F473010

General Info

Members Datasets Scaffolds Average Seq Length
656 488 474 271

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10014358|Ga0105240_100143588
Length 292
Sequence VITIIDDDMSTLDIDTVQAFLLVAELQSFTRTAEALGTTQASVSLKLQRLEAVVGRRLVERSPRSVGLTADGAAFLHHARALMEAHDRALSGETPAQQILSLGISDHAGGPELVPLLERLHAMSSQLALNVTIGLSREIVDAYDGGELDAIVVRQEGSRRGGEKLTVDQFGWFAAKRFVWRRGEPLRLATLAPPCGVRAIAVRALDKAGIAWNETFVGGGVTAVAAAALAGLAVAPLARRIAPAGLIDIGASSRLPDLGSSKVMLHSRVSDPAKLAALRTLAATFRSVAAVG

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
14 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
15 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
18 2643221582 Rhizobium sp. Root651 Isolate Unclassified
19 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
20 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
21 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
24 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
25 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
26 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
27 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
28 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
29 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
33 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
34 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
35 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
36 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
37 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
38 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
39 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
40 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
41 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
42 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
43 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
44 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
45 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
46 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
47 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
48 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
49 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
50 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
51 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
52 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
53 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
54 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
55 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
56 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
57 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
58 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
59 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
60 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
61 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
62 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
63 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
64 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
67 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
68 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
69 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
70 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
71 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
72 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
73 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
74 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
75 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
76 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
77 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
78 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
79 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
80 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
81 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
82 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
83 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
84 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
85 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
86 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
87 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
88 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
89 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
90 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
91 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
92 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
93 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
94 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
95 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
96 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
97 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
98 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
99 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
100 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
101 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
102 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
103 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
104 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
107 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
108 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
109 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
110 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
111 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
112 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
113 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
114 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
115 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
123 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
124 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
125 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
126 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
127 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
130 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
131 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
132 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
133 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
134 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
135 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
136 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
137 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
138 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
139 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
140 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
141 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
142 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
143 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
144 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
145 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
146 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
147 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
148 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
149 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
150 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
151 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
152 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
153 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
154 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
155 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
156 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
157 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
158 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
159 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
160 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
161 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
162 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
163 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
164 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
165 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
171 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
172 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
173 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
174 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
175 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
176 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
177 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
178 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
179 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
180 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
181 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
182 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
183 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
184 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
185 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
186 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
187 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
188 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
189 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
190 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
191 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
192 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
193 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
194 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
195 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
196 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
197 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
198 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
199 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
200 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
201 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
202 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
203 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
204 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
205 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
206 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
207 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
208 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
209 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
210 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
211 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
212 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
213 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
214 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
215 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
216 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
217 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
218 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
219 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
220 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
221 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
222 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
223 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
224 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
225 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
226 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
227 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
228 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
229 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
230 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
231 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
232 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
233 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
238 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
240 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
277 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
281 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
282 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
283 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
284 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
285 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
286 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
287 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
288 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
289 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
290 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
291 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
292 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
293 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
294 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
295 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
298 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
303 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
304 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
307 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
308 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
309 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
316 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
335 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
348 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
351 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
