 |
| 256 | Ga0466960_0070622 | 3300044901 | Bacteria | 1738 |
| 257 | Ga0466959_0008370 | 3300045049 | Bacteria | 7309 |
| 258 | Ga0495617_024234 | 3300046452 | Bacteria | 2048 |
| 259 | Ga0495629_0000450 | 3300046459 | Bacteria | 34200 |
| 260 | Ga0495638_0015765 | 3300046460 | Bacteria | 5064 |
| 261 | Ga0495651_0003755 | 3300046462 | Bacteria | 11617 |
| 262 | Ga0495651_0030910 | 3300046462 | Bacteria | 4176 |
| 263 | Ga0495653_0001326 | 3300046463 | Bacteria | 19200 |
| 264 | Ga0495580_0283958 | 3300046472 | Bacteria | 1129 |
| 265 | Ga0495582_0028770 | 3300046473 | Bacteria | 3050 |
| 266 | Ga0495639_0191249 | 3300046475 | Bacteria | 999 |
| 267 | Ga0495664_0129550 | 3300046477 | Bacteria | 1527 |
| 268 | Ga0495606_0060108 | 3300046507 | Bacteria | 2435 |
| 269 | Ga0495606_0265754 | 3300046507 | Bacteria | 945 |
| 270 | Ga0495608_0000519 | 3300046511 | Bacteria | 26476 |
| 271 | Ga0495608_0024114 | 3300046511 | Bacteria | 4163 |
| 272 | Ga0495608_0106144 | 3300046511 | Bacteria | 1808 |
| 273 | Ga0495618_0008396 | 3300046514 | Bacteria | 6252 |
| 274 | Ga0495618_0166343 | 3300046514 | Bacteria | 1404 |
| 275 | Ga0495628_0009138 | 3300046516 | Bacteria | 8477 |
| 276 | Ga0495628_0217081 | 3300046516 | Bacteria | 1437 |
| 277 | Ga0495643_0057586 | 3300046522 | Bacteria | 2070 |
| 278 | Ga0495648_0002337 | 3300046524 | Bacteria | 17612 |
| 279 | Ga0495652_0007399 | 3300046529 | Bacteria | 10124 |
| 280 | Ga0495652_0077014 | 3300046529 | Bacteria | 2765 |
| 281 | Ga0495665_0184999 | 3300046531 | Bacteria | 1082 |
| 282 | Ga0495640_0009150 | 3300046533 | Bacteria | 7730 |
| 283 | Ga0495640_0032668 | 3300046533 | Bacteria | 3705 |
| 284 | Ga0495587_0003210 | 3300046536 | Bacteria | 10925 |
| 285 | Ga0495645_0053987 | 3300046543 | Bacteria | 2920 |
| 286 | Ga0495622_0003117 | 3300046557 | Bacteria | 7857 |
| 287 | Ga0495633_0013768 | 3300046558 | Bacteria | 4250 |
| 288 | Ga0495667_0000128 | 3300046559 | Bacteria | 54804 |
| 289 | Ga0495667_0280950 | 3300046559 | Bacteria | 1057 |
| 290 | Ga0495656_0214588 | 3300046615 | Bacteria | 960 |
| 291 | Ga0495634_0007637 | 3300046642 | Bacteria | 8100 |
| 292 | Ga0495634_0039222 | 3300046642 | Bacteria | 3226 |
| 293 | Ga0495635_0000232 | 3300046663 | Bacteria | 35357 |
| 294 | Ga0495635_0011468 | 3300046663 | Bacteria | 6214 |
| 295 | Ga0495635_0130393 | 3300046663 | Bacteria | 1714 |
| 296 | Ga0495659_0004030 | 3300046664 | Bacteria | 4647 |
| 297 | Ga0495661_0123654 | 3300046665 | Bacteria | 1426 |
| 298 | Ga0495657_0005193 | 3300046675 | Bacteria | 10312 |
| 299 | Ga0495657_0012825 | 3300046675 | Bacteria | 6212 |
| 300 | Ga0495657_0085710 | 3300046675 | Bacteria | 2030 |
| 301 | Ga0495599_0006414 | 3300046678 | Bacteria | 7098 |
| 302 | Ga0495599_0022941 | 3300046678 | Bacteria | 3898 |
| 303 | Ga0495623_0014341 | 3300046679 | Bacteria | 5129 |
| 304 | Ga0495646_0006561 | 3300046680 | Bacteria | 7384 |
| 305 | Ga0495646_0055419 | 3300046680 | Bacteria | 2381 |
| 306 | Ga0495646_0160004 | 3300046680 | Bacteria | 1247 |
| 307 | Ga0495658_0096917 | 3300046683 | Bacteria | 1755 |
| 308 | Ga0495669_0008461 | 3300046684 | Bacteria | 4328 |
| 309 | Ga0495669_0186648 | 3300046684 | Bacteria | 989 |
| 310 | Ga0495613_0012353 | 3300046689 | Bacteria | 6346 |
| 311 | Ga0495624_0014677 | 3300046690 | Bacteria | 5305 |
| 312 | Ga0495600_0001942 | 3300046809 | Bacteria | 11616 |
| 313 | Ga0495581_0049648 | 3300047315 | Bacteria | 2423 |
| 314 | Ga0495604_0006257 | 3300047317 | Bacteria | 9442 |
| 315 | Ga0495604_0007123 | 3300047317 | Bacteria | 8865 |
| 316 | Ga0495636_0025902 | 3300047318 | Bacteria | 2383 |
| 317 | Ga0495674_0017379 | 3300047319 | Bacteria | 6692 |
| 318 | Ga0495672_0019815 | 3300047320 | Bacteria | 4426 |
| 319 | Ga0495676_0032531 | 3300047321 | Bacteria | 4401 |
| 320 | Ga0495680_0000314 | 3300047322 | Bacteria | 54452 |
| 321 | Ga0495680_0013688 | 3300047322 | Bacteria | 7063 |
| 322 | Ga0495675_0162222 | 3300047444 | Bacteria | 1376 |
| 323 | Ga0495684_0001551 | 3300047471 | Bacteria | 18398 |
| 324 | Ga0495593_0001148 | 3300047673 | Bacteria | 15449 |
| 325 | Ga0496100_0183680 | 3300048903 | Bacteria | 1514 |
| 326 | Ga0496101_0060355 | 3300048904 | Bacteria | 2751 |
| 327 | Ga0496101_0073889 | 3300048904 | Bacteria | 2505 |
| 328 | Ga0496101_0074817 | 3300048904 | Bacteria | 2492 |
| 329 | Ga0496102_0075086 | 3300048905 | Bacteria | 3107 |
| 330 | Ga0496102_0152038 | 3300048905 | Bacteria | 2175 |
| 331 | Ga0496102_0605780 | 3300048905 | Bacteria | 1018 |
| 332 | Ga0496102_0657184 | 3300048905 | Bacteria | 971 |
| 333 | Ga0496103_0029282 | 3300048906 | Bacteria | 3346 |
| 334 | Ga0496103_0107781 | 3300048906 | Bacteria | 1767 |
| 335 | Ga0496104_0001696 | 3300048907 | Bacteria | 19029 |
| 336 | Ga0496104_0034628 | 3300048907 | Bacteria | 4711 |
| 337 | Ga0496104_0113178 | 3300048907 | Bacteria | 2602 |
| 338 | Ga0496104_0154916 | 3300048907 | Bacteria | 2199 |
| 339 | Ga0496104_0166725 | 3300048907 | Bacteria | 2112 |
| 340 | Ga0496105_0000992 | 3300048908 | Bacteria | 19571 |
| 341 | Ga0496105_0038559 | 3300048908 | Bacteria | 3936 |
| 342 | Ga0496105_0209449 | 3300048908 | Bacteria | 1589 |
| 343 | Ga0496105_0275695 | 3300048908 | Bacteria | 1357 |
| 344 | Ga0496106_0050008 | 3300048909 | Bacteria | 3150 |
| 345 | Ga0496106_0142306 | 3300048909 | Bacteria | 1887 |
| 346 | Ga0496107_0003405 | 3300048910 | Bacteria | 10638 |
| 347 | Ga0496108_0041121 | 3300048911 | Bacteria | 3857 |
| 348 | Ga0496108_0131295 | 3300048911 | Bacteria | 2153 |
| 349 | Ga0496109_0007428 | 3300048912 | Bacteria | 9278 |
| 350 | Ga0496109_0015451 | 3300048912 | Bacteria | 6654 |
| 351 | Ga0496110_0005590 | 3300048913 | Bacteria | 9870 |
| 352 | Ga0496110_0109361 | 3300048913 | Bacteria | 2482 |
| 353 | Ga0496110_0141131 | 3300048913 | Bacteria | 2178 |
| 354 | Ga0496111_0081144 | 3300048914 | Bacteria | 2367 |
| 355 | Ga0496111_0131522 | 3300048914 | Bacteria | 1852 |
| 356 | Ga0496111_0159367 | 3300048914 | Bacteria | 1675 |
| 357 | Ga0496112_0004436 | 3300048915 | Bacteria | 11886 |
| 358 | Ga0496112_0204021 | 3300048915 | Bacteria | 1935 |
| 359 | Ga0496112_0495526 | 3300048915 | Bacteria | 1157 |
| 360 | Ga0496113_0007091 | 3300048916 | Bacteria | 7174 |
| 361 | Ga0496113_0208700 | 3300048916 | Bacteria | 1554 |
| 362 | Ga0496113_0264034 | 3300048916 | Bacteria | 1375 |
| 363 | Ga0496114_0007466 | 3300048917 | Bacteria | 8643 |
| 364 | Ga0496114_0414595 | 3300048917 | Bacteria | 1193 |
| 365 | Ga0496115_0022644 | 3300048918 | Bacteria | 4870 |
| 366 | Ga0496116_0041959 | 3300048919 | Bacteria | 3133 |
| 367 | Ga0496116_0061434 | 3300048919 | Bacteria | 2432 |
| 368 | Ga0496116_0134649 | 3300048919 | Bacteria | 1402 |
| 369 | Ga0496117_0016084 | 3300048920 | Bacteria | 6332 |
| 370 | Ga0496117_0085969 | 3300048920 | Bacteria | 2045 |
| 371 | Ga0496118_0082386 | 3300048921 | Bacteria | 2254 |
| 372 | Ga0496119_0002507 | 3300048922 | Bacteria | 20068 |
| 373 | Ga0496119_0034442 | 3300048922 | Bacteria | 3335 |
| 374 | Ga0496119_0162229 | 3300048922 | Bacteria | 1187 |
| 375 | Ga0496120_0011604 | 3300048923 | Bacteria | 6049 |
| 376 | Ga0496120_0021066 | 3300048923 | Bacteria | 4125 |
| 377 | Ga0496120_0067249 | 3300048923 | Unclassified | 1980 |
| 378 | Ga0496120_0153303 | 3300048923 | Bacteria | 1156 |
| 379 | Ga0496121_0017785 | 3300048924 | Bacteria | 7226 |
| 380 | Ga0496121_0018380 | 3300048924 | Bacteria | 7052 |
| 381 | Ga0496121_0175284 | 3300048924 | Bacteria | 1553 |
| 382 | Ga0496122_0095566 | 3300048925 | Bacteria | 2007 |