355 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
363 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
385 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
391 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
412 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
413 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
414 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
415 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
416 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
417 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
420 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
428 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
433 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
434 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
435 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
436 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
437 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
438 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
439 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
440 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
441 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
442 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
443 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
444 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
445 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
446 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
447 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
448 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
449 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
450 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
451 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
452 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
453 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
454 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
455 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
456 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
457 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
458 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
459 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
460 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
461 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
462 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
463 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
464 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
465 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
466 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
467 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
468 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
469 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
470 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
471 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
472 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
473 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
474 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
475 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
476 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
477 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
478 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
479 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
480 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
481 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
482 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
483 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
484 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
485 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
486 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
487 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
488 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.26
Metatranscriptomes 0
Isolates 27.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.8
Nodule 22.71
Rhizoplane 6.55
Rhizosphere 46.65
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000736 3300003215 Bacteria 20062
2 JGI25153J46596_10003376 3300003215 Bacteria 8959
3 JGI25153J46596_10006961 3300003215 Bacteria 5633
4 JGI25153J46596_10008512 3300003215 Bacteria 4894
5 JGI25160J50197_1000905 3300003354 Bacteria 15612
6 JGI25404J52841_10002894 3300003659 Bacteria 3323
7 JGI25404J52841_10003223 3300003659 Bacteria 3200
8 Ga0055531_10004515 3300003794 Bacteria 8451
9 Ga0058692_1001780 3300003856 Bacteria 7627
10 Ga0065165_1001028 3300005262 Bacteria 33815
11 Ga0065165_1007319 3300005262 Bacteria 5468
12 Ga0070658_10034773 3300005327 Bacteria 4055
13 Ga0070690_100088734 3300005330 Bacteria 2033
14 Ga0070670_100470625 3300005331 Bacteria 1115
15 Ga0068869_100208365 3300005334 Bacteria 1544
16 Ga0068869_100330321 3300005334 Bacteria 1239
17 Ga0070680_100021933 3300005336 Bacteria 5079
18 Ga0070682_100028792 3300005337 Bacteria 3343
19 Ga0068868_100238346 3300005338 Bacteria 1527
20 Ga0070660_100278355 3300005339 Bacteria 1369
21 Ga0070661_100082424 3300005344 Bacteria 2375
22 Ga0070668_100043973 3300005347 Bacteria 3425
23 Ga0070668_100316959 3300005347 Bacteria 1312
24 Ga0070669_100073111 3300005353 Bacteria 2540
25 Ga0070671_100162390 3300005355 Bacteria 1888
26 Ga0070671_100576015 3300005355 Bacteria 972
27 Ga0070674_100078654 3300005356 Bacteria 2350
28 Ga0070667_100083036 3300005367 Bacteria 2744
29 Ga0070667_100319097 3300005367 Bacteria 1402
30 Ga0070710_10207543 3300005437 Bacteria 1240
31 Ga0070711_100036328 3300005439 Bacteria 3301
32 Ga0070663_100163602 3300005455 Bacteria 1714
33 Ga0070678_100027050 3300005456 Bacteria 3888
34 Ga0070678_100045195 3300005456 Bacteria 3149
35 Ga0070678_100177730 3300005456 Bacteria 1739
36 Ga0070662_100067123 3300005457 Bacteria 2633
37 Ga0070681_10031595 3300005458 Bacteria 5315
38 Ga0070681_10458902 3300005458 Bacteria 1186
39 Ga0068867_100057924 3300005459 Bacteria 2870
40 Ga0070679_100039899 3300005530 Bacteria 4667
41 Ga0070679_100381448 3300005530 Bacteria 1356
42 Ga0070686_100277052 3300005544 Bacteria 1235
43 Ga0070665_100001701 3300005548 Bacteria 25284
44 Ga0070665_100118347 3300005548 Bacteria 2651
45 Ga0070665_100187103 3300005548 Bacteria 2072
46 Ga0070665_100298797 3300005548 Bacteria 1613
47 Ga0068855_100007283 3300005563 Bacteria 13412
48 Ga0068854_100457000 3300005578 Bacteria 1068
49 Ga0068856_100230154 3300005614 Bacteria 1869
50 Ga0070702_100036568 3300005615 Bacteria 2721
51 Ga0068852_100184832 3300005616 Bacteria 1962
52 Ga0068852_100247985 3300005616 Bacteria 1705
53 Ga0068864_100174430 3300005618 Bacteria 1962
54 Ga0068866_10009098 3300005718 Bacteria 4210
55 Ga0068861_100108112 3300005719 Bacteria 2224
56 Ga0068851_10037343 3300005834 Bacteria 2435
57 Ga0068858_100043318 3300005842 Bacteria 4173
58 Ga0068858_100172896 3300005842 Bacteria 2038
59 Ga0068858_100441824 3300005842 Bacteria 1253
60 Ga0068860_100209491 3300005843 Bacteria 1890
61 Ga0068862_100289654 3300005844 Bacteria 1503
62 Ga0081455_10024950 3300005937 Bacteria 5525
63 Ga0081540_1001804 3300005983 Bacteria 17954
64 Ga0081540_1002740 3300005983 Bacteria 14339
65 Ga0081540_1005400 3300005983 Bacteria 9545
66 Ga0081540_1014532 3300005983 Bacteria 5035
67 Ga0081540_1023099 3300005983 Bacteria 3650
68 Ga0075365_10270007 3300006038 Bacteria 1196
69 Ga0075368_10011581 3300006042 Bacteria 3211
70 Ga0075363_100019050 3300006048 Bacteria 3426
71 Ga0075364_10016062 3300006051 Bacteria 4651
72 Ga0075367_10058261 3300006178 Bacteria 2298
73 Ga0075369_10034742 3300006186 Bacteria 2141
74 Ga0075369_10042410 3300006186 Bacteria 1951
75 Ga0075369_10127811 3300006186 Bacteria 1153
76 Ga0075366_10066306 3300006195 Bacteria 2147
77 Ga0075370_10029883 3300006353 Bacteria 3037
78 Ga0075370_10110496 3300006353 Bacteria 1596
79 Ga0068865_100127894 3300006881 Bacteria 1899
80 Ga0068865_100278141 3300006881 Bacteria 1331
81 Ga0099824_1015940 3300006942 Bacteria 6951
82 Ga0099826_10000112 3300006948 Bacteria 37415
83 Ga0105240_10014358 3300009093 Bacteria 10814
84 Ga0105240_10100189 3300009093 Bacteria 3525
85 Ga0111539_10665928 3300009094 Bacteria 1212
86 Ga0105245_10046076 3300009098 Bacteria 3896
87 Ga0105247_10013642 3300009101 Bacteria 4873
88 Ga0105241_10017103 3300009174 Bacteria 5325
89 Ga0105241_10244892 3300009174 Bacteria 1517
90 Ga0105242_10018046 3300009176 Bacteria 5511
91 Ga0105248_10020793 3300009177 Bacteria 7271
92 Ga0105248_10297604 3300009177 Bacteria 1817
93 Ga0105248_10451111 3300009177 Bacteria 1449
94 Ga0105237_10001286 3300009545 Bacteria 33400
95 Ga0105237_10181614 3300009545 Bacteria 2104
96 Ga0105238_10294831 3300009551 Bacteria 1605
97 Ga0105239_10037102 3300010375 Bacteria 5346
98 Ga0105239_10071160 3300010375 Bacteria 3821
99 Ga0105239_10078807 3300010375 Bacteria 3625
100 Ga0105239_10361252 3300010375 Bacteria 1640
101 Ga0105239_10443703 3300010375 Bacteria 1472
102 Ga0157370_10093335 3300013104 Bacteria 2824
103 Ga0157370_10130206 3300013104 Bacteria 2347
104 Ga0157378_10117046 3300013297 Bacteria 2451
105 Ga0157378_10187660 3300013297 Bacteria 1948
106 Ga0163162_10033761 3300013306 Bacteria 5086
107 Ga0163162_10063332 3300013306 Bacteria 3740
108 Ga0163162_10208206 3300013306 Bacteria 2085
109 Ga0157375_10046937 3300013308 Bacteria 4214
110 Ga0157375_10115950 3300013308 Bacteria 2782
111 Ga0163163_10228158 3300014325 Bacteria 1911
112 Ga0163163_10423821 3300014325 Bacteria 1390
113 Ga0157377_10257589 3300014745 Bacteria 1134
114 Ga0157379_10064141 3300014968 Bacteria 3283
115 Ga0157379_10273599 3300014968 Bacteria 1536
116 Ga0157376_10077055 3300014969 Bacteria 2851
117 Ga0214544_1000006 3300021320 Bacteria 380728
118 Ga0214544_1024721 3300021320 Bacteria 3050
119 Ga0214544_1026300 3300021320 Bacteria 2616
120 Ga0214542_1000002 3300021321 Bacteria 720798
121 Ga0214542_1025576 3300021321 Bacteria 3050
122 Ga0214542_1027390 3300021321 Bacteria 2616
123 Ga0214545_1000002 3300021324 Bacteria 727485
124 Ga0214545_1014661 3300021324 Bacteria 8985
125 Ga0214543_1000017 3300021327 Bacteria 290109
126 Ga0214543_1015282 3300021327 Bacteria 8564
127 Ga0213872_10028780 3300021361 Bacteria 2548
128 Ga0209563_101399 3300025230 Bacteria 6449
129 Ga0209677_106909 3300025253 Bacteria 2561
130 Ga0209148_1000803 3300025254 Bacteria 22974
131 Ga0209233_1012089 3300025261 Bacteria 2516
132 Ga0209564_1024380 3300025295 Bacteria 2069
133 Ga0209758_1000100 3300025297 Bacteria 227948
134 Ga0209758_1000164 3300025297 Bacteria 151759
135 Ga0209758_1003244 3300025297 Bacteria 15090
136 Ga0209758_1017486 3300025297 Bacteria 3566
137 Ga0209758_1028045 3300025297 Bacteria 2391
138 Ga0209758_1040304 3300025297 Bacteria 1763
139 Ga0209256_1004118 3300025299 Bacteria 9414
140 Ga0209256_1017604 3300025299 Bacteria 2363
141 Ga0207426_1000611 3300025302 Bacteria 46127
142 Ga0207426_1003966 3300025302 Bacteria 7550
143 Ga0209257_1002068 3300025304 Bacteria 21183
144 Ga0209257_1015471 3300025304 Bacteria 3171
145 Ga0209257_1067879 3300025304 Bacteria 949
146 Ga0207688_10071945 3300025901 Bacteria 1964
147 Ga0207688_10115869 3300025901 Bacteria 1559
148 Ga0207647_10001716 3300025904 Bacteria 16822
149 Ga0207654_10148107 3300025911 Bacteria 1504
150 Ga0207654_10239056 3300025911 Bacteria 1213
151 Ga0207707_10013378 3300025912 Bacteria 7154
152 Ga0207695_10000342 3300025913 Bacteria 108393
153 Ga0207671_10177156 3300025914 Bacteria 1658
154 Ga0207671_10204795 3300025914 Bacteria 1542
155 Ga0207663_10017284 3300025916 Bacteria 4015
156 Ga0207649_10060007 3300025920 Bacteria 2388
157 Ga0207652_10040794 3300025921 Bacteria 3943
158 Ga0207694_10382544 3300025924 Bacteria 1168
159 Ga0207687_10003408 3300025927 Bacteria 10725
160 Ga0207687_10204035 3300025927 Bacteria 1547
161 Ga0207644_10033049 3300025931 Bacteria 3613
162 Ga0207706_10064171 3300025933 Bacteria 3233
163 Ga0207706_10296568 3300025933 Bacteria 1409
164 Ga0207709_10042880 3300025935 Bacteria 2724
165 Ga0207670_10178969 3300025936 Bacteria 1596
166 Ga0207669_10025136 3300025937 Bacteria 3212
167 Ga0207691_10155260 3300025940 Bacteria 2010
168 Ga0207691_10195025 3300025940 Bacteria 1765
169 Ga0207711_10109061 3300025941 Bacteria 2460
170 Ga0207689_10027549 3300025942 Bacteria 4755
171 Ga0207689_10105820 3300025942 Bacteria 2311
172 Ga0207689_10422718 3300025942 Bacteria 1112
173 Ga0207679_10142733 3300025945 Bacteria 1938
174 Ga0207667_10119577 3300025949 Bacteria 2715
175 Ga0207712_10088257 3300025961 Bacteria 2277
176 Ga0207658_10166343 3300025986 Bacteria 1812
177 Ga0207658_10249368 3300025986 Bacteria 1508
178 Ga0207658_10440323 3300025986 Bacteria 1152
179 Ga0207677_10020731 3300026023 Bacteria 3998
180 Ga0207677_10183437 3300026023 Bacteria 1648
181 Ga0207703_10120003 3300026035 Bacteria 2256
182 Ga0207703_10203043 3300026035 Bacteria 1762
183 Ga0207678_10004710 3300026067 Bacteria 12244
184 Ga0207678_10008126 3300026067 Bacteria 9249
185 Ga0207678_10032622 3300026067 Bacteria 4539
186 Ga0207678_10071735 3300026067 Bacteria 2969
187 Ga0207678_10139735 3300026067 Bacteria 2067
188 Ga0207678_10197066 3300026067 Bacteria 1722
189 Ga0207708_10031505 3300026075 Bacteria 4025
190 Ga0207702_10176424 3300026078 Bacteria 1964
191 Ga0207648_10006225 3300026089 Bacteria 11885
192 Ga0207648_10172158 3300026089 Bacteria 1914
193 Ga0207675_100227369 3300026118 Bacteria 1799