| 383 | Ga0496122_0109703 | 3300048925 | Bacteria | 1815 |
| 384 | Ga0496122_0128252 | 3300048925 | Bacteria | 1619 |
| 385 | Ga0496123_0051406 | 3300048926 | Bacteria | 2744 |
| 386 | Ga0496124_0030083 | 3300048927 | Unclassified | 4826 |
| 387 | Ga0496124_0155381 | 3300048927 | Unclassified | 1789 |
| 388 | Ga0496124_0247051 | 3300048927 | Unclassified | 1322 |
| 389 | Ga0496125_0000152 | 3300048928 | Bacteria | 153295 |
| 390 | Ga0496125_0051656 | 3300048928 | Bacteria | 3388 |
| 391 | Ga0496125_0228482 | 3300048928 | Bacteria | 1192 |
| 392 | Ga0496126_0045954 | 3300048929 | Bacteria | 4009 |
| 393 | Ga0496126_0073236 | 3300048929 | Bacteria | 3046 |
| 394 | Ga0496126_0148564 | 3300048929 | Unclassified | 2010 |
| 395 | Ga0496126_0389147 | 3300048929 | Bacteria | 1133 |
| 396 | Ga0501032_0000188 | 3300049569 | Bacteria | 51273 |
| 397 | Ga0501033_0000094 | 3300049570 | Bacteria | 84669 |
| 398 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 399 | Ga0501036_0000697 | 3300049572 | Bacteria | 24782 |
| 400 | Ga0501037_0000174 | 3300049573 | Bacteria | 60960 |
| 401 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 402 | Ga0501039_0000156 | 3300049575 | Bacteria | 47049 |
| 403 | Ga0501042_0042709 | 3300049578 | Bacteria | 3228 |
| 404 | Ga0501043_0004414 | 3300049579 | Bacteria | 11423 |
| 405 | Ga0501046_0000133 | 3300049580 | Bacteria | 79467 |
| 406 | Ga0501047_0000511 | 3300049581 | Bacteria | 41841 |
| 407 | Ga0501048_0000072 | 3300049582 | Bacteria | 51953 |
| 408 | Ga0501067_0000045 | 3300049583 | Bacteria | 73394 |
| 409 | Ga0501068_0008493 | 3300049584 | Bacteria | 5718 |
| 410 | Ga0501069_0003931 | 3300049585 | Bacteria | 7661 |
| 411 | Ga0501070_0039640 | 3300049586 | Bacteria | 3928 |
| 412 | Ga0501072_0008854 | 3300049588 | Bacteria | 7645 |
| 413 | Ga0501073_0000099 | 3300049589 | Bacteria | 55207 |
| 414 | Ga0501074_0001112 | 3300049590 | Bacteria | 17543 |
| 415 | Ga0501079_0005428 | 3300049741 | Bacteria | 9499 |
| 416 | Ga0501080_0006892 | 3300049742 | Bacteria | 10247 |
| 417 | Ga0501083_0001322 | 3300049744 | Bacteria | 16804 |
| 418 | Ga0501035_0002501 | 3300049822 | Bacteria | 17968 |
| 419 | Ga0501044_0000141 | 3300049823 | Bacteria | 88569 |
| 420 | Ga0501045_0003694 | 3300049824 | Bacteria | 10527 |
| 421 | nmdc:mga03n38_1783_c1 | 3300050490 | Bacteria | 5346 |
| 422 | nmdc:mga00v17_19791_c1 | 3300050491 | Bacteria | 3848 |
| 423 | nmdc:mga00v17_284523_c1 | 3300050491 | Bacteria | 1073 |
| 424 | nmdc:mga0yw44_54122_c1 | 3300050492 | Bacteria | 2438 |
| 425 | nmdc:mga0k408_72521_c1 | 3300050493 | Bacteria | 2011 |
| 426 | nmdc:mga06z11_11720_c1 | 3300050494 | Bacteria | 3790 |
| 427 | nmdc:mga06z11_8088_c1 | 3300050494 | Bacteria | 4365 |
| 428 | nmdc:mga07m45_61055_c1 | 3300050496 | Bacteria | 2135 |
| 429 | nmdc:mga08y16_551449_c1 | 3300050511 | Bacteria | 1166 |
| 430 | nmdc:mga0sz30_26486_c1 | 3300050516 | Bacteria | 2377 |
| 431 | nmdc:mga0sz30_76625_c1 | 3300050516 | Bacteria | 1444 |
| 432 | nmdc:mga0sz30_87533_c1 | 3300050516 | Bacteria | 1353 |
| 433 | Ga0495601_0005815 | 3300053077 | Bacteria | 7192 |
| 434 | Ga0495595_0001439 | 3300053084 | Bacteria | 9274 |
| 435 | Ga0495619_0002618 | 3300053085 | Bacteria | 11755 |
| 436 | Ga0495619_0029280 | 3300053085 | Bacteria | 3557 |
| 437 | Ga0500578_0049034 | 3300053086 | Bacteria | 2709 |
| 438 | Ga0500643_000114 | 3300053087 | Bacteria | 84221 |
| 439 | Ga0500583_0073461 | 3300053092 | Bacteria | 1640 |
| 440 | Ga0500566_0000373 | 3300053094 | Bacteria | 24600 |
| 441 | Ga0500566_0008132 | 3300053094 | Bacteria | 6203 |
| 442 | Ga0500650_0022553 | 3300053098 | Bacteria | 2788 |
| 443 | Ga0500555_000656 | 3300053103 | Bacteria | 13263 |
| 444 | Ga0500556_0018952 | 3300053104 | Bacteria | 2180 |
| 445 | Ga0500556_0064835 | 3300053104 | Bacteria | 1353 |
| 446 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 447 | Ga0500560_007338 | 3300053107 | Bacteria | 2590 |
| 448 | Ga0500562_004278 | 3300053108 | Bacteria | 3614 |
| 449 | Ga0500569_021445 | 3300053109 | Bacteria | 1708 |
| 450 | Ga0500595_000628 | 3300053119 | Bacteria | 21174 |
| 451 | Ga0500595_001592 | 3300053119 | Bacteria | 11990 |
| 452 | Ga0500595_013877 | 3300053119 | Bacteria | 3074 |
| 453 | Ga0500607_040299 | 3300053121 | Bacteria | 2532 |
| 454 | Ga0500614_007310 | 3300053123 | Bacteria | 2326 |
| 455 | Ga0500642_0000077 | 3300053130 | Bacteria | 53422 |
| 456 | Ga0500642_0006266 | 3300053130 | Bacteria | 3901 |
| 457 | Ga0500642_0007341 | 3300053130 | Bacteria | 3698 |
| 458 | Ga0500559_0077973 | 3300053136 | Bacteria | 1502 |
| 459 | Ga0500590_098152 | 3300053148 | Bacteria | 1411 |
| 460 | Ga0500604_0005443 | 3300053151 | Bacteria | 3360 |
| 461 | Ga0500616_0081769 | 3300053153 | Bacteria | 1622 |
| 462 | Ga0500622_0011023 | 3300053156 | Bacteria | 4933 |
| 463 | Ga0500624_000198 | 3300053157 | Bacteria | 23807 |
| 464 | Ga0500634_0009431 | 3300053161 | Bacteria | 4938 |
| 465 | Ga0500638_001951 | 3300053162 | Bacteria | 6898 |
| 466 | Ga0500638_027784 | 3300053162 | Bacteria | 2716 |
| 467 | Ga0500636_0000116 | 3300053177 | Bacteria | 41607 |
| 468 | Ga0500637_0009162 | 3300053178 | Bacteria | 5024 |
| 469 | Ga0500645_024273 | 3300053730 | Bacteria | 1854 |
| 470 | Ga0500599_000199 | 3300053736 | Bacteria | 5602 |
| 471 | Ga0500601_000138 | 3300053737 | Bacteria | 14860 |
| 472 | Ga0501084_0006916 | 3300054114 | Bacteria | 9336 |
| 473 | Ga0500661_001981 | 3300055283 | Bacteria | 3865 |
| 474 | Ga0501082_0002578 | 3300060353 | Bacteria | 15849 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044684 | Ga0466966_0002474 | Ga0466966_0002474_4594_5394 | 239 |
| 2 | 3300035086 | Ga0373934_0009278 | Ga0373934_0009278_1778_2632 | 244 |
| 3 | 3300035111 | Ga0373923_0000728 | Ga0373923_0000728_6556_7410 | 244 |
| 4 | 3300035117 | Ga0373953_0004226 | Ga0373953_0004226_1854_2708 | 244 |
| 5 | 3300035118 | Ga0373954_0006955 | Ga0373954_0006955_1916_2770 | 244 |
| 6 | 3300035120 | Ga0373957_0000700 | Ga0373957_0000700_746_1600 | 244 |
| 7 | 3300035172 | Ga0373955_0000624 | Ga0373955_0000624_10647_11501 | 244 |
| 8 | 3300035410 | Ga0373924_0014572 | Ga0373924_0014572_2052_2906 | 244 |
| 9 | 3300035724 | Ga0373933_0002551 | Ga0373933_0002551_1313_2167 | 244 |
| 10 | 3300036401 | Ga0373937_0007814 | Ga0373937_0007814_2003_2857 | 244 |
| 11 | 3300046459 | Ga0495629_0000450 | Ga0495629_0000450_16769_17623 | 244 |
| 12 | 3300046462 | Ga0495651_0003755 | Ga0495651_0003755_3553_4407 | 244 |
| 13 | 3300046463 | Ga0495653_0001326 | Ga0495653_0001326_1416_2270 | 244 |
| 14 | 3300046511 | Ga0495608_0000519 | Ga0495608_0000519_8188_9042 | 244 |
| 15 | 3300046514 | Ga0495618_0008396 | Ga0495618_0008396_1274_2128 | 244 |
| 16 | 3300046516 | Ga0495628_0009138 | Ga0495628_0009138_1669_2523 | 244 |
| 17 | 3300046529 | Ga0495652_0007399 | Ga0495652_0007399_4421_5275 | 244 |
| 18 | 3300046533 | Ga0495640_0009150 | Ga0495640_0009150_5803_6657 | 244 |
| 19 | 3300046536 | Ga0495587_0003210 | Ga0495587_0003210_8070_8924 | 244 |
| 20 | 3300046543 | Ga0495645_0053987 | Ga0495645_0053987_1419_2273 | 244 |
| 21 | 3300046559 | Ga0495667_0000128 | Ga0495667_0000128_2875_3729 | 244 |
| 22 | 3300046642 | Ga0495634_0007637 | Ga0495634_0007637_2903_3757 | 244 |
| 23 | 3300046663 | Ga0495635_0000232 | Ga0495635_0000232_31629_32483 | 244 |
| 24 | 3300046675 | Ga0495657_0005193 | Ga0495657_0005193_7457_8311 | 244 |
| 25 | 3300046678 | Ga0495599_0006414 | Ga0495599_0006414_4354_5208 | 244 |