194 Ga0207683_10018785 3300026121 Bacteria 5898
195 Ga0207683_10105956 3300026121 Bacteria 2513
196 Ga0207698_10539632 3300026142 Bacteria 1141
197 Ga0207698_10579948 3300026142 Bacteria 1103
198 Ga0209371_1002460 3300027312 Bacteria 10323
199 Ga0209282_1002045 3300027666 Bacteria 11478
200 Ga0268266_10002227 3300028379 Bacteria 21177
201 Ga0268266_10068682 3300028379 Bacteria 3069
202 Ga0268266_10618418 3300028379 Bacteria 1041
203 Ga0268265_10404340 3300028380 Bacteria 1263
204 Ga0268265_10494238 3300028380 Bacteria 1151
205 Ga0268264_10143647 3300028381 Bacteria 2131
206 Ga0268264_10350275 3300028381 Bacteria 1405
207 Ga0265326_10013527 3300028558 Bacteria 2385
208 Ga0265334_10028087 3300028573 Unclassified 2263
209 Ga0265323_10041960 3300028653 Bacteria 1658
210 Ga0307517_10000125 3300028786 Bacteria 115466
211 Ga0307515_10049435 3300028794 Bacteria 6327
212 Ga0265338_10001338 3300028800 Bacteria 40180
213 Ga0268256_1003711 3300030500 Bacteria 6724
214 Ga0265330_10041339 3300031235 Bacteria 2044
215 Ga0265325_10147802 3300031241 Bacteria 1113
216 Ga0265339_10052409 3300031249 Bacteria 2223
217 Ga0265331_10009277 3300031250 Bacteria 5537
218 Ga0265331_10082265 3300031250 Bacteria 1494
219 Ga0265316_10158531 3300031344 Bacteria 1693
220 Ga0307508_10083434 3300031616 Bacteria 2778
221 Ga0265314_10032234 3300031711 Bacteria 3856
222 Ga0265342_10062243 3300031712 Bacteria 2197
223 Ga0307409_100530039 3300031995 Bacteria 1152
224 Ga0307510_10004259 3300033180 Bacteria 16815
225 Ga0373934_0009278 3300035086 Bacteria 3683
226 Ga0373923_0000728 3300035111 Bacteria 8477
227 Ga0373936_0004786 3300035113 Bacteria 5109
228 Ga0373953_0004226 3300035117 Bacteria 4557
229 Ga0373954_0006955 3300035118 Bacteria 4938
230 Ga0373954_0030384 3300035118 Bacteria 2491
231 Ga0373957_0000700 3300035120 Bacteria 8682
232 Ga0373957_0037987 3300035120 Bacteria 1801
233 Ga0373943_0149158 3300035170 Bacteria 1266
234 Ga0373955_0000624 3300035172 Bacteria 15179
235 Ga0373924_0014572 3300035410 Bacteria 2974
236 Ga0373931_0048659 3300035691 Bacteria 2248
237 Ga0373931_0306123 3300035691 Bacteria 983
238 Ga0373927_0014344 3300035695 Bacteria 5248
239 Ga0373927_0019200 3300035695 Bacteria 4483
240 Ga0373927_0031030 3300035695 Bacteria 3486
241 Ga0373933_0002551 3300035724 Bacteria 10216
242 Ga0373933_0200425 3300035724 Bacteria 1277
243 Ga0373937_0007814 3300036401 Bacteria 9272
244 Ga0373937_0041702 3300036401 Bacteria 4187
245 Ga0373925_0133808 3300037068 Bacteria 1935
246 Ga0395900_0000601 3300037418 Bacteria 49219
247 Ga0395898_0010480 3300037466 Bacteria 9689
248 Ga0395905_0014881 3300037471 Bacteria 7422
249 Ga0395905_0522626 3300037471 Bacteria 1087
250 Ga0395901_0154042 3300038443 Bacteria 2414
251 Ga0466972_0000149 3300044658 Bacteria 56799
252 Ga0466972_0021294 3300044658 Bacteria 3233
253 Ga0466965_0110999 3300044683 Bacteria 1409
254 Ga0466966_0002474 3300044684 Bacteria 12086
255 Ga0466961_0000082 3300044693 Bacteria 59328
256 Ga0466960_0070622 3300044901 Bacteria 1738
257 Ga0466959_0008370 3300045049 Bacteria 7309
258 Ga0495617_024234 3300046452 Bacteria 2048
259 Ga0495629_0000450 3300046459 Bacteria 34200
260 Ga0495638_0015765 3300046460 Bacteria 5064
261 Ga0495651_0003755 3300046462 Bacteria 11617
262 Ga0495651_0030910 3300046462 Bacteria 4176
263 Ga0495653_0001326 3300046463 Bacteria 19200
264 Ga0495580_0283958 3300046472 Bacteria 1129
265 Ga0495582_0028770 3300046473 Bacteria 3050
266 Ga0495639_0191249 3300046475 Bacteria 999
267 Ga0495664_0129550 3300046477 Bacteria 1527
268 Ga0495606_0060108 3300046507 Bacteria 2435
269 Ga0495606_0265754 3300046507 Bacteria 945
270 Ga0495608_0000519 3300046511 Bacteria 26476
271 Ga0495608_0024114 3300046511 Bacteria 4163
272 Ga0495608_0106144 3300046511 Bacteria 1808
273 Ga0495618_0008396 3300046514 Bacteria 6252
274 Ga0495618_0166343 3300046514 Bacteria 1404
275 Ga0495628_0009138 3300046516 Bacteria 8477
276 Ga0495628_0217081 3300046516 Bacteria 1437
277 Ga0495643_0057586 3300046522 Bacteria 2070
278 Ga0495648_0002337 3300046524 Bacteria 17612
279 Ga0495652_0007399 3300046529 Bacteria 10124
280 Ga0495652_0077014 3300046529 Bacteria 2765
281 Ga0495665_0184999 3300046531 Bacteria 1082
282 Ga0495640_0009150 3300046533 Bacteria 7730
283 Ga0495640_0032668 3300046533 Bacteria 3705
284 Ga0495587_0003210 3300046536 Bacteria 10925
285 Ga0495645_0053987 3300046543 Bacteria 2920
286 Ga0495622_0003117 3300046557 Bacteria 7857
287 Ga0495633_0013768 3300046558 Bacteria 4250
288 Ga0495667_0000128 3300046559 Bacteria 54804
289 Ga0495667_0280950 3300046559 Bacteria 1057
290 Ga0495656_0214588 3300046615 Bacteria 960
291 Ga0495634_0007637 3300046642 Bacteria 8100
292 Ga0495634_0039222 3300046642 Bacteria 3226
293 Ga0495635_0000232 3300046663 Bacteria 35357
294 Ga0495635_0011468 3300046663 Bacteria 6214
295 Ga0495635_0130393 3300046663 Bacteria 1714
296 Ga0495659_0004030 3300046664 Bacteria 4647
297 Ga0495661_0123654 3300046665 Bacteria 1426
298 Ga0495657_0005193 3300046675 Bacteria 10312
299 Ga0495657_0012825 3300046675 Bacteria 6212
300 Ga0495657_0085710 3300046675 Bacteria 2030
301 Ga0495599_0006414 3300046678 Bacteria 7098
302 Ga0495599_0022941 3300046678 Bacteria 3898
303 Ga0495623_0014341 3300046679 Bacteria 5129
304 Ga0495646_0006561 3300046680 Bacteria 7384
305 Ga0495646_0055419 3300046680 Bacteria 2381
306 Ga0495646_0160004 3300046680 Bacteria 1247
307 Ga0495658_0096917 3300046683 Bacteria 1755
308 Ga0495669_0008461 3300046684 Bacteria 4328
309 Ga0495669_0186648 3300046684 Bacteria 989
310 Ga0495613_0012353 3300046689 Bacteria 6346
311 Ga0495624_0014677 3300046690 Bacteria 5305
312 Ga0495600_0001942 3300046809 Bacteria 11616
313 Ga0495581_0049648 3300047315 Bacteria 2423
314 Ga0495604_0006257 3300047317 Bacteria 9442
315 Ga0495604_0007123 3300047317 Bacteria 8865
316 Ga0495636_0025902 3300047318 Bacteria 2383
317 Ga0495674_0017379 3300047319 Bacteria 6692
318 Ga0495672_0019815 3300047320 Bacteria 4426
319 Ga0495676_0032531 3300047321 Bacteria 4401
320 Ga0495680_0000314 3300047322 Bacteria 54452
321 Ga0495680_0013688 3300047322 Bacteria 7063
322 Ga0495675_0162222 3300047444 Bacteria 1376
323 Ga0495684_0001551 3300047471 Bacteria 18398
324 Ga0495593_0001148 3300047673 Bacteria 15449
325 Ga0496100_0183680 3300048903 Bacteria 1514
326 Ga0496101_0060355 3300048904 Bacteria 2751
327 Ga0496101_0073889 3300048904 Bacteria 2505
328 Ga0496101_0074817 3300048904 Bacteria 2492
329 Ga0496102_0075086 3300048905 Bacteria 3107
330 Ga0496102_0152038 3300048905 Bacteria 2175
331 Ga0496102_0605780 3300048905 Bacteria 1018
332 Ga0496102_0657184 3300048905 Bacteria 971
333 Ga0496103_0029282 3300048906 Bacteria 3346
334 Ga0496103_0107781 3300048906 Bacteria 1767
335 Ga0496104_0001696 3300048907 Bacteria 19029
336 Ga0496104_0034628 3300048907 Bacteria 4711
337 Ga0496104_0113178 3300048907 Bacteria 2602
338 Ga0496104_0154916 3300048907 Bacteria 2199
339 Ga0496104_0166725 3300048907 Bacteria 2112
340 Ga0496105_0000992 3300048908 Bacteria 19571
341 Ga0496105_0038559 3300048908 Bacteria 3936
342 Ga0496105_0209449 3300048908 Bacteria 1589
343 Ga0496105_0275695 3300048908 Bacteria 1357
344 Ga0496106_0050008 3300048909 Bacteria 3150
345 Ga0496106_0142306 3300048909 Bacteria 1887
346 Ga0496107_0003405 3300048910 Bacteria 10638
347 Ga0496108_0041121 3300048911 Bacteria 3857
348 Ga0496108_0131295 3300048911 Bacteria 2153
349 Ga0496109_0007428 3300048912 Bacteria 9278
350 Ga0496109_0015451 3300048912 Bacteria 6654
351 Ga0496110_0005590 3300048913 Bacteria 9870
352 Ga0496110_0109361 3300048913 Bacteria 2482
353 Ga0496110_0141131 3300048913 Bacteria 2178
354 Ga0496111_0081144 3300048914 Bacteria 2367
355 Ga0496111_0131522 3300048914 Bacteria 1852
356 Ga0496111_0159367 3300048914 Bacteria 1675
357 Ga0496112_0004436 3300048915 Bacteria 11886
358 Ga0496112_0204021 3300048915 Bacteria 1935
359 Ga0496112_0495526 3300048915 Bacteria 1157
360 Ga0496113_0007091 3300048916 Bacteria 7174
361 Ga0496113_0208700 3300048916 Bacteria 1554
362 Ga0496113_0264034 3300048916 Bacteria 1375
363 Ga0496114_0007466 3300048917 Bacteria 8643
364 Ga0496114_0414595 3300048917 Bacteria 1193
365 Ga0496115_0022644 3300048918 Bacteria 4870
366 Ga0496116_0041959 3300048919 Bacteria 3133
367 Ga0496116_0061434 3300048919 Bacteria 2432
368 Ga0496116_0134649 3300048919 Bacteria 1402
369 Ga0496117_0016084 3300048920 Bacteria 6332
370 Ga0496117_0085969 3300048920 Bacteria 2045
371 Ga0496118_0082386 3300048921 Bacteria 2254
372 Ga0496119_0002507 3300048922 Bacteria 20068
373 Ga0496119_0034442 3300048922 Bacteria 3335
374 Ga0496119_0162229 3300048922 Bacteria 1187
375 Ga0496120_0011604 3300048923 Bacteria 6049
376 Ga0496120_0021066 3300048923 Bacteria 4125
377 Ga0496120_0067249 3300048923 Unclassified 1980
378 Ga0496120_0153303 3300048923 Bacteria 1156
379 Ga0496121_0017785 3300048924 Bacteria 7226
380 Ga0496121_0018380 3300048924 Bacteria 7052
381 Ga0496121_0175284 3300048924 Bacteria 1553
382 Ga0496122_0095566 3300048925 Bacteria 2007
383 Ga0496122_0109703 3300048925 Bacteria 1815
384 Ga0496122_0128252 3300048925 Bacteria 1619
385 Ga0496123_0051406 3300048926 Bacteria 2744
386 Ga0496124_0030083 3300048927 Unclassified 4826
387 Ga0496124_0155381 3300048927 Unclassified 1789
388 Ga0496124_0247051 3300048927 Unclassified 1322
389 Ga0496125_0000152 3300048928 Bacteria 153295
390 Ga0496125_0051656 3300048928 Bacteria 3388
391 Ga0496125_0228482 3300048928 Bacteria 1192
392 Ga0496126_0045954 3300048929 Bacteria 4009
393 Ga0496126_0073236 3300048929 Bacteria 3046
394 Ga0496126_0148564 3300048929 Unclassified 2010
395 Ga0496126_0389147 3300048929 Bacteria 1133
396 Ga0501032_0000188 3300049569 Bacteria 51273
397 Ga0501033_0000094 3300049570 Bacteria 84669
398 Ga0501034_0000021 3300049571 Bacteria 266023
399 Ga0501036_0000697 3300049572 Bacteria 24782
400 Ga0501037_0000174 3300049573 Bacteria 60960
401 Ga0501038_0000052 3300049574 Bacteria 94841
402 Ga0501039_0000156 3300049575 Bacteria 47049
403 Ga0501042_0042709 3300049578 Bacteria 3228
404 Ga0501043_0004414 3300049579 Bacteria 11423
405 Ga0501046_0000133 3300049580 Bacteria 79467
406 Ga0501047_0000511 3300049581 Bacteria 41841
407 Ga0501048_0000072 3300049582 Bacteria 51953
408 Ga0501067_0000045 3300049583 Bacteria 73394
409 Ga0501068_0008493 3300049584 Bacteria 5718
410 Ga0501069_0003931 3300049585 Bacteria 7661
411 Ga0501070_0039640 3300049586 Bacteria 3928
412 Ga0501072_0008854 3300049588 Bacteria 7645
413 Ga0501073_0000099 3300049589 Bacteria 55207
414 Ga0501074_0001112 3300049590 Bacteria 17543
415 Ga0501079_0005428 3300049741 Bacteria 9499
416 Ga0501080_0006892 3300049742 Bacteria 10247
417 Ga0501083_0001322 3300049744 Bacteria 16804
418 Ga0501035_0002501 3300049822 Bacteria 17968
419 Ga0501044_0000141 3300049823 Bacteria 88569
420 Ga0501045_0003694 3300049824 Bacteria 10527
421 nmdc:mga03n38_1783_c1 3300050490 Bacteria 5346
422 nmdc:mga00v17_19791_c1 3300050491 Bacteria 3848
423 nmdc:mga00v17_284523_c1 3300050491 Bacteria 1073
424 nmdc:mga0yw44_54122_c1 3300050492 Bacteria 2438
425 nmdc:mga0k408_72521_c1 3300050493 Bacteria 2011
426 nmdc:mga06z11_11720_c1 3300050494 Bacteria 3790
427 nmdc:mga06z11_8088_c1 3300050494 Bacteria 4365
428 nmdc:mga07m45_61055_c1 3300050496 Bacteria 2135
429 nmdc:mga08y16_551449_c1 3300050511 Bacteria 1166
430 nmdc:mga0sz30_26486_c1 3300050516 Bacteria 2377
431 nmdc:mga0sz30_76625_c1 3300050516 Bacteria 1444
432 nmdc:mga0sz30_87533_c1 3300050516 Bacteria 1353
433 Ga0495601_0005815 3300053077 Bacteria 7192
434 Ga0495595_0001439 3300053084 Bacteria 9274
435 Ga0495619_0002618 3300053085 Bacteria 11755
436 Ga0495619_0029280 3300053085 Bacteria 3557
437 Ga0500578_0049034 3300053086 Bacteria 2709
438 Ga0500643_000114 3300053087 Bacteria 84221
439 Ga0500583_0073461 3300053092 Bacteria 1640
440 Ga0500566_0000373 3300053094 Bacteria 24600
441 Ga0500566_0008132 3300053094 Bacteria 6203
442 Ga0500650_0022553 3300053098 Bacteria 2788
443 Ga0500555_000656 3300053103 Bacteria 13263
444 Ga0500556_0018952 3300053104 Bacteria 2180
445 Ga0500556_0064835 3300053104 Bacteria 1353
446 Ga0500557_000001 3300053105 Bacteria 241298
447 Ga0500560_007338 3300053107 Bacteria 2590
448 Ga0500562_004278 3300053108 Bacteria 3614
449 Ga0500569_021445 3300053109 Bacteria 1708
450 Ga0500595_000628 3300053119 Bacteria 21174
451 Ga0500595_001592 3300053119 Bacteria 11990
452 Ga0500595_013877 3300053119 Bacteria 3074
453 Ga0500607_040299 3300053121 Bacteria 2532
454 Ga0500614_007310 3300053123 Bacteria 2326
455 Ga0500642_0000077 3300053130 Bacteria 53422
456 Ga0500642_0006266 3300053130 Bacteria 3901
457 Ga0500642_0007341 3300053130 Bacteria 3698
458 Ga0500559_0077973 3300053136 Bacteria 1502
459 Ga0500590_098152 3300053148 Bacteria 1411
460 Ga0500604_0005443 3300053151 Bacteria 3360
461 Ga0500616_0081769 3300053153 Bacteria 1622
462 Ga0500622_0011023 3300053156 Bacteria 4933
463 Ga0500624_000198 3300053157 Bacteria 23807
464 Ga0500634_0009431 3300053161 Bacteria 4938
465 Ga0500638_001951 3300053162 Bacteria 6898
466 Ga0500638_027784 3300053162 Bacteria 2716
467 Ga0500636_0000116 3300053177 Bacteria 41607
468 Ga0500637_0009162 3300053178 Bacteria 5024
469 Ga0500645_024273 3300053730 Bacteria 1854
470 Ga0500599_000199 3300053736 Bacteria 5602
471 Ga0500601_000138 3300053737 Bacteria 14860
472 Ga0501084_0006916 3300054114 Bacteria 9336
473 Ga0500661_001981 3300055283 Bacteria 3865
474 Ga0501082_0002578 3300060353 Bacteria 15849

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0002474 Ga0466966_0002474_4594_5394 239
2 3300035086 Ga0373934_0009278 Ga0373934_0009278_1778_2632 244
3 3300035111 Ga0373923_0000728 Ga0373923_0000728_6556_7410 244
4 3300035117 Ga0373953_0004226 Ga0373953_0004226_1854_2708 244
5 3300035118 Ga0373954_0006955 Ga0373954_0006955_1916_2770 244
6 3300035120 Ga0373957_0000700 Ga0373957_0000700_746_1600 244
7 3300035172 Ga0373955_0000624 Ga0373955_0000624_10647_11501 244
8 3300035410 Ga0373924_0014572 Ga0373924_0014572_2052_2906 244
9 3300035724 Ga0373933_0002551 Ga0373933_0002551_1313_2167 244
10 3300036401 Ga0373937_0007814 Ga0373937_0007814_2003_2857 244
11 3300046459 Ga0495629_0000450 Ga0495629_0000450_16769_17623 244
12 3300046462 Ga0495651_0003755 Ga0495651_0003755_3553_4407 244
13 3300046463 Ga0495653_0001326 Ga0495653_0001326_1416_2270 244
14 3300046511 Ga0495608_0000519 Ga0495608_0000519_8188_9042 244
15 3300046514 Ga0495618_0008396 Ga0495618_0008396_1274_2128 244
16 3300046516 Ga0495628_0009138 Ga0495628_0009138_1669_2523 244
17 3300046529 Ga0495652_0007399 Ga0495652_0007399_4421_5275 244
18 3300046533 Ga0495640_0009150 Ga0495640_0009150_5803_6657 244
19 3300046536 Ga0495587_0003210 Ga0495587_0003210_8070_8924 244
20 3300046543 Ga0495645_0053987 Ga0495645_0053987_1419_2273 244
21 3300046559 Ga0495667_0000128 Ga0495667_0000128_2875_3729 244
22 3300046642 Ga0495634_0007637 Ga0495634_0007637_2903_3757 244
23 3300046663 Ga0495635_0000232 Ga0495635_0000232_31629_32483 244
24 3300046675 Ga0495657_0005193 Ga0495657_0005193_7457_8311 244
25 3300046678 Ga0495599_0006414 Ga0495599_0006414_4354_5208 244
26 3300046679 Ga0495623_0014341 Ga0495623_0014341_1399_2253 244
27 3300046680 Ga0495646_0006561 Ga0495646_0006561_5196_6050 244
28 3300046809 Ga0495600_0001942 Ga0495600_0001942_7211_8065 244
29 3300047317 Ga0495604_0007123 Ga0495604_0007123_4460_5314 244
30 3300047319 Ga0495674_0017379 Ga0495674_0017379_4391_5245 244
31 3300047322 Ga0495680_0000314 Ga0495680_0000314_18662_19516 244
32 3300047471 Ga0495684_0001551 Ga0495684_0001551_6313_7167 244
33 3300047673 Ga0495593_0001148 Ga0495593_0001148_4458_5312 244
34 3300053077 Ga0495601_0005815 Ga0495601_0005815_1257_2111 244
35 3300053084 Ga0495595_0001439 Ga0495595_0001439_3964_4818 244
36 3300053085 Ga0495619_0002618 Ga0495619_0002618_6976_7830 244
37 3300053121 Ga0500607_040299 Ga0500607_040299_983_1834 244
38 3300053123 Ga0500614_007310 Ga0500614_007310_672_1523 244
39 3300028381 Ga0268264_10143647 Ga0268264_101436473 246
40 3300046477 Ga0495664_0129550 Ga0495664_0129550_744_1490 246
41 3300049578 Ga0501042_0042709 Ga0501042_0042709_702_1547 248
42 3300047321 Ga0495676_0032531 Ga0495676_0032531_1048_1899 249
43 3300048905 Ga0496102_0657184 Ga0496102_0657184_63_914 249
44 3300048907 Ga0496104_0001696 Ga0496104_0001696_17030_17881 249
45 3300048908 Ga0496105_0000992 Ga0496105_0000992_11757_12608 249
46 3300048922 Ga0496119_0002507 Ga0496119_0002507_7797_8648 249
47 3300048923 Ga0496120_0011604 Ga0496120_0011604_2769_3620 249
48 3300048929 Ga0496126_0045954 Ga0496126_0045954_169_1020 249
49 3300031235 Ga0265330_10041339 Ga0265330_100413392 250
50 3300005339 Ga0070660_100278355 Ga0070660_1002783552 254
51 3300048922 Ga0496119_0162229 Ga0496119_0162229_293_1144 254
52 3300053156 Ga0500622_0011023 Ga0500622_0011023_1136_1990 254
53 3300005437 Ga0070710_10207543 Ga0070710_102075431 255
54 3300005616 Ga0068852_100184832 Ga0068852_1001848323 255
55 3300009093 Ga0105240_10100189 Ga0105240_101001892 255
56 3300009098 Ga0105245_10046076 Ga0105245_100460762 255
57 3300009545 Ga0105237_10001286 Ga0105237_100012865 255
58 3300010375 Ga0105239_10078807 Ga0105239_100788074 255
59 3300021320 Ga0214544_1000006 Ga0214544_100000660 255
60 3300021321 Ga0214542_1000002 Ga0214542_1000002316 255
61 3300021324 Ga0214545_1000002 Ga0214545_1000002403 255
62 3300021327 Ga0214543_1000017 Ga0214543_10000177 255
63 3300025302 Ga0207426_1003966 Ga0207426_10039664 255
64 3300025911 Ga0207654_10239056 Ga0207654_102390562 255
65 3300025913 Ga0207695_10000342 Ga0207695_1000034232 255
66 3300026142 Ga0207698_10539632 Ga0207698_105396322 255
67 3300048905 Ga0496102_0605780 Ga0496102_0605780_57_911 255
68 3300048929 Ga0496126_0073236 Ga0496126_0073236_536_1384 255
69 3300053737 Ga0500601_000138 Ga0500601_000138_567_1418 255
70 3300003215 JGI25153J46596_10003376 JGI25153J46596_100033768 256
71 3300003794 Ga0055531_10004515 Ga0055531_100045159 256
72 3300005262 Ga0065165_1007319 Ga0065165_10073195 256
73 3300006942 Ga0099824_1015940 Ga0099824_10159407 256
74 3300010375 Ga0105239_10361252 Ga0105239_103612521 256
75 3300025254 Ga0209148_1000803 Ga0209148_100080319 256
76 3300025297 Ga0209758_1000100 Ga0209758_1000100242 256
77 3300025297 Ga0209758_1040304 Ga0209758_10403042 256
78 3300025304 Ga0209257_1002068 Ga0209257_10020683 256
79 3300044658 Ga0466972_0000149 Ga0466972_0000149_25123_25974 256
80 3300044658 Ga0466972_0021294 Ga0466972_0021294_1683_2534 256
81 3300044693 Ga0466961_0000082 Ga0466961_0000082_17022_17894 256
82 3300045049 Ga0466959_0008370 Ga0466959_0008370_5387_6259 256
83 3300048924 Ga0496121_0018380 Ga0496121_0018380_3813_4664 256
84 3300055283 Ga0500661_001981 Ga0500661_001981_1176_2030 256
85 3300003215 JGI25153J46596_10008512 JGI25153J46596_100085124 257
86 3300003354 JGI25160J50197_1000905 JGI25160J50197_10009054 257
87 3300025295 Ga0209564_1024380 Ga0209564_10243802 257
88 3300025297 Ga0209758_1003244 Ga0209758_10032442 257
89 3300025302 Ga0207426_1000611 Ga0207426_100061118 257
90 3300048928 Ga0496125_0051656 Ga0496125_0051656_808_1659 257
91 3300053177 Ga0500636_0000116 Ga0500636_0000116_569_1420 257
92 3300003215 JGI25153J46596_10006961 JGI25153J46596_100069613 258
93 3300005262 Ga0065165_1001028 Ga0065165_100102834 258
94 3300005327 Ga0070658_10034773 Ga0070658_100347733 258
95 3300005344 Ga0070661_100082424 Ga0070661_1000824243 258
96 3300005347 Ga0070668_100043973 Ga0070668_1000439734 258
97 3300005548 Ga0070665_100118347 Ga0070665_1001183473 258
98 3300010375 Ga0105239_10037102 Ga0105239_100371025 258
99 3300025230 Ga0209563_101399 Ga0209563_1013995 258
100 3300025253 Ga0209677_106909 Ga0209677_1069091 258
101 3300025261 Ga0209233_1012089 Ga0209233_10120892 258
102 3300025297 Ga0209758_1017486 Ga0209758_10174864 258
103 3300025297 Ga0209758_1028045 Ga0209758_10280451 258
104 3300025299 Ga0209256_1004118 Ga0209256_10041184 258
105 3300025920 Ga0207649_10060007 Ga0207649_100600073 258
106 3300025945 Ga0207679_10142733 Ga0207679_101427333 258
107 3300026067 Ga0207678_10032622 Ga0207678_100326223 258
108 3300026067 Ga0207678_10071735 Ga0207678_100717354 258
109 3300026142 Ga0207698_10579948 Ga0207698_105799481 258
110 3300033180 Ga0307510_10004259 Ga0307510_1000425911 258
111 3300044683 Ga0466965_0110999 Ga0466965_0110999_333_1184 258
112 3300044901 Ga0466960_0070622 Ga0466960_0070622_98_949 258
113 3300046460 Ga0495638_0015765 Ga0495638_0015765_2942_3796 258
114 3300046462 Ga0495651_0030910 Ga0495651_0030910_1187_2038 258
115 3300046475 Ga0495639_0191249 Ga0495639_0191249_37_888 258
116 3300046507 Ga0495606_0060108 Ga0495606_0060108_412_1266 258
117 3300046511 Ga0495608_0106144 Ga0495608_0106144_395_1246 258
118 3300046514 Ga0495618_0166343 Ga0495618_0166343_22_873 258
119 3300046516 Ga0495628_0217081 Ga0495628_0217081_196_1047 258
120 3300046529 Ga0495652_0077014 Ga0495652_0077014_1719_2570 258
121 3300046533 Ga0495640_0032668 Ga0495640_0032668_155_1006 258
122 3300046557 Ga0495622_0003117 Ga0495622_0003117_2517_3368 258
123 3300046642 Ga0495634_0039222 Ga0495634_0039222_743_1594 258
124 3300046663 Ga0495635_0011468 Ga0495635_0011468_3123_3974 258
125 3300046665 Ga0495661_0123654 Ga0495661_0123654_399_1253 258
126 3300046675 Ga0495657_0012825 Ga0495657_0012825_2492_3343 258
127 3300046675 Ga0495657_0085710 Ga0495657_0085710_817_1668 258