| 26 | 3300046679 | Ga0495623_0014341 | Ga0495623_0014341_1399_2253 | 244 |
| 27 | 3300046680 | Ga0495646_0006561 | Ga0495646_0006561_5196_6050 | 244 |
| 28 | 3300046809 | Ga0495600_0001942 | Ga0495600_0001942_7211_8065 | 244 |
| 29 | 3300047317 | Ga0495604_0007123 | Ga0495604_0007123_4460_5314 | 244 |
| 30 | 3300047319 | Ga0495674_0017379 | Ga0495674_0017379_4391_5245 | 244 |
| 31 | 3300047322 | Ga0495680_0000314 | Ga0495680_0000314_18662_19516 | 244 |
| 32 | 3300047471 | Ga0495684_0001551 | Ga0495684_0001551_6313_7167 | 244 |
| 33 | 3300047673 | Ga0495593_0001148 | Ga0495593_0001148_4458_5312 | 244 |
| 34 | 3300053077 | Ga0495601_0005815 | Ga0495601_0005815_1257_2111 | 244 |
| 35 | 3300053084 | Ga0495595_0001439 | Ga0495595_0001439_3964_4818 | 244 |
| 36 | 3300053085 | Ga0495619_0002618 | Ga0495619_0002618_6976_7830 | 244 |
| 37 | 3300053121 | Ga0500607_040299 | Ga0500607_040299_983_1834 | 244 |
| 38 | 3300053123 | Ga0500614_007310 | Ga0500614_007310_672_1523 | 244 |
| 39 | 3300028381 | Ga0268264_10143647 | Ga0268264_101436473 | 246 |
| 40 | 3300046477 | Ga0495664_0129550 | Ga0495664_0129550_744_1490 | 246 |
| 41 | 3300049578 | Ga0501042_0042709 | Ga0501042_0042709_702_1547 | 248 |
| 42 | 3300047321 | Ga0495676_0032531 | Ga0495676_0032531_1048_1899 | 249 |
| 43 | 3300048905 | Ga0496102_0657184 | Ga0496102_0657184_63_914 | 249 |
| 44 | 3300048907 | Ga0496104_0001696 | Ga0496104_0001696_17030_17881 | 249 |
| 45 | 3300048908 | Ga0496105_0000992 | Ga0496105_0000992_11757_12608 | 249 |
| 46 | 3300048922 | Ga0496119_0002507 | Ga0496119_0002507_7797_8648 | 249 |
| 47 | 3300048923 | Ga0496120_0011604 | Ga0496120_0011604_2769_3620 | 249 |
| 48 | 3300048929 | Ga0496126_0045954 | Ga0496126_0045954_169_1020 | 249 |
| 49 | 3300031235 | Ga0265330_10041339 | Ga0265330_100413392 | 250 |
| 50 | 3300005339 | Ga0070660_100278355 | Ga0070660_1002783552 | 254 |
| 51 | 3300048922 | Ga0496119_0162229 | Ga0496119_0162229_293_1144 | 254 |
| 52 | 3300053156 | Ga0500622_0011023 | Ga0500622_0011023_1136_1990 | 254 |
| 53 | 3300005437 | Ga0070710_10207543 | Ga0070710_102075431 | 255 |
| 54 | 3300005616 | Ga0068852_100184832 | Ga0068852_1001848323 | 255 |
| 55 | 3300009093 | Ga0105240_10100189 | Ga0105240_101001892 | 255 |
| 56 | 3300009098 | Ga0105245_10046076 | Ga0105245_100460762 | 255 |
| 57 | 3300009545 | Ga0105237_10001286 | Ga0105237_100012865 | 255 |
| 58 | 3300010375 | Ga0105239_10078807 | Ga0105239_100788074 | 255 |
| 59 | 3300021320 | Ga0214544_1000006 | Ga0214544_100000660 | 255 |
| 60 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002316 | 255 |
| 61 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002403 | 255 |
| 62 | 3300021327 | Ga0214543_1000017 | Ga0214543_10000177 | 255 |
| 63 | 3300025302 | Ga0207426_1003966 | Ga0207426_10039664 | 255 |
| 64 | 3300025911 | Ga0207654_10239056 | Ga0207654_102390562 | 255 |
| 65 | 3300025913 | Ga0207695_10000342 | Ga0207695_1000034232 | 255 |
| 66 | 3300026142 | Ga0207698_10539632 | Ga0207698_105396322 | 255 |
| 67 | 3300048905 | Ga0496102_0605780 | Ga0496102_0605780_57_911 | 255 |
| 68 | 3300048929 | Ga0496126_0073236 | Ga0496126_0073236_536_1384 | 255 |
| 69 | 3300053737 | Ga0500601_000138 | Ga0500601_000138_567_1418 | 255 |
| 70 | 3300003215 | JGI25153J46596_10003376 | JGI25153J46596_100033768 | 256 |
| 71 | 3300003794 | Ga0055531_10004515 | Ga0055531_100045159 | 256 |
| 72 | 3300005262 | Ga0065165_1007319 | Ga0065165_10073195 | 256 |
| 73 | 3300006942 | Ga0099824_1015940 | Ga0099824_10159407 | 256 |
| 74 | 3300010375 | Ga0105239_10361252 | Ga0105239_103612521 | 256 |
| 75 | 3300025254 | Ga0209148_1000803 | Ga0209148_100080319 | 256 |
| 76 | 3300025297 | Ga0209758_1000100 | Ga0209758_1000100242 | 256 |
| 77 | 3300025297 | Ga0209758_1040304 | Ga0209758_10403042 | 256 |
| 78 | 3300025304 | Ga0209257_1002068 | Ga0209257_10020683 | 256 |
| 79 | 3300044658 | Ga0466972_0000149 | Ga0466972_0000149_25123_25974 | 256 |
| 80 | 3300044658 | Ga0466972_0021294 | Ga0466972_0021294_1683_2534 | 256 |
| 81 | 3300044693 | Ga0466961_0000082 | Ga0466961_0000082_17022_17894 | 256 |
| 82 | 3300045049 | Ga0466959_0008370 | Ga0466959_0008370_5387_6259 | 256 |
| 83 | 3300048924 | Ga0496121_0018380 | Ga0496121_0018380_3813_4664 | 256 |
| 84 | 3300055283 | Ga0500661_001981 | Ga0500661_001981_1176_2030 | 256 |
| 85 | 3300003215 | JGI25153J46596_10008512 | JGI25153J46596_100085124 | 257 |
| 86 | 3300003354 | JGI25160J50197_1000905 | JGI25160J50197_10009054 | 257 |
| 87 | 3300025295 | Ga0209564_1024380 | Ga0209564_10243802 | 257 |
| 88 | 3300025297 | Ga0209758_1003244 | Ga0209758_10032442 | 257 |
| 89 | 3300025302 | Ga0207426_1000611 | Ga0207426_100061118 | 257 |
| 90 | 3300048928 | Ga0496125_0051656 | Ga0496125_0051656_808_1659 | 257 |
| 91 | 3300053177 | Ga0500636_0000116 | Ga0500636_0000116_569_1420 | 257 |
| 92 | 3300003215 | JGI25153J46596_10006961 | JGI25153J46596_100069613 | 258 |
| 93 | 3300005262 | Ga0065165_1001028 | Ga0065165_100102834 | 258 |
| 94 | 3300005327 | Ga0070658_10034773 | Ga0070658_100347733 | 258 |
| 95 | 3300005344 | Ga0070661_100082424 | Ga0070661_1000824243 | 258 |
| 96 | 3300005347 | Ga0070668_100043973 | Ga0070668_1000439734 | 258 |
| 97 | 3300005548 | Ga0070665_100118347 | Ga0070665_1001183473 | 258 |
| 98 | 3300010375 | Ga0105239_10037102 | Ga0105239_100371025 | 258 |
| 99 | 3300025230 | Ga0209563_101399 | Ga0209563_1013995 | 258 |
| 100 | 3300025253 | Ga0209677_106909 | Ga0209677_1069091 | 258 |
| 101 | 3300025261 | Ga0209233_1012089 | Ga0209233_10120892 | 258 |
| 102 | 3300025297 | Ga0209758_1017486 | Ga0209758_10174864 | 258 |
| 103 | 3300025297 | Ga0209758_1028045 | Ga0209758_10280451 | 258 |
| 104 | 3300025299 | Ga0209256_1004118 | Ga0209256_10041184 | 258 |
| 105 | 3300025920 | Ga0207649_10060007 | Ga0207649_100600073 | 258 |
| 106 | 3300025945 | Ga0207679_10142733 | Ga0207679_101427333 | 258 |
| 107 | 3300026067 | Ga0207678_10032622 | Ga0207678_100326223 | 258 |
| 108 | 3300026067 | Ga0207678_10071735 | Ga0207678_100717354 | 258 |
| 109 | 3300026142 | Ga0207698_10579948 | Ga0207698_105799481 | 258 |
| 110 | 3300033180 | Ga0307510_10004259 | Ga0307510_1000425911 | 258 |
| 111 | 3300044683 | Ga0466965_0110999 | Ga0466965_0110999_333_1184 | 258 |
| 112 | 3300044901 | Ga0466960_0070622 | Ga0466960_0070622_98_949 | 258 |
| 113 | 3300046460 | Ga0495638_0015765 | Ga0495638_0015765_2942_3796 | 258 |
| 114 | 3300046462 | Ga0495651_0030910 | Ga0495651_0030910_1187_2038 | 258 |
| 115 | 3300046475 | Ga0495639_0191249 | Ga0495639_0191249_37_888 | 258 |
| 116 | 3300046507 | Ga0495606_0060108 | Ga0495606_0060108_412_1266 | 258 |
| 117 | 3300046511 | Ga0495608_0106144 | Ga0495608_0106144_395_1246 | 258 |
| 118 | 3300046514 | Ga0495618_0166343 | Ga0495618_0166343_22_873 | 258 |
| 119 | 3300046516 | Ga0495628_0217081 | Ga0495628_0217081_196_1047 | 258 |
| 120 | 3300046529 | Ga0495652_0077014 | Ga0495652_0077014_1719_2570 | 258 |
| 121 | 3300046533 | Ga0495640_0032668 | Ga0495640_0032668_155_1006 | 258 |
| 122 | 3300046557 | Ga0495622_0003117 | Ga0495622_0003117_2517_3368 | 258 |
| 123 | 3300046642 | Ga0495634_0039222 | Ga0495634_0039222_743_1594 | 258 |
| 124 | 3300046663 | Ga0495635_0011468 | Ga0495635_0011468_3123_3974 | 258 |
| 125 | 3300046665 | Ga0495661_0123654 | Ga0495661_0123654_399_1253 | 258 |
| 126 | 3300046675 | Ga0495657_0012825 | Ga0495657_0012825_2492_3343 | 258 |
| 127 | 3300046675 | Ga0495657_0085710 | Ga0495657_0085710_817_1668 | 258 |
| 128 | 3300046678 | Ga0495599_0022941 | Ga0495599_0022941_549_1400 | 258 |
| 129 | 3300046680 | Ga0495646_0055419 | Ga0495646_0055419_1102_1956 | 258 |
| 130 | 3300046680 | Ga0495646_0160004 | Ga0495646_0160004_220_1071 | 258 |
| 131 | 3300046689 | Ga0495613_0012353 | Ga0495613_0012353_4272_5123 | 258 |
| 132 | 3300046690 | Ga0495624_0014677 | Ga0495624_0014677_2296_3147 | 258 |
| 133 | 3300047315 | Ga0495581_0049648 | Ga0495581_0049648_548_1399 | 258 |
| 134 | 3300047317 | Ga0495604_0006257 | Ga0495604_0006257_1615_2466 | 258 |
| 135 | 3300047322 | Ga0495680_0013688 | Ga0495680_0013688_1513_2364 | 258 |
| 136 | 3300047444 | Ga0495675_0162222 | Ga0495675_0162222_146_997 | 258 |
| 137 | 3300048914 | Ga0496111_0131522 | Ga0496111_0131522_65_919 | 258 |
| 138 | 3300048915 | Ga0496112_0495526 | Ga0496112_0495526_269_1120 | 258 |
| 139 | 3300048924 | Ga0496121_0017785 | Ga0496121_0017785_4803_5654 | 258 |
| 140 | 3300048924 | Ga0496121_0175284 | Ga0496121_0175284_155_1006 | 258 |
| 141 | 3300050492 | nmdc:mga0yw44_54122_c1 | nmdc:mga0yw44_54122_c1_1514_2368 | 258 |
| 142 | 3300053086 | Ga0500578_0049034 | Ga0500578_0049034_1324_2178 | 258 |
| 143 | 3300053087 | Ga0500643_000114 | Ga0500643_000114_66691_67545 | 258 |
| 144 | 3300053092 | Ga0500583_0073461 | Ga0500583_0073461_677_1531 | 258 |
| 145 | 3300053098 | Ga0500650_0022553 | Ga0500650_0022553_688_1542 | 258 |
| 146 | 3300053103 | Ga0500555_000656 | Ga0500555_000656_12160_13014 | 258 |
| 147 | 3300053104 | Ga0500556_0064835 | Ga0500556_0064835_439_1293 | 258 |
| 148 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_199202_200056 | 258 |
| 149 | 3300053108 | Ga0500562_004278 | Ga0500562_004278_1485_2339 | 258 |
| 150 | 3300053109 | Ga0500569_021445 | Ga0500569_021445_212_1063 | 258 |
| 151 | 3300053130 | Ga0500642_0007341 | Ga0500642_0007341_1205_2059 | 258 |
| 152 | 3300053136 | Ga0500559_0077973 | Ga0500559_0077973_168_1019 | 258 |
| 153 | 3300053148 | Ga0500590_098152 | Ga0500590_098152_462_1313 | 258 |
| 154 | 3300053151 | Ga0500604_0005443 | Ga0500604_0005443_376_1230 | 258 |
| 155 | 3300053162 | Ga0500638_027784 | Ga0500638_027784_455_1306 | 258 |
| 156 | 3300053736 | Ga0500599_000199 | Ga0500599_000199_3185_4039 | 258 |
| 157 | 3300021320 | Ga0214544_1024721 | Ga0214544_10247213 | 259 |
| 158 | 3300021321 | Ga0214542_1025576 | Ga0214542_10255763 | 259 |
| 159 | 3300021324 | Ga0214545_1014661 | Ga0214545_10146614 | 259 |
| 160 | 3300021327 | Ga0214543_1015282 | Ga0214543_10152828 | 259 |
| 161 | 3300031241 | Ga0265325_10147802 | Ga0265325_101478022 | 259 |
| 162 | 3300031250 | Ga0265331_10082265 | Ga0265331_100822652 | 259 |
| 163 | 3300046511 | Ga0495608_0024114 | Ga0495608_0024114_2100_2951 | 259 |
| 164 | 3300046524 | Ga0495648_0002337 | Ga0495648_0002337_896_1750 | 259 |
| 165 | 3300009174 | Ga0105241_10017103 | Ga0105241_100171036 | 260 |
| 166 | 3300021361 | Ga0213872_10028780 | Ga0213872_100287802 | 260 |
| 167 | 3300053119 | Ga0500595_013877 | Ga0500595_013877_1252_2106 | 260 |
| 168 | 3300005356 | Ga0070674_100078654 | Ga0070674_1000786543 | 261 |
| 169 | 3300005367 | Ga0070667_100083036 | Ga0070667_1000830362 | 261 |
| 170 | 3300005458 | Ga0070681_10458902 | Ga0070681_104589021 | 261 |
| 171 | 3300005459 | Ga0068867_100057924 | Ga0068867_1000579243 | 261 |
| 172 | 3300005530 | Ga0070679_100381448 | Ga0070679_1003814482 | 261 |
| 173 | 3300005548 | Ga0070665_100187103 | Ga0070665_1001871032 | 261 |
| 174 | 3300005615 | Ga0070702_100036568 | Ga0070702_1000365684 | 261 |
| 175 | 3300005718 | Ga0068866_10009098 | Ga0068866_100090983 | 261 |
| 176 | 3300005719 | Ga0068861_100108112 | Ga0068861_1001081122 | 261 |
| 177 | 3300006881 | Ga0068865_100127894 | Ga0068865_1001278942 | 261 |
| 178 | 3300013297 | Ga0157378_10117046 | Ga0157378_101170462 | 261 |
| 179 | 3300013308 | Ga0157375_10115950 | Ga0157375_101159502 | 261 |
| 180 | 3300025927 | Ga0207687_10204035 | Ga0207687_102040351 | 261 |
| 181 | 3300025935 | Ga0207709_10042880 | Ga0207709_100428802 | 261 |
| 182 | 3300025937 | Ga0207669_10025136 | Ga0207669_100251362 | 261 |
| 183 | 3300025940 | Ga0207691_10195025 | Ga0207691_101950252 | 261 |
| 184 | 3300025941 | Ga0207711_10109061 | Ga0207711_101090612 | 261 |
| 185 | 3300025942 | Ga0207689_10422718 | Ga0207689_104227181 | 261 |
| 186 | 3300025961 | Ga0207712_10088257 | Ga0207712_100882573 | 261 |
| 187 | 3300025986 | Ga0207658_10166343 | Ga0207658_101663432 | 261 |
| 188 | 3300026023 | Ga0207677_10183437 | Ga0207677_101834373 | 261 |
| 189 | 3300026067 | Ga0207678_10139735 | Ga0207678_101397352 | 261 |
| 190 | 3300026075 | Ga0207708_10031505 | Ga0207708_100315054 | 261 |
| 191 | 3300026089 | Ga0207648_10006225 | Ga0207648_100062255 | 261 |
| 192 | 3300026118 | Ga0207675_100227369 | Ga0207675_1002273692 | 261 |
| 193 | 3300026121 | Ga0207683_10018785 | Ga0207683_100187854 | 261 |
| 194 | 3300028379 | Ga0268266_10068682 | Ga0268266_100686822 | 261 |
| 195 | 3300046684 | Ga0495669_0008461 | Ga0495669_0008461_2379_3236 | 261 |
| 196 | 3300047320 | Ga0495672_0019815 | Ga0495672_0019815_231_1088 | 261 |
| 197 | 3300048909 | Ga0496106_0142306 | Ga0496106_0142306_79_1008 | 261 |
| 198 | 3300048917 | Ga0496114_0414595 | Ga0496114_0414595_304_1158 | 261 |
| 199 | 3300048929 | Ga0496126_0389147 | Ga0496126_0389147_102_959 | 261 |
| 200 | 3300005330 | Ga0070690_100088734 | Ga0070690_1000887342 | 262 |
| 201 | 3300005355 | Ga0070671_100576015 | Ga0070671_1005760151 | 262 |
| 202 | 3300005456 | Ga0070678_100177730 | Ga0070678_1001777302 | 262 |
| 203 | 3300005616 | Ga0068852_100247985 | Ga0068852_1002479852 | 262 |
| 204 | 3300005842 | Ga0068858_100172896 | Ga0068858_1001728963 | 262 |
| 205 | 3300006881 | Ga0068865_100278141 | Ga0068865_1002781412 | 262 |
| 206 | 3300009177 | Ga0105248_10020793 | Ga0105248_100207935 | 262 |
| 207 | 3300009545 | Ga0105237_10181614 | Ga0105237_101816143 | 262 |
| 208 | 3300010375 | Ga0105239_10071160 | Ga0105239_100711603 | 262 |
| 209 | 3300013306 | Ga0163162_10033761 | Ga0163162_100337612 | 262 |
| 210 | 3300013306 | Ga0163162_10208206 | Ga0163162_102082062 | 262 |
| 211 | 3300013308 | Ga0157375_10046937 | Ga0157375_100469372 | 262 |
| 212 | 3300014325 | Ga0163163_10228158 | Ga0163163_102281582 | 262 |
| 213 | 3300014968 | Ga0157379_10064141 | Ga0157379_100641414 | 262 |
| 214 | 3300025914 | Ga0207671_10177156 | Ga0207671_101771563 | 262 |
| 215 | 3300025986 | Ga0207658_10249368 | Ga0207658_102493682 | 262 |
| 216 | 3300026035 | Ga0207703_10120003 | Ga0207703_101200033 | 262 |
| 217 | 3300026121 | Ga0207683_10105956 | Ga0207683_101059563 | 262 |
| 218 | 3300028786 | Ga0307517_10000125 | Ga0307517_10000125129 | 262 |
| 219 | 3300028794 | Ga0307515_10049435 | Ga0307515_100494351 | 262 |
| 220 | 3300035170 | Ga0373943_0149158 | Ga0373943_0149158_40_894 | 262 |
| 221 | 3300035691 | Ga0373931_0048659 | Ga0373931_0048659_90_944 | 262 |
| 222 | 3300035695 | Ga0373927_0019200 | Ga0373927_0019200_2200_3054 | 262 |
| 223 | 3300035695 | Ga0373927_0031030 | Ga0373927_0031030_301_1155 | 262 |
| 224 | 3300037471 | Ga0395905_0014881 | Ga0395905_0014881_1512_2366 | 262 |
| 225 | 3300046473 | Ga0495582_0028770 | Ga0495582_0028770_1428_2282 | 262 |
| 226 | 3300046531 | Ga0495665_0184999 | Ga0495665_0184999_56_928 | 262 |
| 227 | 3300046559 | Ga0495667_0280950 | Ga0495667_0280950_125_997 | 262 |
| 228 | 3300046615 | Ga0495656_0214588 | Ga0495656_0214588_40_918 | 262 |
| 229 | 3300046664 | Ga0495659_0004030 | Ga0495659_0004030_48_923 | 262 |
| 230 | 3300046683 | Ga0495658_0096917 | Ga0495658_0096917_123_977 | 262 |
| 231 | 3300046684 | Ga0495669_0186648 | Ga0495669_0186648_90_962 | 262 |