128 3300046678 Ga0495599_0022941 Ga0495599_0022941_549_1400 258
129 3300046680 Ga0495646_0055419 Ga0495646_0055419_1102_1956 258
130 3300046680 Ga0495646_0160004 Ga0495646_0160004_220_1071 258
131 3300046689 Ga0495613_0012353 Ga0495613_0012353_4272_5123 258
132 3300046690 Ga0495624_0014677 Ga0495624_0014677_2296_3147 258
133 3300047315 Ga0495581_0049648 Ga0495581_0049648_548_1399 258
134 3300047317 Ga0495604_0006257 Ga0495604_0006257_1615_2466 258
135 3300047322 Ga0495680_0013688 Ga0495680_0013688_1513_2364 258
136 3300047444 Ga0495675_0162222 Ga0495675_0162222_146_997 258
137 3300048914 Ga0496111_0131522 Ga0496111_0131522_65_919 258
138 3300048915 Ga0496112_0495526 Ga0496112_0495526_269_1120 258
139 3300048924 Ga0496121_0017785 Ga0496121_0017785_4803_5654 258
140 3300048924 Ga0496121_0175284 Ga0496121_0175284_155_1006 258
141 3300050492 nmdc:mga0yw44_54122_c1 nmdc:mga0yw44_54122_c1_1514_2368 258
142 3300053086 Ga0500578_0049034 Ga0500578_0049034_1324_2178 258
143 3300053087 Ga0500643_000114 Ga0500643_000114_66691_67545 258
144 3300053092 Ga0500583_0073461 Ga0500583_0073461_677_1531 258
145 3300053098 Ga0500650_0022553 Ga0500650_0022553_688_1542 258
146 3300053103 Ga0500555_000656 Ga0500555_000656_12160_13014 258
147 3300053104 Ga0500556_0064835 Ga0500556_0064835_439_1293 258
148 3300053105 Ga0500557_000001 Ga0500557_000001_199202_200056 258
149 3300053108 Ga0500562_004278 Ga0500562_004278_1485_2339 258
150 3300053109 Ga0500569_021445 Ga0500569_021445_212_1063 258
151 3300053130 Ga0500642_0007341 Ga0500642_0007341_1205_2059 258
152 3300053136 Ga0500559_0077973 Ga0500559_0077973_168_1019 258
153 3300053148 Ga0500590_098152 Ga0500590_098152_462_1313 258
154 3300053151 Ga0500604_0005443 Ga0500604_0005443_376_1230 258
155 3300053162 Ga0500638_027784 Ga0500638_027784_455_1306 258
156 3300053736 Ga0500599_000199 Ga0500599_000199_3185_4039 258
157 3300021320 Ga0214544_1024721 Ga0214544_10247213 259
158 3300021321 Ga0214542_1025576 Ga0214542_10255763 259
159 3300021324 Ga0214545_1014661 Ga0214545_10146614 259
160 3300021327 Ga0214543_1015282 Ga0214543_10152828 259
161 3300031241 Ga0265325_10147802 Ga0265325_101478022 259
162 3300031250 Ga0265331_10082265 Ga0265331_100822652 259
163 3300046511 Ga0495608_0024114 Ga0495608_0024114_2100_2951 259
164 3300046524 Ga0495648_0002337 Ga0495648_0002337_896_1750 259
165 3300009174 Ga0105241_10017103 Ga0105241_100171036 260
166 3300021361 Ga0213872_10028780 Ga0213872_100287802 260
167 3300053119 Ga0500595_013877 Ga0500595_013877_1252_2106 260
168 3300005356 Ga0070674_100078654 Ga0070674_1000786543 261
169 3300005367 Ga0070667_100083036 Ga0070667_1000830362 261
170 3300005458 Ga0070681_10458902 Ga0070681_104589021 261
171 3300005459 Ga0068867_100057924 Ga0068867_1000579243 261
172 3300005530 Ga0070679_100381448 Ga0070679_1003814482 261
173 3300005548 Ga0070665_100187103 Ga0070665_1001871032 261
174 3300005615 Ga0070702_100036568 Ga0070702_1000365684 261
175 3300005718 Ga0068866_10009098 Ga0068866_100090983 261
176 3300005719 Ga0068861_100108112 Ga0068861_1001081122 261
177 3300006881 Ga0068865_100127894 Ga0068865_1001278942 261
178 3300013297 Ga0157378_10117046 Ga0157378_101170462 261
179 3300013308 Ga0157375_10115950 Ga0157375_101159502 261
180 3300025927 Ga0207687_10204035 Ga0207687_102040351 261
181 3300025935 Ga0207709_10042880 Ga0207709_100428802 261
182 3300025937 Ga0207669_10025136 Ga0207669_100251362 261
183 3300025940 Ga0207691_10195025 Ga0207691_101950252 261
184 3300025941 Ga0207711_10109061 Ga0207711_101090612 261
185 3300025942 Ga0207689_10422718 Ga0207689_104227181 261
186 3300025961 Ga0207712_10088257 Ga0207712_100882573 261
187 3300025986 Ga0207658_10166343 Ga0207658_101663432 261
188 3300026023 Ga0207677_10183437 Ga0207677_101834373 261
189 3300026067 Ga0207678_10139735 Ga0207678_101397352 261
190 3300026075 Ga0207708_10031505 Ga0207708_100315054 261
191 3300026089 Ga0207648_10006225 Ga0207648_100062255 261
192 3300026118 Ga0207675_100227369 Ga0207675_1002273692 261
193 3300026121 Ga0207683_10018785 Ga0207683_100187854 261
194 3300028379 Ga0268266_10068682 Ga0268266_100686822 261
195 3300046684 Ga0495669_0008461 Ga0495669_0008461_2379_3236 261
196 3300047320 Ga0495672_0019815 Ga0495672_0019815_231_1088 261
197 3300048909 Ga0496106_0142306 Ga0496106_0142306_79_1008 261
198 3300048917 Ga0496114_0414595 Ga0496114_0414595_304_1158 261
199 3300048929 Ga0496126_0389147 Ga0496126_0389147_102_959 261
200 3300005330 Ga0070690_100088734 Ga0070690_1000887342 262
201 3300005355 Ga0070671_100576015 Ga0070671_1005760151 262
202 3300005456 Ga0070678_100177730 Ga0070678_1001777302 262
203 3300005616 Ga0068852_100247985 Ga0068852_1002479852 262
204 3300005842 Ga0068858_100172896 Ga0068858_1001728963 262
205 3300006881 Ga0068865_100278141 Ga0068865_1002781412 262
206 3300009177 Ga0105248_10020793 Ga0105248_100207935 262
207 3300009545 Ga0105237_10181614 Ga0105237_101816143 262
208 3300010375 Ga0105239_10071160 Ga0105239_100711603 262
209 3300013306 Ga0163162_10033761 Ga0163162_100337612 262
210 3300013306 Ga0163162_10208206 Ga0163162_102082062 262
211 3300013308 Ga0157375_10046937 Ga0157375_100469372 262
212 3300014325 Ga0163163_10228158 Ga0163163_102281582 262
213 3300014968 Ga0157379_10064141 Ga0157379_100641414 262
214 3300025914 Ga0207671_10177156 Ga0207671_101771563 262
215 3300025986 Ga0207658_10249368 Ga0207658_102493682 262
216 3300026035 Ga0207703_10120003 Ga0207703_101200033 262
217 3300026121 Ga0207683_10105956 Ga0207683_101059563 262
218 3300028786 Ga0307517_10000125 Ga0307517_10000125129 262
219 3300028794 Ga0307515_10049435 Ga0307515_100494351 262
220 3300035170 Ga0373943_0149158 Ga0373943_0149158_40_894 262
221 3300035691 Ga0373931_0048659 Ga0373931_0048659_90_944 262
222 3300035695 Ga0373927_0019200 Ga0373927_0019200_2200_3054 262
223 3300035695 Ga0373927_0031030 Ga0373927_0031030_301_1155 262
224 3300037471 Ga0395905_0014881 Ga0395905_0014881_1512_2366 262
225 3300046473 Ga0495582_0028770 Ga0495582_0028770_1428_2282 262
226 3300046531 Ga0495665_0184999 Ga0495665_0184999_56_928 262
227 3300046559 Ga0495667_0280950 Ga0495667_0280950_125_997 262
228 3300046615 Ga0495656_0214588 Ga0495656_0214588_40_918 262
229 3300046664 Ga0495659_0004030 Ga0495659_0004030_48_923 262
230 3300046683 Ga0495658_0096917 Ga0495658_0096917_123_977 262
231 3300046684 Ga0495669_0186648 Ga0495669_0186648_90_962 262
232 3300048904 Ga0496101_0060355 Ga0496101_0060355_1641_2495 262
233 3300048905 Ga0496102_0075086 Ga0496102_0075086_1466_2320 262
234 3300048906 Ga0496103_0029282 Ga0496103_0029282_1210_2088 262
235 3300048907 Ga0496104_0113178 Ga0496104_0113178_1161_2015 262
236 3300048908 Ga0496105_0209449 Ga0496105_0209449_676_1530 262
237 3300048910 Ga0496107_0003405 Ga0496107_0003405_6525_7403 262
238 3300048911 Ga0496108_0131295 Ga0496108_0131295_599_1453 262
239 3300048912 Ga0496109_0015451 Ga0496109_0015451_5256_6110 262
240 3300048913 Ga0496110_0109361 Ga0496110_0109361_1548_2402 262
241 3300048914 Ga0496111_0081144 Ga0496111_0081144_898_1752 262
242 3300048915 Ga0496112_0004436 Ga0496112_0004436_1992_2846 262
243 3300048916 Ga0496113_0007091 Ga0496113_0007091_5303_6157 262
244 3300048916 Ga0496113_0264034 Ga0496113_0264034_313_1191 262
245 3300048917 Ga0496114_0007466 Ga0496114_0007466_1161_2015 262
246 3300048918 Ga0496115_0022644 Ga0496115_0022644_554_1432 262
247 3300053085 Ga0495619_0029280 Ga0495619_0029280_2363_3217 262
248 3300053119 Ga0500595_001592 Ga0500595_001592_4027_4878 262
249 3300053130 Ga0500642_0006266 Ga0500642_0006266_183_1034 262
250 3300005334 Ga0068869_100330321 Ga0068869_1003303211 263
251 3300005456 Ga0070678_100027050 Ga0070678_1000270504 263
252 3300005457 Ga0070662_100067123 Ga0070662_1000671232 263
253 3300005544 Ga0070686_100277052 Ga0070686_1002770521 263
254 3300005842 Ga0068858_100441824 Ga0068858_1004418241 263
255 3300009176 Ga0105242_10018046 Ga0105242_100180465 263
256 3300013306 Ga0163162_10063332 Ga0163162_100633322 263
257 3300021320 Ga0214544_1026300 Ga0214544_10263002 263
258 3300021321 Ga0214542_1027390 Ga0214542_10273903 263
259 3300025933 Ga0207706_10064171 Ga0207706_100641712 263
260 3300025936 Ga0207670_10178969 Ga0207670_101789692 263
261 3300026035 Ga0207703_10203043 Ga0207703_102030432 263
262 3300048903 Ga0496100_0183680 Ga0496100_0183680_99_953 263
263 3300048925 Ga0496122_0128252 Ga0496122_0128252_467_1318 263
264 3300049569 Ga0501032_0000188 Ga0501032_0000188_17453_18343 263
265 3300049570 Ga0501033_0000094 Ga0501033_0000094_7545_8435 263
266 3300049571 Ga0501034_0000021 Ga0501034_0000021_76352_77242 263
267 3300049572 Ga0501036_0000697 Ga0501036_0000697_4054_4944 263
268 3300049573 Ga0501037_0000174 Ga0501037_0000174_44077_44967 263
269 3300049574 Ga0501038_0000052 Ga0501038_0000052_76362_77252 263
270 3300049575 Ga0501039_0000156 Ga0501039_0000156_4428_5318 263
271 3300049579 Ga0501043_0004414 Ga0501043_0004414_6771_7661 263
272 3300049580 Ga0501046_0000133 Ga0501046_0000133_58069_58959 263
273 3300049581 Ga0501047_0000511 Ga0501047_0000511_23718_24608 263
274 3300049582 Ga0501048_0000072 Ga0501048_0000072_47216_48106 263
275 3300049583 Ga0501067_0000045 Ga0501067_0000045_66444_67334 263
276 3300049584 Ga0501068_0008493 Ga0501068_0008493_546_1436 263
277 3300049585 Ga0501069_0003931 Ga0501069_0003931_5050_5940 263
278 3300049586 Ga0501070_0039640 Ga0501070_0039640_2257_3147 263
279 3300049588 Ga0501072_0008854 Ga0501072_0008854_791_1681 263
280 3300049589 Ga0501073_0000099 Ga0501073_0000099_51047_51937 263
281 3300049590 Ga0501074_0001112 Ga0501074_0001112_8919_9809 263
282 3300049741 Ga0501079_0005428 Ga0501079_0005428_2534_3424 263
283 3300049742 Ga0501080_0006892 Ga0501080_0006892_5672_6562 263
284 3300049744 Ga0501083_0001322 Ga0501083_0001322_852_1742 263
285 3300049822 Ga0501035_0002501 Ga0501035_0002501_13646_14536 263
286 3300049823 Ga0501044_0000141 Ga0501044_0000141_67841_68731 263
287 3300049824 Ga0501045_0003694 Ga0501045_0003694_3944_4834 263
288 3300054114 Ga0501084_0006916 Ga0501084_0006916_6129_7019 263
289 3300060353 Ga0501082_0002578 Ga0501082_0002578_5824_6714 263
290 3300005337 Ga0070682_100028792 Ga0070682_1000287925 264
291 3300005338 Ga0068868_100238346 Ga0068868_1002383462 264
292 3300005455 Ga0070663_100163602 Ga0070663_1001636022 264
293 3300005578 Ga0068854_100457000 Ga0068854_1004570002 264
294 3300005618 Ga0068864_100174430 Ga0068864_1001744302 264
295 3300009177 Ga0105248_10451111 Ga0105248_104511112 264
296 3300013104 Ga0157370_10093335 Ga0157370_100933351 264
297 3300014968 Ga0157379_10273599 Ga0157379_102735991 264
298 3300014969 Ga0157376_10077055 Ga0157376_100770553 264
299 3300025927 Ga0207687_10003408 Ga0207687_100034087 264
300 3300026023 Ga0207677_10020731 Ga0207677_100207315 264
301 3300026067 Ga0207678_10008126 Ga0207678_100081264 264
302 3300046507 Ga0495606_0265754 Ga0495606_0265754_68_922 264
303 3300048904 Ga0496101_0073889 Ga0496101_0073889_1238_2116 264
304 3300048907 Ga0496104_0154916 Ga0496104_0154916_486_1364 264
305 3300048908 Ga0496105_0038559 Ga0496105_0038559_375_1253 264
306 3300048909 Ga0496106_0050008 Ga0496106_0050008_2227_3105 264
307 3300048911 Ga0496108_0041121 Ga0496108_0041121_2515_3393 264
308 3300048912 Ga0496109_0007428 Ga0496109_0007428_5159_6037 264
309 3300048913 Ga0496110_0005590 Ga0496110_0005590_8831_9709 264
310 3300048914 Ga0496111_0159367 Ga0496111_0159367_161_1039 264
311 3300048915 Ga0496112_0204021 Ga0496112_0204021_295_1173 264
312 3300003659 JGI25404J52841_10002894 JGI25404J52841_100028942 266
313 3300005983 Ga0081540_1005400 Ga0081540_10054006 266
314 3300005983 Ga0081540_1014532 Ga0081540_10145326 266
315 3300005983 Ga0081540_1023099 Ga0081540_10230994 266
316 3300037418 Ga0395900_0000601 Ga0395900_0000601_41062_41916 266
317 3300037466 Ga0395898_0010480 Ga0395898_0010480_3467_4321 266
318 3300037471 Ga0395905_0522626 Ga0395905_0522626_108_962 266
319 3300038443 Ga0395901_0154042 Ga0395901_0154042_568_1422 266
320 3300005439 Ga0070711_100036328 Ga0070711_1000363283 267
321 3300025916 Ga0207663_10017284 Ga0207663_100172844 267
322 3300048904 Ga0496101_0074817 Ga0496101_0074817_830_1681 267
323 3300046452 Ga0495617_024234 Ga0495617_024234_800_1648 271
324 3300047318 Ga0495636_0025902 Ga0495636_0025902_281_1129 271
325 3300005937 Ga0081455_10024950 Ga0081455_100249503 272
326 3300031344 Ga0265316_10158531 Ga0265316_101585313 272
327 3300003659 JGI25404J52841_10003223 JGI25404J52841_100032235 273
328 3300005983 Ga0081540_1001804 Ga0081540_100180413 273
329 3300005331 Ga0070670_100470625 Ga0070670_1004706251 274
330 3300005347 Ga0070668_100316959 Ga0070668_1003169592 274
331 3300005355 Ga0070671_100162390 Ga0070671_1001623902 274
332 3300005367 Ga0070667_100319097 Ga0070667_1003190972 274
333 3300005548 Ga0070665_100298797 Ga0070665_1002987972 274
334 3300006038 Ga0075365_10270007 Ga0075365_102700072 274
335 3300006042 Ga0075368_10011581 Ga0075368_100115811 274
336 3300006051 Ga0075364_10016062 Ga0075364_100160623 274
337 3300006178 Ga0075367_10058261 Ga0075367_100582612 274
338 3300006186 Ga0075369_10127811 Ga0075369_101278111 274
339 3300006195 Ga0075366_10066306 Ga0075366_100663063 274
340 3300006353 Ga0075370_10110496 Ga0075370_101104962 274
341 3300009174 Ga0105241_10244892 Ga0105241_102448922 274
342 3300009177 Ga0105248_10297604 Ga0105248_102976042 274
343 3300009551 Ga0105238_10294831 Ga0105238_102948312 274
344 3300010375 Ga0105239_10443703 Ga0105239_104437032 274
345 3300014325 Ga0163163_10423821 Ga0163163_104238212 274
346 3300014745 Ga0157377_10257589 Ga0157377_102575892 274
347 3300025299 Ga0209256_1017604 Ga0209256_10176041 274
348 3300025304 Ga0209257_1015471 Ga0209257_10154712 274
349 3300025304 Ga0209257_1067879 Ga0209257_10678791 274
350 3300025901 Ga0207688_10071945 Ga0207688_100719451 274
351 3300025904 Ga0207647_10001716 Ga0207647_100017168 274
352 3300025911 Ga0207654_10148107 Ga0207654_101481072 274
353 3300025914 Ga0207671_10204795 Ga0207671_102047952 274
354 3300025924 Ga0207694_10382544 Ga0207694_103825441 274
355 3300025931 Ga0207644_10033049 Ga0207644_100330494 274
356 3300025933 Ga0207706_10296568 Ga0207706_102965682 274
357 3300025986 Ga0207658_10440323 Ga0207658_104403232 274
358 3300026067 Ga0207678_10197066 Ga0207678_101970662 274
359 3300028379 Ga0268266_10618418 Ga0268266_106184182 274
360 3300028380 Ga0268265_10404340 Ga0268265_104043402 274
361 3300046522 Ga0495643_0057586 Ga0495643_0057586_145_996 274
362 3300048905 Ga0496102_0152038 Ga0496102_0152038_930_1781 274
363 3300048906 Ga0496103_0107781 Ga0496103_0107781_145_996 274
364 3300048907 Ga0496104_0034628 Ga0496104_0034628_1786_2637 274
365 3300048908 Ga0496105_0275695 Ga0496105_0275695_317_1168 274
366 3300048913 Ga0496110_0141131 Ga0496110_0141131_191_1042 274
367 3300048916 Ga0496113_0208700 Ga0496113_0208700_42_893 274
368 3300048922 Ga0496119_0034442 Ga0496119_0034442_2300_3151 274
369 3300048923 Ga0496120_0153303 Ga0496120_0153303_252_1103 274
370 3300048928 Ga0496125_0228482 Ga0496125_0228482_299_1150 274
371 3300050493 nmdc:mga0k408_72521_c1 nmdc:mga0k408_72521_c1_804_1655 274
372 3300050494 nmdc:mga06z11_11720_c1 nmdc:mga06z11_11720_c1_2242_3093 274
373 3300050496 nmdc:mga07m45_61055_c1 nmdc:mga07m45_61055_c1_849_1700 274
374 3300050516 nmdc:mga0sz30_26486_c1 nmdc:mga0sz30_26486_c1_1269_2120 274
375 3300053730 Ga0500645_024273 Ga0500645_024273_129_980 274
376 iso_pu_bacteria 2537561587 2537875073 274
377 iso_pu_bacteria 2841846520 2841851427 274
378 3300005456 Ga0070678_100045195 Ga0070678_1000451952 275
379 3300025901 Ga0207688_10115869 Ga0207688_101158692 275
380 3300025940 Ga0207691_10155260 Ga0207691_101552603 275