| 232 | 3300048904 | Ga0496101_0060355 | Ga0496101_0060355_1641_2495 | 262 |
| 233 | 3300048905 | Ga0496102_0075086 | Ga0496102_0075086_1466_2320 | 262 |
| 234 | 3300048906 | Ga0496103_0029282 | Ga0496103_0029282_1210_2088 | 262 |
| 235 | 3300048907 | Ga0496104_0113178 | Ga0496104_0113178_1161_2015 | 262 |
| 236 | 3300048908 | Ga0496105_0209449 | Ga0496105_0209449_676_1530 | 262 |
| 237 | 3300048910 | Ga0496107_0003405 | Ga0496107_0003405_6525_7403 | 262 |
| 238 | 3300048911 | Ga0496108_0131295 | Ga0496108_0131295_599_1453 | 262 |
| 239 | 3300048912 | Ga0496109_0015451 | Ga0496109_0015451_5256_6110 | 262 |
| 240 | 3300048913 | Ga0496110_0109361 | Ga0496110_0109361_1548_2402 | 262 |
| 241 | 3300048914 | Ga0496111_0081144 | Ga0496111_0081144_898_1752 | 262 |
| 242 | 3300048915 | Ga0496112_0004436 | Ga0496112_0004436_1992_2846 | 262 |
| 243 | 3300048916 | Ga0496113_0007091 | Ga0496113_0007091_5303_6157 | 262 |
| 244 | 3300048916 | Ga0496113_0264034 | Ga0496113_0264034_313_1191 | 262 |
| 245 | 3300048917 | Ga0496114_0007466 | Ga0496114_0007466_1161_2015 | 262 |
| 246 | 3300048918 | Ga0496115_0022644 | Ga0496115_0022644_554_1432 | 262 |
| 247 | 3300053085 | Ga0495619_0029280 | Ga0495619_0029280_2363_3217 | 262 |
| 248 | 3300053119 | Ga0500595_001592 | Ga0500595_001592_4027_4878 | 262 |
| 249 | 3300053130 | Ga0500642_0006266 | Ga0500642_0006266_183_1034 | 262 |
| 250 | 3300005334 | Ga0068869_100330321 | Ga0068869_1003303211 | 263 |
| 251 | 3300005456 | Ga0070678_100027050 | Ga0070678_1000270504 | 263 |
| 252 | 3300005457 | Ga0070662_100067123 | Ga0070662_1000671232 | 263 |
| 253 | 3300005544 | Ga0070686_100277052 | Ga0070686_1002770521 | 263 |
| 254 | 3300005842 | Ga0068858_100441824 | Ga0068858_1004418241 | 263 |
| 255 | 3300009176 | Ga0105242_10018046 | Ga0105242_100180465 | 263 |
| 256 | 3300013306 | Ga0163162_10063332 | Ga0163162_100633322 | 263 |
| 257 | 3300021320 | Ga0214544_1026300 | Ga0214544_10263002 | 263 |
| 258 | 3300021321 | Ga0214542_1027390 | Ga0214542_10273903 | 263 |
| 259 | 3300025933 | Ga0207706_10064171 | Ga0207706_100641712 | 263 |
| 260 | 3300025936 | Ga0207670_10178969 | Ga0207670_101789692 | 263 |
| 261 | 3300026035 | Ga0207703_10203043 | Ga0207703_102030432 | 263 |
| 262 | 3300048903 | Ga0496100_0183680 | Ga0496100_0183680_99_953 | 263 |
| 263 | 3300048925 | Ga0496122_0128252 | Ga0496122_0128252_467_1318 | 263 |
| 264 | 3300049569 | Ga0501032_0000188 | Ga0501032_0000188_17453_18343 | 263 |
| 265 | 3300049570 | Ga0501033_0000094 | Ga0501033_0000094_7545_8435 | 263 |
| 266 | 3300049571 | Ga0501034_0000021 | Ga0501034_0000021_76352_77242 | 263 |
| 267 | 3300049572 | Ga0501036_0000697 | Ga0501036_0000697_4054_4944 | 263 |
| 268 | 3300049573 | Ga0501037_0000174 | Ga0501037_0000174_44077_44967 | 263 |
| 269 | 3300049574 | Ga0501038_0000052 | Ga0501038_0000052_76362_77252 | 263 |
| 270 | 3300049575 | Ga0501039_0000156 | Ga0501039_0000156_4428_5318 | 263 |
| 271 | 3300049579 | Ga0501043_0004414 | Ga0501043_0004414_6771_7661 | 263 |
| 272 | 3300049580 | Ga0501046_0000133 | Ga0501046_0000133_58069_58959 | 263 |
| 273 | 3300049581 | Ga0501047_0000511 | Ga0501047_0000511_23718_24608 | 263 |
| 274 | 3300049582 | Ga0501048_0000072 | Ga0501048_0000072_47216_48106 | 263 |
| 275 | 3300049583 | Ga0501067_0000045 | Ga0501067_0000045_66444_67334 | 263 |
| 276 | 3300049584 | Ga0501068_0008493 | Ga0501068_0008493_546_1436 | 263 |
| 277 | 3300049585 | Ga0501069_0003931 | Ga0501069_0003931_5050_5940 | 263 |
| 278 | 3300049586 | Ga0501070_0039640 | Ga0501070_0039640_2257_3147 | 263 |
| 279 | 3300049588 | Ga0501072_0008854 | Ga0501072_0008854_791_1681 | 263 |
| 280 | 3300049589 | Ga0501073_0000099 | Ga0501073_0000099_51047_51937 | 263 |
| 281 | 3300049590 | Ga0501074_0001112 | Ga0501074_0001112_8919_9809 | 263 |
| 282 | 3300049741 | Ga0501079_0005428 | Ga0501079_0005428_2534_3424 | 263 |
| 283 | 3300049742 | Ga0501080_0006892 | Ga0501080_0006892_5672_6562 | 263 |
| 284 | 3300049744 | Ga0501083_0001322 | Ga0501083_0001322_852_1742 | 263 |
| 285 | 3300049822 | Ga0501035_0002501 | Ga0501035_0002501_13646_14536 | 263 |
| 286 | 3300049823 | Ga0501044_0000141 | Ga0501044_0000141_67841_68731 | 263 |
| 287 | 3300049824 | Ga0501045_0003694 | Ga0501045_0003694_3944_4834 | 263 |
| 288 | 3300054114 | Ga0501084_0006916 | Ga0501084_0006916_6129_7019 | 263 |
| 289 | 3300060353 | Ga0501082_0002578 | Ga0501082_0002578_5824_6714 | 263 |
| 290 | 3300005337 | Ga0070682_100028792 | Ga0070682_1000287925 | 264 |
| 291 | 3300005338 | Ga0068868_100238346 | Ga0068868_1002383462 | 264 |
| 292 | 3300005455 | Ga0070663_100163602 | Ga0070663_1001636022 | 264 |
| 293 | 3300005578 | Ga0068854_100457000 | Ga0068854_1004570002 | 264 |
| 294 | 3300005618 | Ga0068864_100174430 | Ga0068864_1001744302 | 264 |
| 295 | 3300009177 | Ga0105248_10451111 | Ga0105248_104511112 | 264 |
| 296 | 3300013104 | Ga0157370_10093335 | Ga0157370_100933351 | 264 |
| 297 | 3300014968 | Ga0157379_10273599 | Ga0157379_102735991 | 264 |
| 298 | 3300014969 | Ga0157376_10077055 | Ga0157376_100770553 | 264 |
| 299 | 3300025927 | Ga0207687_10003408 | Ga0207687_100034087 | 264 |
| 300 | 3300026023 | Ga0207677_10020731 | Ga0207677_100207315 | 264 |
| 301 | 3300026067 | Ga0207678_10008126 | Ga0207678_100081264 | 264 |
| 302 | 3300046507 | Ga0495606_0265754 | Ga0495606_0265754_68_922 | 264 |
| 303 | 3300048904 | Ga0496101_0073889 | Ga0496101_0073889_1238_2116 | 264 |
| 304 | 3300048907 | Ga0496104_0154916 | Ga0496104_0154916_486_1364 | 264 |
| 305 | 3300048908 | Ga0496105_0038559 | Ga0496105_0038559_375_1253 | 264 |
| 306 | 3300048909 | Ga0496106_0050008 | Ga0496106_0050008_2227_3105 | 264 |
| 307 | 3300048911 | Ga0496108_0041121 | Ga0496108_0041121_2515_3393 | 264 |
| 308 | 3300048912 | Ga0496109_0007428 | Ga0496109_0007428_5159_6037 | 264 |
| 309 | 3300048913 | Ga0496110_0005590 | Ga0496110_0005590_8831_9709 | 264 |
| 310 | 3300048914 | Ga0496111_0159367 | Ga0496111_0159367_161_1039 | 264 |
| 311 | 3300048915 | Ga0496112_0204021 | Ga0496112_0204021_295_1173 | 264 |
| 312 | 3300003659 | JGI25404J52841_10002894 | JGI25404J52841_100028942 | 266 |
| 313 | 3300005983 | Ga0081540_1005400 | Ga0081540_10054006 | 266 |
| 314 | 3300005983 | Ga0081540_1014532 | Ga0081540_10145326 | 266 |
| 315 | 3300005983 | Ga0081540_1023099 | Ga0081540_10230994 | 266 |
| 316 | 3300037418 | Ga0395900_0000601 | Ga0395900_0000601_41062_41916 | 266 |
| 317 | 3300037466 | Ga0395898_0010480 | Ga0395898_0010480_3467_4321 | 266 |
| 318 | 3300037471 | Ga0395905_0522626 | Ga0395905_0522626_108_962 | 266 |
| 319 | 3300038443 | Ga0395901_0154042 | Ga0395901_0154042_568_1422 | 266 |
| 320 | 3300005439 | Ga0070711_100036328 | Ga0070711_1000363283 | 267 |
| 321 | 3300025916 | Ga0207663_10017284 | Ga0207663_100172844 | 267 |
| 322 | 3300048904 | Ga0496101_0074817 | Ga0496101_0074817_830_1681 | 267 |
| 323 | 3300046452 | Ga0495617_024234 | Ga0495617_024234_800_1648 | 271 |
| 324 | 3300047318 | Ga0495636_0025902 | Ga0495636_0025902_281_1129 | 271 |
| 325 | 3300005937 | Ga0081455_10024950 | Ga0081455_100249503 | 272 |
| 326 | 3300031344 | Ga0265316_10158531 | Ga0265316_101585313 | 272 |
| 327 | 3300003659 | JGI25404J52841_10003223 | JGI25404J52841_100032235 | 273 |
| 328 | 3300005983 | Ga0081540_1001804 | Ga0081540_100180413 | 273 |
| 329 | 3300005331 | Ga0070670_100470625 | Ga0070670_1004706251 | 274 |
| 330 | 3300005347 | Ga0070668_100316959 | Ga0070668_1003169592 | 274 |
| 331 | 3300005355 | Ga0070671_100162390 | Ga0070671_1001623902 | 274 |
| 332 | 3300005367 | Ga0070667_100319097 | Ga0070667_1003190972 | 274 |
| 333 | 3300005548 | Ga0070665_100298797 | Ga0070665_1002987972 | 274 |
| 334 | 3300006038 | Ga0075365_10270007 | Ga0075365_102700072 | 274 |
| 335 | 3300006042 | Ga0075368_10011581 | Ga0075368_100115811 | 274 |
| 336 | 3300006051 | Ga0075364_10016062 | Ga0075364_100160623 | 274 |
| 337 | 3300006178 | Ga0075367_10058261 | Ga0075367_100582612 | 274 |
| 338 | 3300006186 | Ga0075369_10127811 | Ga0075369_101278111 | 274 |
| 339 | 3300006195 | Ga0075366_10066306 | Ga0075366_100663063 | 274 |
| 340 | 3300006353 | Ga0075370_10110496 | Ga0075370_101104962 | 274 |
| 341 | 3300009174 | Ga0105241_10244892 | Ga0105241_102448922 | 274 |
| 342 | 3300009177 | Ga0105248_10297604 | Ga0105248_102976042 | 274 |
| 343 | 3300009551 | Ga0105238_10294831 | Ga0105238_102948312 | 274 |
| 344 | 3300010375 | Ga0105239_10443703 | Ga0105239_104437032 | 274 |
| 345 | 3300014325 | Ga0163163_10423821 | Ga0163163_104238212 | 274 |
| 346 | 3300014745 | Ga0157377_10257589 | Ga0157377_102575892 | 274 |
| 347 | 3300025299 | Ga0209256_1017604 | Ga0209256_10176041 | 274 |
| 348 | 3300025304 | Ga0209257_1015471 | Ga0209257_10154712 | 274 |
| 349 | 3300025304 | Ga0209257_1067879 | Ga0209257_10678791 | 274 |
| 350 | 3300025901 | Ga0207688_10071945 | Ga0207688_100719451 | 274 |
| 351 | 3300025904 | Ga0207647_10001716 | Ga0207647_100017168 | 274 |
| 352 | 3300025911 | Ga0207654_10148107 | Ga0207654_101481072 | 274 |
| 353 | 3300025914 | Ga0207671_10204795 | Ga0207671_102047952 | 274 |
| 354 | 3300025924 | Ga0207694_10382544 | Ga0207694_103825441 | 274 |
| 355 | 3300025931 | Ga0207644_10033049 | Ga0207644_100330494 | 274 |
| 356 | 3300025933 | Ga0207706_10296568 | Ga0207706_102965682 | 274 |
| 357 | 3300025986 | Ga0207658_10440323 | Ga0207658_104403232 | 274 |
| 358 | 3300026067 | Ga0207678_10197066 | Ga0207678_101970662 | 274 |
| 359 | 3300028379 | Ga0268266_10618418 | Ga0268266_106184182 | 274 |
| 360 | 3300028380 | Ga0268265_10404340 | Ga0268265_104043402 | 274 |
| 361 | 3300046522 | Ga0495643_0057586 | Ga0495643_0057586_145_996 | 274 |
| 362 | 3300048905 | Ga0496102_0152038 | Ga0496102_0152038_930_1781 | 274 |
| 363 | 3300048906 | Ga0496103_0107781 | Ga0496103_0107781_145_996 | 274 |
| 364 | 3300048907 | Ga0496104_0034628 | Ga0496104_0034628_1786_2637 | 274 |
| 365 | 3300048908 | Ga0496105_0275695 | Ga0496105_0275695_317_1168 | 274 |
| 366 | 3300048913 | Ga0496110_0141131 | Ga0496110_0141131_191_1042 | 274 |
| 367 | 3300048916 | Ga0496113_0208700 | Ga0496113_0208700_42_893 | 274 |
| 368 | 3300048922 | Ga0496119_0034442 | Ga0496119_0034442_2300_3151 | 274 |
| 369 | 3300048923 | Ga0496120_0153303 | Ga0496120_0153303_252_1103 | 274 |
| 370 | 3300048928 | Ga0496125_0228482 | Ga0496125_0228482_299_1150 | 274 |
| 371 | 3300050493 | nmdc:mga0k408_72521_c1 | nmdc:mga0k408_72521_c1_804_1655 | 274 |
| 372 | 3300050494 | nmdc:mga06z11_11720_c1 | nmdc:mga06z11_11720_c1_2242_3093 | 274 |
| 373 | 3300050496 | nmdc:mga07m45_61055_c1 | nmdc:mga07m45_61055_c1_849_1700 | 274 |
| 374 | 3300050516 | nmdc:mga0sz30_26486_c1 | nmdc:mga0sz30_26486_c1_1269_2120 | 274 |
| 375 | 3300053730 | Ga0500645_024273 | Ga0500645_024273_129_980 | 274 |
| 376 | iso_pu_bacteria | 2537561587 | 2537875073 | 274 |
| 377 | iso_pu_bacteria | 2841846520 | 2841851427 | 274 |
| 378 | 3300005456 | Ga0070678_100045195 | Ga0070678_1000451952 | 275 |
| 379 | 3300025901 | Ga0207688_10115869 | Ga0207688_101158692 | 275 |
| 380 | 3300025940 | Ga0207691_10155260 | Ga0207691_101552603 | 275 |
| 381 | iso_pu_bacteria | 2600255279 | 2601611108 | 275 |
| 382 | iso_pu_bacteria | 2600255308 | 2601747881 | 275 |
| 383 | iso_pu_bacteria | 2643221582 | 2643921997 | 275 |
| 384 | iso_pu_bacteria | 8003570095 | 8003574622 | 275 |
| 385 | 3300050491 | nmdc:mga00v17_284523_c1 | nmdc:mga00v17_284523_c1_177_1061 | 276 |
| 386 | iso_pu_bacteria | 2881665667 | 2881672979 | 276 |
| 387 | iso_pu_bacteria | 2721755755 | 2723846036 | 277 |
| 388 | iso_pu_bacteria | 2842124991 | 2842130011 | 277 |
| 389 | iso_pu_bacteria | 2857531043 | 2857537230 | 277 |
| 390 | iso_pu_bacteria | 2881364244 | 2881366346 | 277 |
| 391 | iso_pu_bacteria | 2929138655 | 2929144227 | 277 |
| 392 | iso_pu_bacteria | 2841957949 | 2841962368 | 278 |
| 393 | iso_pu_bacteria | 2879110137 | 2879110682 | 278 |
| 394 | iso_pu_bacteria | 2889033259 | 2889040979 | 278 |
| 395 | iso_pu_bacteria | 2906626472 | 2906628156 | 278 |
| 396 | iso_pu_bacteria | 2922386360 | 2922392155 | 278 |
| 397 | iso_pu_bacteria | 2933594066 | 2933598216 | 278 |
| 398 | iso_pu_bacteria | 8006926726 | 8006931563 | 278 |
| 399 | iso_pu_bacteria | 8056673599 | 8056680591 | 278 |
| 400 | 3300006948 | Ga0099826_10000112 | Ga0099826_1000011211 | 279 |
| 401 | 3300027666 | Ga0209282_1002045 | Ga0209282_10020452 | 279 |
| 402 | 3300028573 | Ga0265334_10028087 | Ga0265334_100280872 | 279 |
| 403 | 3300031250 | Ga0265331_10009277 | Ga0265331_100092772 | 279 |
| 404 | iso_pu_bacteria | 2508501009 | 2508543666 | 279 |
| 405 | iso_pu_bacteria | 2508501042 | 2508698541 | 279 |
| 406 | iso_pu_bacteria | 2511231028 | 2511399618 | 279 |
| 407 | iso_pu_bacteria | 2513237092 | 2513628310 | 279 |
| 408 | iso_pu_bacteria | 2513237094 | 2513643818 | 279 |
| 409 | iso_pu_bacteria | 2513237095 | 2513646291 | 279 |
| 410 | iso_pu_bacteria | 2513237102 | 2513700311 | 279 |
| 411 | iso_pu_bacteria | 2513237104 | 2513721631 | 279 |
| 412 | iso_pu_bacteria | 2513237139 | 2513875367 | 279 |
| 413 | iso_pu_bacteria | 2513237161 | 2514016162 | 279 |
| 414 | iso_pu_bacteria | 2517093001 | 2517103650 | 279 |
| 415 | iso_pu_bacteria | 2528768022 | 2528856770 | 279 |
| 416 | iso_pu_bacteria | 2617270735 | 2617349153 | 279 |
| 417 | iso_pu_bacteria | 2617270741 | 2617378301 | 279 |
| 418 | iso_pu_bacteria | 2791355196 | 2793060390 | 279 |
| 419 | iso_pu_bacteria | 2802429603 | 2805921995 | 279 |
| 420 | iso_pu_bacteria | 2824600985 | 2824602236 | 279 |
| 421 | iso_pu_bacteria | 2824609381 | 2824610224 | 279 |
| 422 | iso_pu_bacteria | 2824617872 | 2824623563 | 279 |
| 423 | iso_pu_bacteria | 2824626560 | 2824630925 | 279 |
| 424 | iso_pu_bacteria | 2824635225 | 2824640051 | 279 |
| 425 | iso_pu_bacteria | 2824644064 | 2824647801 | 279 |
| 426 | iso_pu_bacteria | 2824661429 | 2824666947 | 279 |
| 427 | iso_pu_bacteria | 2824714736 | 2824717656 | 279 |
| 428 | iso_pu_bacteria | 2824723954 | 2824727837 | 279 |
| 429 | iso_pu_bacteria | 2824753945 | 2824758152 | 279 |
| 430 | iso_pu_bacteria | 2824763712 | 2824766618 | 279 |
| 431 | iso_pu_bacteria | 2838122688 | 2838128799 | 279 |
| 432 | iso_pu_bacteria | 2841941048 | 2841941105 | 279 |
| 433 | iso_pu_bacteria | 2841949485 | 2841957266 | 279 |
| 434 | iso_pu_bacteria | 2841966195 | 2841967259 | 279 |
| 435 | iso_pu_bacteria | 2841974524 | 2841979344 | 279 |
| 436 | iso_pu_bacteria | 2841983080 | 2841989820 | 279 |
| 437 | iso_pu_bacteria | 2842038055 | 2842040022 | 279 |
| 438 | iso_pu_bacteria | 2842045827 | 2842047033 | 279 |
| 439 | iso_pu_bacteria | 2844315083 | 2844318147 | 279 |
| 440 | iso_pu_bacteria | 2847939898 | 2847945533 | 279 |
| 441 | iso_pu_bacteria | 2849076700 | 2849080280 | 279 |
| 442 | iso_pu_bacteria | 2857509624 | 2857510354 | 279 |
| 443 | iso_pu_bacteria | 2874590934 | 2874595254 | 279 |
| 444 | iso_pu_bacteria | 2874612657 | 2874613203 | 279 |
| 445 | iso_pu_bacteria | 2874620515 | 2874620780 | 279 |
| 446 | iso_pu_bacteria | 2874628541 | 2874636520 | 279 |
| 447 | iso_pu_bacteria | 2874645413 | 2874651095 | 279 |