381 iso_pu_bacteria 2600255279 2601611108 275
382 iso_pu_bacteria 2600255308 2601747881 275
383 iso_pu_bacteria 2643221582 2643921997 275
384 iso_pu_bacteria 8003570095 8003574622 275
385 3300050491 nmdc:mga00v17_284523_c1 nmdc:mga00v17_284523_c1_177_1061 276
386 iso_pu_bacteria 2881665667 2881672979 276
387 iso_pu_bacteria 2721755755 2723846036 277
388 iso_pu_bacteria 2842124991 2842130011 277
389 iso_pu_bacteria 2857531043 2857537230 277
390 iso_pu_bacteria 2881364244 2881366346 277
391 iso_pu_bacteria 2929138655 2929144227 277
392 iso_pu_bacteria 2841957949 2841962368 278
393 iso_pu_bacteria 2879110137 2879110682 278
394 iso_pu_bacteria 2889033259 2889040979 278
395 iso_pu_bacteria 2906626472 2906628156 278
396 iso_pu_bacteria 2922386360 2922392155 278
397 iso_pu_bacteria 2933594066 2933598216 278
398 iso_pu_bacteria 8006926726 8006931563 278
399 iso_pu_bacteria 8056673599 8056680591 278
400 3300006948 Ga0099826_10000112 Ga0099826_1000011211 279
401 3300027666 Ga0209282_1002045 Ga0209282_10020452 279
402 3300028573 Ga0265334_10028087 Ga0265334_100280872 279
403 3300031250 Ga0265331_10009277 Ga0265331_100092772 279
404 iso_pu_bacteria 2508501009 2508543666 279
405 iso_pu_bacteria 2508501042 2508698541 279
406 iso_pu_bacteria 2511231028 2511399618 279
407 iso_pu_bacteria 2513237092 2513628310 279
408 iso_pu_bacteria 2513237094 2513643818 279
409 iso_pu_bacteria 2513237095 2513646291 279
410 iso_pu_bacteria 2513237102 2513700311 279
411 iso_pu_bacteria 2513237104 2513721631 279
412 iso_pu_bacteria 2513237139 2513875367 279
413 iso_pu_bacteria 2513237161 2514016162 279
414 iso_pu_bacteria 2517093001 2517103650 279
415 iso_pu_bacteria 2528768022 2528856770 279
416 iso_pu_bacteria 2617270735 2617349153 279
417 iso_pu_bacteria 2617270741 2617378301 279
418 iso_pu_bacteria 2791355196 2793060390 279
419 iso_pu_bacteria 2802429603 2805921995 279
420 iso_pu_bacteria 2824600985 2824602236 279
421 iso_pu_bacteria 2824609381 2824610224 279
422 iso_pu_bacteria 2824617872 2824623563 279
423 iso_pu_bacteria 2824626560 2824630925 279
424 iso_pu_bacteria 2824635225 2824640051 279
425 iso_pu_bacteria 2824644064 2824647801 279
426 iso_pu_bacteria 2824661429 2824666947 279
427 iso_pu_bacteria 2824714736 2824717656 279
428 iso_pu_bacteria 2824723954 2824727837 279
429 iso_pu_bacteria 2824753945 2824758152 279
430 iso_pu_bacteria 2824763712 2824766618 279
431 iso_pu_bacteria 2838122688 2838128799 279
432 iso_pu_bacteria 2841941048 2841941105 279
433 iso_pu_bacteria 2841949485 2841957266 279
434 iso_pu_bacteria 2841966195 2841967259 279
435 iso_pu_bacteria 2841974524 2841979344 279
436 iso_pu_bacteria 2841983080 2841989820 279
437 iso_pu_bacteria 2842038055 2842040022 279
438 iso_pu_bacteria 2842045827 2842047033 279
439 iso_pu_bacteria 2844315083 2844318147 279
440 iso_pu_bacteria 2847939898 2847945533 279
441 iso_pu_bacteria 2849076700 2849080280 279
442 iso_pu_bacteria 2857509624 2857510354 279
443 iso_pu_bacteria 2874590934 2874595254 279
444 iso_pu_bacteria 2874612657 2874613203 279
445 iso_pu_bacteria 2874620515 2874620780 279
446 iso_pu_bacteria 2874628541 2874636520 279
447 iso_pu_bacteria 2874645413 2874651095 279
448 iso_pu_bacteria 2876761206 2876762567 279
449 iso_pu_bacteria 2876771140 2876775190 279
450 iso_pu_bacteria 2876818435 2876824005 279
451 iso_pu_bacteria 2879099564 2879109457 279
452 iso_pu_bacteria 2879127579 2879134782 279
453 iso_pu_bacteria 2879142872 2879149093 279
454 iso_pu_bacteria 2885366525 2885372933 279
455 iso_pu_bacteria 2885409591 2885416690 279
456 iso_pu_bacteria 2888378607 2888382953 279
457 iso_pu_bacteria 2888388044 2888394842 279
458 iso_pu_bacteria 2888419890 2888423418 279
459 iso_pu_bacteria 2903727486 2903734150 279
460 iso_pu_bacteria 2904666416 2904666865 279
461 iso_pu_bacteria 2904711408 2904716791 279
462 iso_pu_bacteria 2906602504 2906608405 279
463 iso_pu_bacteria 2908775508 2908779056 279
464 iso_pu_bacteria 2922393267 2922395356 279
465 iso_pu_bacteria 2929615660 2929615782 279
466 iso_pu_bacteria 2929624759 2929630395 279
467 iso_pu_bacteria 2932784394 2932792043 279
468 iso_pu_bacteria 2932794094 2932796226 279
469 iso_pu_bacteria 2932801729 2932804471 279
470 iso_pu_bacteria 2932809354 2932814090 279
471 iso_pu_bacteria 2932818245 2932819422 279
472 iso_pu_bacteria 2932828146 2932833869 279
473 iso_pu_bacteria 2933577622 2933578932 279
474 iso_pu_bacteria 2935608549 2935611494 279
475 iso_pu_bacteria 2935616580 2935618601 279
476 iso_pu_bacteria 2935638405 2935644556 279
477 iso_pu_bacteria 2935648319 2935648868 279
478 iso_pu_bacteria 2935656913 2935657050 279
479 iso_pu_bacteria 2935665750 2935673553 279
480 iso_pu_bacteria 2935675223 2935678440 279
481 iso_pu_bacteria 2935684952 2935688131 279
482 iso_pu_bacteria 2935694250 2935701331 279
483 iso_pu_bacteria 2935713505 2935715150 279
484 iso_pu_bacteria 2935722832 2935726285 279
485 iso_pu_bacteria 2935732158 2935733969 279
486 iso_pu_bacteria 2935741537 2935743348 279
487 iso_pu_bacteria 2935750917 2935754614 279
488 iso_pu_bacteria 2935760218 2935765393 279
489 iso_pu_bacteria 2935769743 2935776333 279
490 iso_pu_bacteria 2935777560 2935784145 279
491 iso_pu_bacteria 2935785616 2935790322 279
492 iso_pu_bacteria 2935793552 2935798905 279
493 iso_pu_bacteria 2935801545 2935805344 279
494 iso_pu_bacteria 2935810662 2935816642 279
495 iso_pu_bacteria 2935819856 2935820971 279
496 iso_pu_bacteria 2935827899 2935833695 279
497 iso_pu_bacteria 2935837841 2935839619 279
498 iso_pu_bacteria 2935847175 2935850769 279
499 iso_pu_bacteria 2935855204 2935856966 279
500 iso_pu_bacteria 2935883170 2935888872 279
501 iso_pu_bacteria 2935908558 2935913862 279
502 iso_pu_bacteria 2935916978 2935920148 279
503 iso_pu_bacteria 2935926038 2935930487 279
504 iso_pu_bacteria 2935934488 2935939540 279
505 iso_pu_bacteria 2935942939 2935946489 279
506 iso_pu_bacteria 2935951376 2935955672 279
507 iso_pu_bacteria 2935967501 2935972618 279
508 iso_pu_bacteria 2935975950 2935981559 279
509 iso_pu_bacteria 2935984226 2935989050 279
510 iso_pu_bacteria 2935992306 2935997746 279
511 iso_pu_bacteria 2936011229 2936011778 279
512 iso_pu_bacteria 2936019824 2936020373 279
513 iso_pu_bacteria 2936028420 2936029067 279
514 iso_pu_bacteria 2936037263 2936043096 279
515 iso_pu_bacteria 2936046547 2936047096 279
516 iso_pu_bacteria 2936055302 2936061327 279
517 iso_pu_bacteria 2940556831 2940560009 279
518 iso_pu_bacteria 2941531003 2941535956 279
519 iso_pu_bacteria 2941538514 2941540308 279
520 iso_pu_bacteria 3005506211 3005507844 279
521 iso_pu_bacteria 3005710791 3005713856 279
522 iso_pu_bacteria 3005718088 3005721377 279
523 iso_pu_bacteria 8016522445 8016530660 279
524 iso_pu_bacteria 8016530956 8016535944 279
525 iso_pu_bacteria 8016539877 8016540225 279
526 iso_pu_bacteria 8016548790 8016553009 279
527 iso_pu_bacteria 8016566248 8016574290 279
528 iso_pu_bacteria 8016575299 8016578390 279
529 iso_pu_bacteria 8016603502 8016611805 279
530 iso_pu_bacteria 8016613128 8016622001 279
531 iso_pu_bacteria 8016630954 8016632172 279
532 iso_pu_bacteria 8017057580 8017061866 279
533 iso_pu_bacteria 8019538911 8019543812 279
534 iso_pu_bacteria 8019547302 8019554966 279
535 iso_pu_bacteria 8019576017 8019581398 279
536 iso_pu_bacteria 8019586578 8019589025 279
537 iso_pu_bacteria 8019597564 8019602209 279
538 iso_pu_bacteria 8019629233 8019635544 279
539 iso_pu_bacteria 8019638758 8019644160 279
540 iso_pu_bacteria 8019648815 8019657149 279
541 iso_pu_bacteria 8019659431 8019663348 279
542 iso_pu_bacteria 8019668869 8019672967 279
543 iso_pu_bacteria 8019678201 8019683175 279
544 iso_pu_bacteria 8019687851 8019688881 279
545 iso_pu_bacteria 8055742211 8055747429 279
546 iso_pu_bacteria 8056967851 8056972497 279
547 3300046558 Ga0495633_0013768 Ga0495633_0013768_1829_2680 280
548 3300048919 Ga0496116_0134649 Ga0496116_0134649_440_1291 280
549 3300048920 Ga0496117_0085969 Ga0496117_0085969_931_1782 280
550 3300048921 Ga0496118_0082386 Ga0496118_0082386_497_1348 280
551 3300053107 Ga0500560_007338 Ga0500560_007338_871_1722 280
552 3300053157 Ga0500624_000198 Ga0500624_000198_1477_2328 280
553 3300053161 Ga0500634_0009431 Ga0500634_0009431_1403_2254 280
554 iso_pu_bacteria 2838675328 2838679104 280
555 iso_pu_bacteria 2838714209 2838718058 280
556 iso_pu_bacteria 2838719591 2838723403 280
557 iso_pu_bacteria 2838724970 2838728772 280
558 iso_pu_bacteria 2841859092 2841863510 280
559 iso_pu_bacteria 2842130223 2842133745 280
560 iso_pu_bacteria 2842152218 2842155991 280
561 iso_pu_bacteria 2842170452 2842174303 280
562 iso_pu_bacteria 2842175837 2842179359 280
563 iso_pu_bacteria 2842187318 2842190879 280
564 iso_pu_bacteria 2842211629 2842215194 280
565 iso_pu_bacteria 2842224351 2842228167 280
566 iso_pu_bacteria 2842515876 2842520293 280
567 iso_pu_bacteria 2899792073 2899793855 280
568 iso_pu_bacteria 2919114240 2919118288 280
569 iso_pu_bacteria 2926754445 2926758052 280
570 iso_pu_bacteria 2933006813 2933011016 280
571 iso_pu_bacteria 2933011516 2933015985 280
572 3300006186 Ga0075369_10034742 Ga0075369_100347422 281
573 3300006186 Ga0075369_10042410 Ga0075369_100424101 281
574 3300027312 Ga0209371_1002460 Ga0209371_10024606 281
575 3300030500 Ga0268256_1003711 Ga0268256_10037112 281
576 3300048919 Ga0496116_0041959 Ga0496116_0041959_1518_2372 281
577 3300048919 Ga0496116_0061434 Ga0496116_0061434_250_1104 281
578 3300048920 Ga0496117_0016084 Ga0496117_0016084_2934_3788 281
579 3300048923 Ga0496120_0021066 Ga0496120_0021066_2969_3823 281
580 3300048923 Ga0496120_0067249 Ga0496120_0067249_69_923 281
581 3300048925 Ga0496122_0095566 Ga0496122_0095566_510_1364 281
582 3300048925 Ga0496122_0109703 Ga0496122_0109703_157_1011 281
583 3300048926 Ga0496123_0051406 Ga0496123_0051406_1519_2373 281
584 3300048927 Ga0496124_0030083 Ga0496124_0030083_1511_2365 281
585 3300048927 Ga0496124_0155381 Ga0496124_0155381_365_1219 281
586 3300048927 Ga0496124_0247051 Ga0496124_0247051_104_958 281
587 3300048928 Ga0496125_0000152 Ga0496125_0000152_55611_56465 281
588 3300048929 Ga0496126_0148564 Ga0496126_0148564_125_979 281
589 3300050491 nmdc:mga00v17_19791_c1 nmdc:mga00v17_19791_c1_19_873 281
590 3300003856 Ga0058692_1001780 Ga0058692_10017805 282
591 3300005334 Ga0068869_100208365 Ga0068869_1002083652 282
592 3300005336 Ga0070680_100021933 Ga0070680_1000219334 282
593 3300005353 Ga0070669_100073111 Ga0070669_1000731112 282
594 3300005458 Ga0070681_10031595 Ga0070681_100315953 282
595 3300005530 Ga0070679_100039899 Ga0070679_1000398993 282
596 3300005548 Ga0070665_100001701 Ga0070665_10000170119 282
597 3300005563 Ga0068855_100007283 Ga0068855_1000072835 282
598 3300005614 Ga0068856_100230154 Ga0068856_1002301542 282
599 3300005843 Ga0068860_100209491 Ga0068860_1002094912 282
600 3300005844 Ga0068862_100289654 Ga0068862_1002896542 282
601 3300005983 Ga0081540_1002740 Ga0081540_10027406 282
602 3300006048 Ga0075363_100019050 Ga0075363_1000190506 282
603 3300006353 Ga0075370_10029883 Ga0075370_100298834 282
604 3300009094 Ga0111539_10665928 Ga0111539_106659282 282
605 3300013104 Ga0157370_10130206 Ga0157370_101302063 282
606 3300025912 Ga0207707_10013378 Ga0207707_100133784 282
607 3300025921 Ga0207652_10040794 Ga0207652_100407943 282
608 3300025942 Ga0207689_10027549 Ga0207689_100275492 282
609 3300025942 Ga0207689_10105820 Ga0207689_101058202 282
610 3300026067 Ga0207678_10004710 Ga0207678_100047106 282
611 3300026078 Ga0207702_10176424 Ga0207702_101764242 282
612 3300026089 Ga0207648_10172158 Ga0207648_101721582 282
613 3300028379 Ga0268266_10002227 Ga0268266_100022277 282
614 3300028380 Ga0268265_10494238 Ga0268265_104942381 282
615 3300028381 Ga0268264_10350275 Ga0268264_103502752 282
616 3300031616 Ga0307508_10083434 Ga0307508_100834341 282
617 3300031995 Ga0307409_100530039 Ga0307409_1005300391 282
618 3300035113 Ga0373936_0004786 Ga0373936_0004786_3515_4369 282
619 3300035695 Ga0373927_0014344 Ga0373927_0014344_1715_2566 282
620 3300037068 Ga0373925_0133808 Ga0373925_0133808_692_1543 282
621 3300046472 Ga0495580_0283958 Ga0495580_0283958_175_1026 282
622 3300048907 Ga0496104_0166725 Ga0496104_0166725_727_1581 282
623 3300050490 nmdc:mga03n38_1783_c1 nmdc:mga03n38_1783_c1_3854_4708 282
624 3300050494 nmdc:mga06z11_8088_c1 nmdc:mga06z11_8088_c1_1028_1882 282
625 3300050511 nmdc:mga08y16_551449_c1 nmdc:mga08y16_551449_c1_220_1074 282
626 3300050516 nmdc:mga0sz30_76625_c1 nmdc:mga0sz30_76625_c1_333_1190 282
627 3300050516 nmdc:mga0sz30_87533_c1 nmdc:mga0sz30_87533_c1_55_912 282
628 3300053162 Ga0500638_001951 Ga0500638_001951_6035_6886 282
629 3300003215 JGI25153J46596_10000736 JGI25153J46596_1000073623 283
630 3300005834 Ga0068851_10037343 Ga0068851_100373434 283
631 3300005842 Ga0068858_100043318 Ga0068858_1000433185 283
632 3300009093 Ga0105240_10014358 Ga0105240_100143588 283
633 3300009101 Ga0105247_10013642 Ga0105247_100136424 283
634 3300013297 Ga0157378_10187660 Ga0157378_101876602 283
635 3300025297 Ga0209758_1000164 Ga0209758_100016461 283
636 3300025949 Ga0207667_10119577 Ga0207667_101195773 283
637 3300028558 Ga0265326_10013527 Ga0265326_100135271 283
638 3300028653 Ga0265323_10041960 Ga0265323_100419601 283
639 3300028800 Ga0265338_10001338 Ga0265338_100013386 283
640 3300031249 Ga0265339_10052409 Ga0265339_100524091 283
641 3300031711 Ga0265314_10032234 Ga0265314_100322342 283
642 3300031712 Ga0265342_10062243 Ga0265342_100622433 283
643 3300035118 Ga0373954_0030384 Ga0373954_0030384_513_1370 283
644 3300035120 Ga0373957_0037987 Ga0373957_0037987_642_1499 283
645 3300035691 Ga0373931_0306123 Ga0373931_0306123_71_925 283
646 3300035724 Ga0373933_0200425 Ga0373933_0200425_382_1239 283
647 3300036401 Ga0373937_0041702 Ga0373937_0041702_572_1429 283
648 3300046663 Ga0495635_0130393 Ga0495635_0130393_846_1697 283
649 3300053094 Ga0500566_0000373 Ga0500566_0000373_13176_14027 283
650 3300053094 Ga0500566_0008132 Ga0500566_0008132_2930_3805 283
651 3300053104 Ga0500556_0018952 Ga0500556_0018952_61_915 283
652 3300053119 Ga0500595_000628 Ga0500595_000628_4155_5030 283
653 3300053130 Ga0500642_0000077 Ga0500642_0000077_15911_16762 283
654 3300053153 Ga0500616_0081769 Ga0500616_0081769_233_1087 283
655 3300053178 Ga0500637_0009162 Ga0500637_0009162_1805_2680 283
656 iso_pu_bacteria 2738543031 2739349416 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

14

73

0.96

PF03466

LysR_substrate

LysR substrate binding domain

94

287

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9244 5 85
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9241 5 85
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9226 5 84
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9149 5 85
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9145 5 85
ID Description Score Start End Superfamily
af_Q47141_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9869 5 82 1.10.10.10
af_P0A8R9_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9795 5 85 1.10.10.10
af_Q2G1Q8_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9659 5 85 1.10.10.10
af_Q2FZS7_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9592 5 85 1.10.10.10
af_Q2FVT4_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9584 5 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Q5IPR2-F1-model_v4 Transcriptional regulator 0.9762 5 85 GO:0000976
GO:0003700
AF-A0A6N3U979-F1-model_v4 deleted 0.9729 5 77
AF-Q7UTS6-F1-model_v4 Probable transcription regulator, HTH_1 family 0.965 5 85 GO:0003677
GO:0003700
AF-A0A7X6IIS4-F1-model_v4 deleted 0.9371 5 82
AF-A0A6N3U979-F1-model_v4 deleted 0.9354 5 77

Feature Viewer

pLDDT pTM Quality
89.85 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map