| 448 | iso_pu_bacteria | 2876761206 | 2876762567 | 279 |
| 449 | iso_pu_bacteria | 2876771140 | 2876775190 | 279 |
| 450 | iso_pu_bacteria | 2876818435 | 2876824005 | 279 |
| 451 | iso_pu_bacteria | 2879099564 | 2879109457 | 279 |
| 452 | iso_pu_bacteria | 2879127579 | 2879134782 | 279 |
| 453 | iso_pu_bacteria | 2879142872 | 2879149093 | 279 |
| 454 | iso_pu_bacteria | 2885366525 | 2885372933 | 279 |
| 455 | iso_pu_bacteria | 2885409591 | 2885416690 | 279 |
| 456 | iso_pu_bacteria | 2888378607 | 2888382953 | 279 |
| 457 | iso_pu_bacteria | 2888388044 | 2888394842 | 279 |
| 458 | iso_pu_bacteria | 2888419890 | 2888423418 | 279 |
| 459 | iso_pu_bacteria | 2903727486 | 2903734150 | 279 |
| 460 | iso_pu_bacteria | 2904666416 | 2904666865 | 279 |
| 461 | iso_pu_bacteria | 2904711408 | 2904716791 | 279 |
| 462 | iso_pu_bacteria | 2906602504 | 2906608405 | 279 |
| 463 | iso_pu_bacteria | 2908775508 | 2908779056 | 279 |
| 464 | iso_pu_bacteria | 2922393267 | 2922395356 | 279 |
| 465 | iso_pu_bacteria | 2929615660 | 2929615782 | 279 |
| 466 | iso_pu_bacteria | 2929624759 | 2929630395 | 279 |
| 467 | iso_pu_bacteria | 2932784394 | 2932792043 | 279 |
| 468 | iso_pu_bacteria | 2932794094 | 2932796226 | 279 |
| 469 | iso_pu_bacteria | 2932801729 | 2932804471 | 279 |
| 470 | iso_pu_bacteria | 2932809354 | 2932814090 | 279 |
| 471 | iso_pu_bacteria | 2932818245 | 2932819422 | 279 |
| 472 | iso_pu_bacteria | 2932828146 | 2932833869 | 279 |
| 473 | iso_pu_bacteria | 2933577622 | 2933578932 | 279 |
| 474 | iso_pu_bacteria | 2935608549 | 2935611494 | 279 |
| 475 | iso_pu_bacteria | 2935616580 | 2935618601 | 279 |
| 476 | iso_pu_bacteria | 2935638405 | 2935644556 | 279 |
| 477 | iso_pu_bacteria | 2935648319 | 2935648868 | 279 |
| 478 | iso_pu_bacteria | 2935656913 | 2935657050 | 279 |
| 479 | iso_pu_bacteria | 2935665750 | 2935673553 | 279 |
| 480 | iso_pu_bacteria | 2935675223 | 2935678440 | 279 |
| 481 | iso_pu_bacteria | 2935684952 | 2935688131 | 279 |
| 482 | iso_pu_bacteria | 2935694250 | 2935701331 | 279 |
| 483 | iso_pu_bacteria | 2935713505 | 2935715150 | 279 |
| 484 | iso_pu_bacteria | 2935722832 | 2935726285 | 279 |
| 485 | iso_pu_bacteria | 2935732158 | 2935733969 | 279 |
| 486 | iso_pu_bacteria | 2935741537 | 2935743348 | 279 |
| 487 | iso_pu_bacteria | 2935750917 | 2935754614 | 279 |
| 488 | iso_pu_bacteria | 2935760218 | 2935765393 | 279 |
| 489 | iso_pu_bacteria | 2935769743 | 2935776333 | 279 |
| 490 | iso_pu_bacteria | 2935777560 | 2935784145 | 279 |
| 491 | iso_pu_bacteria | 2935785616 | 2935790322 | 279 |
| 492 | iso_pu_bacteria | 2935793552 | 2935798905 | 279 |
| 493 | iso_pu_bacteria | 2935801545 | 2935805344 | 279 |
| 494 | iso_pu_bacteria | 2935810662 | 2935816642 | 279 |
| 495 | iso_pu_bacteria | 2935819856 | 2935820971 | 279 |
| 496 | iso_pu_bacteria | 2935827899 | 2935833695 | 279 |
| 497 | iso_pu_bacteria | 2935837841 | 2935839619 | 279 |
| 498 | iso_pu_bacteria | 2935847175 | 2935850769 | 279 |
| 499 | iso_pu_bacteria | 2935855204 | 2935856966 | 279 |
| 500 | iso_pu_bacteria | 2935883170 | 2935888872 | 279 |
| 501 | iso_pu_bacteria | 2935908558 | 2935913862 | 279 |
| 502 | iso_pu_bacteria | 2935916978 | 2935920148 | 279 |
| 503 | iso_pu_bacteria | 2935926038 | 2935930487 | 279 |
| 504 | iso_pu_bacteria | 2935934488 | 2935939540 | 279 |
| 505 | iso_pu_bacteria | 2935942939 | 2935946489 | 279 |
| 506 | iso_pu_bacteria | 2935951376 | 2935955672 | 279 |
| 507 | iso_pu_bacteria | 2935967501 | 2935972618 | 279 |
| 508 | iso_pu_bacteria | 2935975950 | 2935981559 | 279 |
| 509 | iso_pu_bacteria | 2935984226 | 2935989050 | 279 |
| 510 | iso_pu_bacteria | 2935992306 | 2935997746 | 279 |
| 511 | iso_pu_bacteria | 2936011229 | 2936011778 | 279 |
| 512 | iso_pu_bacteria | 2936019824 | 2936020373 | 279 |
| 513 | iso_pu_bacteria | 2936028420 | 2936029067 | 279 |
| 514 | iso_pu_bacteria | 2936037263 | 2936043096 | 279 |
| 515 | iso_pu_bacteria | 2936046547 | 2936047096 | 279 |
| 516 | iso_pu_bacteria | 2936055302 | 2936061327 | 279 |
| 517 | iso_pu_bacteria | 2940556831 | 2940560009 | 279 |
| 518 | iso_pu_bacteria | 2941531003 | 2941535956 | 279 |
| 519 | iso_pu_bacteria | 2941538514 | 2941540308 | 279 |
| 520 | iso_pu_bacteria | 3005506211 | 3005507844 | 279 |
| 521 | iso_pu_bacteria | 3005710791 | 3005713856 | 279 |
| 522 | iso_pu_bacteria | 3005718088 | 3005721377 | 279 |
| 523 | iso_pu_bacteria | 8016522445 | 8016530660 | 279 |
| 524 | iso_pu_bacteria | 8016530956 | 8016535944 | 279 |
| 525 | iso_pu_bacteria | 8016539877 | 8016540225 | 279 |
| 526 | iso_pu_bacteria | 8016548790 | 8016553009 | 279 |
| 527 | iso_pu_bacteria | 8016566248 | 8016574290 | 279 |
| 528 | iso_pu_bacteria | 8016575299 | 8016578390 | 279 |
| 529 | iso_pu_bacteria | 8016603502 | 8016611805 | 279 |
| 530 | iso_pu_bacteria | 8016613128 | 8016622001 | 279 |
| 531 | iso_pu_bacteria | 8016630954 | 8016632172 | 279 |
| 532 | iso_pu_bacteria | 8017057580 | 8017061866 | 279 |
| 533 | iso_pu_bacteria | 8019538911 | 8019543812 | 279 |
| 534 | iso_pu_bacteria | 8019547302 | 8019554966 | 279 |
| 535 | iso_pu_bacteria | 8019576017 | 8019581398 | 279 |
| 536 | iso_pu_bacteria | 8019586578 | 8019589025 | 279 |
| 537 | iso_pu_bacteria | 8019597564 | 8019602209 | 279 |
| 538 | iso_pu_bacteria | 8019629233 | 8019635544 | 279 |
| 539 | iso_pu_bacteria | 8019638758 | 8019644160 | 279 |
| 540 | iso_pu_bacteria | 8019648815 | 8019657149 | 279 |
| 541 | iso_pu_bacteria | 8019659431 | 8019663348 | 279 |
| 542 | iso_pu_bacteria | 8019668869 | 8019672967 | 279 |
| 543 | iso_pu_bacteria | 8019678201 | 8019683175 | 279 |
| 544 | iso_pu_bacteria | 8019687851 | 8019688881 | 279 |
| 545 | iso_pu_bacteria | 8055742211 | 8055747429 | 279 |
| 546 | iso_pu_bacteria | 8056967851 | 8056972497 | 279 |
| 547 | 3300046558 | Ga0495633_0013768 | Ga0495633_0013768_1829_2680 | 280 |
| 548 | 3300048919 | Ga0496116_0134649 | Ga0496116_0134649_440_1291 | 280 |
| 549 | 3300048920 | Ga0496117_0085969 | Ga0496117_0085969_931_1782 | 280 |
| 550 | 3300048921 | Ga0496118_0082386 | Ga0496118_0082386_497_1348 | 280 |
| 551 | 3300053107 | Ga0500560_007338 | Ga0500560_007338_871_1722 | 280 |
| 552 | 3300053157 | Ga0500624_000198 | Ga0500624_000198_1477_2328 | 280 |
| 553 | 3300053161 | Ga0500634_0009431 | Ga0500634_0009431_1403_2254 | 280 |
| 554 | iso_pu_bacteria | 2838675328 | 2838679104 | 280 |
| 555 | iso_pu_bacteria | 2838714209 | 2838718058 | 280 |
| 556 | iso_pu_bacteria | 2838719591 | 2838723403 | 280 |
| 557 | iso_pu_bacteria | 2838724970 | 2838728772 | 280 |
| 558 | iso_pu_bacteria | 2841859092 | 2841863510 | 280 |
| 559 | iso_pu_bacteria | 2842130223 | 2842133745 | 280 |
| 560 | iso_pu_bacteria | 2842152218 | 2842155991 | 280 |
| 561 | iso_pu_bacteria | 2842170452 | 2842174303 | 280 |
| 562 | iso_pu_bacteria | 2842175837 | 2842179359 | 280 |
| 563 | iso_pu_bacteria | 2842187318 | 2842190879 | 280 |
| 564 | iso_pu_bacteria | 2842211629 | 2842215194 | 280 |
| 565 | iso_pu_bacteria | 2842224351 | 2842228167 | 280 |
| 566 | iso_pu_bacteria | 2842515876 | 2842520293 | 280 |
| 567 | iso_pu_bacteria | 2899792073 | 2899793855 | 280 |
| 568 | iso_pu_bacteria | 2919114240 | 2919118288 | 280 |
| 569 | iso_pu_bacteria | 2926754445 | 2926758052 | 280 |
| 570 | iso_pu_bacteria | 2933006813 | 2933011016 | 280 |
| 571 | iso_pu_bacteria | 2933011516 | 2933015985 | 280 |
| 572 | 3300006186 | Ga0075369_10034742 | Ga0075369_100347422 | 281 |
| 573 | 3300006186 | Ga0075369_10042410 | Ga0075369_100424101 | 281 |
| 574 | 3300027312 | Ga0209371_1002460 | Ga0209371_10024606 | 281 |
| 575 | 3300030500 | Ga0268256_1003711 | Ga0268256_10037112 | 281 |
| 576 | 3300048919 | Ga0496116_0041959 | Ga0496116_0041959_1518_2372 | 281 |
| 577 | 3300048919 | Ga0496116_0061434 | Ga0496116_0061434_250_1104 | 281 |
| 578 | 3300048920 | Ga0496117_0016084 | Ga0496117_0016084_2934_3788 | 281 |
| 579 | 3300048923 | Ga0496120_0021066 | Ga0496120_0021066_2969_3823 | 281 |
| 580 | 3300048923 | Ga0496120_0067249 | Ga0496120_0067249_69_923 | 281 |
| 581 | 3300048925 | Ga0496122_0095566 | Ga0496122_0095566_510_1364 | 281 |
| 582 | 3300048925 | Ga0496122_0109703 | Ga0496122_0109703_157_1011 | 281 |
| 583 | 3300048926 | Ga0496123_0051406 | Ga0496123_0051406_1519_2373 | 281 |
| 584 | 3300048927 | Ga0496124_0030083 | Ga0496124_0030083_1511_2365 | 281 |
| 585 | 3300048927 | Ga0496124_0155381 | Ga0496124_0155381_365_1219 | 281 |
| 586 | 3300048927 | Ga0496124_0247051 | Ga0496124_0247051_104_958 | 281 |
| 587 | 3300048928 | Ga0496125_0000152 | Ga0496125_0000152_55611_56465 | 281 |
| 588 | 3300048929 | Ga0496126_0148564 | Ga0496126_0148564_125_979 | 281 |
| 589 | 3300050491 | nmdc:mga00v17_19791_c1 | nmdc:mga00v17_19791_c1_19_873 | 281 |
| 590 | 3300003856 | Ga0058692_1001780 | Ga0058692_10017805 | 282 |
| 591 | 3300005334 | Ga0068869_100208365 | Ga0068869_1002083652 | 282 |
| 592 | 3300005336 | Ga0070680_100021933 | Ga0070680_1000219334 | 282 |
| 593 | 3300005353 | Ga0070669_100073111 | Ga0070669_1000731112 | 282 |
| 594 | 3300005458 | Ga0070681_10031595 | Ga0070681_100315953 | 282 |
| 595 | 3300005530 | Ga0070679_100039899 | Ga0070679_1000398993 | 282 |
| 596 | 3300005548 | Ga0070665_100001701 | Ga0070665_10000170119 | 282 |
| 597 | 3300005563 | Ga0068855_100007283 | Ga0068855_1000072835 | 282 |
| 598 | 3300005614 | Ga0068856_100230154 | Ga0068856_1002301542 | 282 |
| 599 | 3300005843 | Ga0068860_100209491 | Ga0068860_1002094912 | 282 |
| 600 | 3300005844 | Ga0068862_100289654 | Ga0068862_1002896542 | 282 |
| 601 | 3300005983 | Ga0081540_1002740 | Ga0081540_10027406 | 282 |
| 602 | 3300006048 | Ga0075363_100019050 | Ga0075363_1000190506 | 282 |
| 603 | 3300006353 | Ga0075370_10029883 | Ga0075370_100298834 | 282 |
| 604 | 3300009094 | Ga0111539_10665928 | Ga0111539_106659282 | 282 |
| 605 | 3300013104 | Ga0157370_10130206 | Ga0157370_101302063 | 282 |
| 606 | 3300025912 | Ga0207707_10013378 | Ga0207707_100133784 | 282 |
| 607 | 3300025921 | Ga0207652_10040794 | Ga0207652_100407943 | 282 |
| 608 | 3300025942 | Ga0207689_10027549 | Ga0207689_100275492 | 282 |
| 609 | 3300025942 | Ga0207689_10105820 | Ga0207689_101058202 | 282 |
| 610 | 3300026067 | Ga0207678_10004710 | Ga0207678_100047106 | 282 |
| 611 | 3300026078 | Ga0207702_10176424 | Ga0207702_101764242 | 282 |
| 612 | 3300026089 | Ga0207648_10172158 | Ga0207648_101721582 | 282 |
| 613 | 3300028379 | Ga0268266_10002227 | Ga0268266_100022277 | 282 |
| 614 | 3300028380 | Ga0268265_10494238 | Ga0268265_104942381 | 282 |
| 615 | 3300028381 | Ga0268264_10350275 | Ga0268264_103502752 | 282 |
| 616 | 3300031616 | Ga0307508_10083434 | Ga0307508_100834341 | 282 |
| 617 | 3300031995 | Ga0307409_100530039 | Ga0307409_1005300391 | 282 |
| 618 | 3300035113 | Ga0373936_0004786 | Ga0373936_0004786_3515_4369 | 282 |
| 619 | 3300035695 | Ga0373927_0014344 | Ga0373927_0014344_1715_2566 | 282 |
| 620 | 3300037068 | Ga0373925_0133808 | Ga0373925_0133808_692_1543 | 282 |
| 621 | 3300046472 | Ga0495580_0283958 | Ga0495580_0283958_175_1026 | 282 |
| 622 | 3300048907 | Ga0496104_0166725 | Ga0496104_0166725_727_1581 | 282 |
| 623 | 3300050490 | nmdc:mga03n38_1783_c1 | nmdc:mga03n38_1783_c1_3854_4708 | 282 |
| 624 | 3300050494 | nmdc:mga06z11_8088_c1 | nmdc:mga06z11_8088_c1_1028_1882 | 282 |
| 625 | 3300050511 | nmdc:mga08y16_551449_c1 | nmdc:mga08y16_551449_c1_220_1074 | 282 |
| 626 | 3300050516 | nmdc:mga0sz30_76625_c1 | nmdc:mga0sz30_76625_c1_333_1190 | 282 |
| 627 | 3300050516 | nmdc:mga0sz30_87533_c1 | nmdc:mga0sz30_87533_c1_55_912 | 282 |
| 628 | 3300053162 | Ga0500638_001951 | Ga0500638_001951_6035_6886 | 282 |
| 629 | 3300003215 | JGI25153J46596_10000736 | JGI25153J46596_1000073623 | 283 |
| 630 | 3300005834 | Ga0068851_10037343 | Ga0068851_100373434 | 283 |
| 631 | 3300005842 | Ga0068858_100043318 | Ga0068858_1000433185 | 283 |
| 632 | 3300009093 | Ga0105240_10014358 | Ga0105240_100143588 | 283 |
| 633 | 3300009101 | Ga0105247_10013642 | Ga0105247_100136424 | 283 |
| 634 | 3300013297 | Ga0157378_10187660 | Ga0157378_101876602 | 283 |
| 635 | 3300025297 | Ga0209758_1000164 | Ga0209758_100016461 | 283 |
| 636 | 3300025949 | Ga0207667_10119577 | Ga0207667_101195773 | 283 |
| 637 | 3300028558 | Ga0265326_10013527 | Ga0265326_100135271 | 283 |
| 638 | 3300028653 | Ga0265323_10041960 | Ga0265323_100419601 | 283 |
| 639 | 3300028800 | Ga0265338_10001338 | Ga0265338_100013386 | 283 |
| 640 | 3300031249 | Ga0265339_10052409 | Ga0265339_100524091 | 283 |
| 641 | 3300031711 | Ga0265314_10032234 | Ga0265314_100322342 | 283 |
| 642 | 3300031712 | Ga0265342_10062243 | Ga0265342_100622433 | 283 |
| 643 | 3300035118 | Ga0373954_0030384 | Ga0373954_0030384_513_1370 | 283 |
| 644 | 3300035120 | Ga0373957_0037987 | Ga0373957_0037987_642_1499 | 283 |
| 645 | 3300035691 | Ga0373931_0306123 | Ga0373931_0306123_71_925 | 283 |
| 646 | 3300035724 | Ga0373933_0200425 | Ga0373933_0200425_382_1239 | 283 |
| 647 | 3300036401 | Ga0373937_0041702 | Ga0373937_0041702_572_1429 | 283 |
| 648 | 3300046663 | Ga0495635_0130393 | Ga0495635_0130393_846_1697 | 283 |
| 649 | 3300053094 | Ga0500566_0000373 | Ga0500566_0000373_13176_14027 | 283 |
| 650 | 3300053094 | Ga0500566_0008132 | Ga0500566_0008132_2930_3805 | 283 |
| 651 | 3300053104 | Ga0500556_0018952 | Ga0500556_0018952_61_915 | 283 |
| 652 | 3300053119 | Ga0500595_000628 | Ga0500595_000628_4155_5030 | 283 |
| 653 | 3300053130 | Ga0500642_0000077 | Ga0500642_0000077_15911_16762 | 283 |
| 654 | 3300053153 | Ga0500616_0081769 | Ga0500616_0081769_233_1087 | 283 |
| 655 | 3300053178 | Ga0500637_0009162 | Ga0500637_0009162_1805_2680 | 283 |
| 656 | iso_pu_bacteria | 2738543031 | 2739349416 | 283 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9244 | 5 | 85 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9241 | 5 | 85 |
| 4ihs-assembly1.cif.gz_B | crystal structure of benm_dbd/catb site 1 dna complex | 0.9226 | 5 | 84 |
| 4iht-assembly2.cif.gz_C | crystal structure of benm_dbd/bena site 1 dna complex | 0.9149 | 5 | 85 |
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9145 | 5 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q47141_1_83_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9869 | 5 | 82 | 1.10.10.10 |
| af_P0A8R9_1_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9795 | 5 | 85 | 1.10.10.10 |
| af_Q2G1Q8_1_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9659 | 5 | 85 | 1.10.10.10 |
| af_Q2FZS7_1_83_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9592 | 5 | 85 | 1.10.10.10 |
| af_Q2FVT4_1_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9584 | 5 | 85 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q5IPR2-F1-model_v4 | Transcriptional regulator | 0.9762 | 5 | 85 |
GO:0000976
GO:0003700 |
| AF-A0A6N3U979-F1-model_v4 | deleted | 0.9729 | 5 | 77 |
|
| AF-Q7UTS6-F1-model_v4 | Probable transcription regulator, HTH_1 family | 0.965 | 5 | 85 |
GO:0003677
GO:0003700 |
| AF-A0A7X6IIS4-F1-model_v4 | deleted | 0.9371 | 5 | 82 |
|
| AF-A0A6N3U979-F1-model_v4 | deleted | 0.9354 | 5 | 77 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar