F472996
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 345 | 1312 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100372740|Ga0070663_1003727402 |
| Length | 317 |
| Sequence | VIAKNVMTDKLEIVIPAGAGGEGDYSLSITPERAGWGYSSFKVLELAAGSTHTFATGEDEWVVLPLSGSCTVACDGETFTLAGRRGVFTRVTDFAYVPRDADTTVTSQDGGRFALCGARAQRRLTARYGPAEGVQVELRGAGQASRQVNNFCTPATFEADKLIAVEVITPGGNWSSFPPHKHDEAGPNESRLEEVYYFEADSGYAAGQAGACGYQRVYGSGPGKEIDVCAEVRTGDAILIPYGWHGPAMAAPGYDLYYLNVMAGPDPERVWKICDDPAHAWVRTLWDGQEIDPRLPLTSTVEKSSPEESGTEKEEVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 100 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 199 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 203 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 204 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 205 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 318 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 319 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 320 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 321 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 322 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 323 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 324 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 325 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 326 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 327 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 328 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 329 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 330 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 331 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 332 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 333 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 334 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 335 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 336 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 337 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 338 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 339 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 340 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 341 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 342 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 343 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 344 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 345 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.58 |
| Metatranscriptomes | 0.15 |
| Isolates | 4.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0 |
| Rhizoplane | 6.4 |
| Rhizosphere | 83.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070663_100372740 | 3300005455 | Bacteria | 1161 |
| 2 | JGI25405J52794_10009396 | 3300003911 | Bacteria | 1846 |
| 3 | Ga0070683_100163023 | 3300005329 | Bacteria | 2115 |
| 4 | Ga0070683_100341451 | 3300005329 | Bacteria | 1426 |
| 5 | Ga0070683_100344994 | 3300005329 | Bacteria | 1418 |
| 6 | Ga0068869_100264239 | 3300005334 | Bacteria | 1378 |
| 7 | Ga0070680_100013951 | 3300005336 | Bacteria | 6271 |
| 8 | Ga0068868_100114912 | 3300005338 | Bacteria | 2190 |
| 9 | Ga0068868_100231464 | 3300005338 | Bacteria | 1550 |
| 10 | Ga0070660_100281849 | 3300005339 | Bacteria | 1360 |
| 11 | Ga0070660_100319860 | 3300005339 | Bacteria | 1274 |
| 12 | Ga0070687_100027165 | 3300005343 | Bacteria | 2761 |
| 13 | Ga0070661_100075807 | 3300005344 | Bacteria | 2478 |
| 14 | Ga0070661_100316528 | 3300005344 | Bacteria | 1218 |
| 15 | Ga0070668_100000258 | 3300005347 | Bacteria | 35205 |
| 16 | Ga0070669_100003538 | 3300005353 | Bacteria | 11269 |
| 17 | Ga0070669_100054966 | 3300005353 | Bacteria | 2917 |
| 18 | Ga0070688_100123905 | 3300005365 | Bacteria | 1735 |
| 19 | Ga0070667_100000077 | 3300005367 | Bacteria | 120245 |
| 20 | Ga0070667_100019017 | 3300005367 | Bacteria | 5695 |
| 21 | Ga0070667_100047178 | 3300005367 | Bacteria | 3624 |
| 22 | Ga0070709_10013070 | 3300005434 | Bacteria | 4660 |
| 23 | Ga0070709_10173513 | 3300005434 | Bacteria | 1509 |
| 24 | Ga0070709_10419568 | 3300005434 | Bacteria | 1002 |
| 25 | Ga0070714_100032801 | 3300005435 | Bacteria | 4337 |
| 26 | Ga0070714_100048621 | 3300005435 | Bacteria | 3608 |
| 27 | Ga0070714_100071213 | 3300005435 | Bacteria | 3005 |
| 28 | Ga0070713_100024532 | 3300005436 | Bacteria | 4699 |
| 29 | Ga0070713_100202114 | 3300005436 | Bacteria | 1795 |
| 30 | Ga0070710_10140986 | 3300005437 | Bacteria | 1478 |
| 31 | Ga0070710_10177488 | 3300005437 | Bacteria | 1331 |
| 32 | Ga0070701_10001956 | 3300005438 | Bacteria | 7804 |
| 33 | Ga0070701_10019488 | 3300005438 | Bacteria | 3205 |
| 34 | Ga0070711_100045175 | 3300005439 | Bacteria | 2994 |
| 35 | Ga0070711_100071752 | 3300005439 | Bacteria | 2442 |
| 36 | Ga0070700_100037644 | 3300005441 | Bacteria | 2944 |
| 37 | Ga0070700_100040522 | 3300005441 | Bacteria | 2851 |
| 38 | Ga0070694_100209690 | 3300005444 | Bacteria | 1456 |
| 39 | Ga0070708_100009370 | 3300005445 | Bacteria | 7893 |
| 40 | Ga0070708_100186943 | 3300005445 | Bacteria | 1937 |
| 41 | Ga0070708_100267579 | 3300005445 | Bacteria | 1607 |
| 42 | Ga0070663_100060022 | 3300005455 | Bacteria | 2734 |
| 43 | Ga0070663_100171154 | 3300005455 | Bacteria | 1679 |
| 44 | Ga0070662_100483462 | 3300005457 | Bacteria | 1031 |
| 45 | Ga0070681_10027284 | 3300005458 | Bacteria | 5741 |
| 46 | Ga0070685_10024072 | 3300005466 | Bacteria | 3341 |
| 47 | Ga0070706_100135561 | 3300005467 | Bacteria | 2298 |
| 48 | Ga0070707_100044139 | 3300005468 | Bacteria | 4267 |
| 49 | Ga0070707_100059687 | 3300005468 | Bacteria | 3658 |
| 50 | Ga0070707_100135050 | 3300005468 | Bacteria | 2400 |
| 51 | Ga0070698_100003844 | 3300005471 | Bacteria | 16514 |
| 52 | Ga0070698_100036644 | 3300005471 | Bacteria | 5064 |
| 53 | Ga0070698_100107775 | 3300005471 | Bacteria | 2753 |
| 54 | Ga0070698_100109163 | 3300005471 | Bacteria | 2734 |
| 55 | Ga0070699_100011563 | 3300005518 | Bacteria | 7620 |
| 56 | Ga0070679_100133509 | 3300005530 | Bacteria | 2463 |
| 57 | Ga0070684_100067903 | 3300005535 | Bacteria | 3132 |
| 58 | Ga0070684_100393095 | 3300005535 | Bacteria | 1278 |
| 59 | Ga0070684_100474416 | 3300005535 | Bacteria | 1157 |
| 60 | Ga0070684_100588735 | 3300005535 | Bacteria | 1034 |
| 61 | Ga0068853_100048944 | 3300005539 | Bacteria | 3631 |
| 62 | Ga0070693_100037775 | 3300005547 | Bacteria | 2695 |
| 63 | Ga0070693_100220684 | 3300005547 | Bacteria | 1242 |
| 64 | Ga0070665_100004932 | 3300005548 | Bacteria | 13838 |
| 65 | Ga0070665_100133315 | 3300005548 | Bacteria | 2486 |
| 66 | Ga0070665_100312442 | 3300005548 | Bacteria | 1575 |
| 67 | Ga0070665_100368594 | 3300005548 | Bacteria | 1443 |
| 68 | Ga0070665_100432938 | 3300005548 | Bacteria | 1324 |
| 69 | Ga0070665_100673478 | 3300005548 | Bacteria | 1047 |
| 70 | Ga0068855_100420420 | 3300005563 | Bacteria | 1462 |
| 71 | Ga0070664_100119666 | 3300005564 | Bacteria | 2304 |
| 72 | Ga0068857_100070741 | 3300005577 | Bacteria | 3108 |
| 73 | Ga0068854_100534025 | 3300005578 | Bacteria | 992 |
| 74 | Ga0068856_100107629 | 3300005614 | Bacteria | 2784 |
| 75 | Ga0070702_100106428 | 3300005615 | Bacteria | 1730 |
| 76 | Ga0068852_100103556 | 3300005616 | Bacteria | 2574 |
| 77 | Ga0068852_100206553 | 3300005616 | Bacteria | 1861 |
| 78 | Ga0068852_100309688 | 3300005616 | Bacteria | 1531 |
| 79 | Ga0068852_100397701 | 3300005616 | Bacteria | 1355 |
| 80 | Ga0068852_100690761 | 3300005616 | Bacteria | 1030 |
| 81 | Ga0068859_100000438 | 3300005617 | Bacteria | 41832 |
| 82 | Ga0068859_100082177 | 3300005617 | Bacteria | 3264 |
| 83 | Ga0068859_100176990 | 3300005617 | Bacteria | 2215 |
| 84 | Ga0068864_100131976 | 3300005618 | Bacteria | 2245 |
| 85 | Ga0068864_100157826 | 3300005618 | Bacteria | 2060 |
| 86 | Ga0068864_100176361 | 3300005618 | Bacteria | 1952 |
| 87 | Ga0068861_100087967 | 3300005719 | Bacteria | 2445 |
| 88 | Ga0068861_100456802 | 3300005719 | Bacteria | 1146 |
| 89 | Ga0068851_10049393 | 3300005834 | Bacteria | 2134 |
| 90 | Ga0068863_100000777 | 3300005841 | Bacteria | 32074 |
| 91 | Ga0068863_100050783 | 3300005841 | Bacteria | 3930 |
| 92 | Ga0068863_100076977 | 3300005841 | Bacteria | 3156 |
| 93 | Ga0068863_100183588 | 3300005841 | Bacteria | 2008 |
| 94 | Ga0068858_100008639 | 3300005842 | Bacteria | 9781 |
| 95 | Ga0068858_100028166 | 3300005842 | Bacteria | 5220 |
| 96 | Ga0068860_100000010 | 3300005843 | Bacteria | 359114 |
| 97 | Ga0068862_100000008 | 3300005844 | Bacteria | 305510 |
| 98 | Ga0068862_100282891 | 3300005844 | Bacteria | 1520 |
| 99 | Ga0081455_10010888 | 3300005937 | Bacteria | 9179 |
| 100 | Ga0081455_10139924 | 3300005937 | Bacteria | 1881 |
| 101 | Ga0081455_10283189 | 3300005937 | Bacteria | 1197 |
| 102 | Ga0081538_10001458 | 3300005981 | Bacteria | 24309 |
| 103 | Ga0081538_10018782 | 3300005981 | Bacteria | 5173 |
| 104 | Ga0081540_1000156 | 3300005983 | Bacteria | 70177 |
| 105 | Ga0081540_1054742 | 3300005983 | Bacteria | 1947 |
| 106 | Ga0070717_10068965 | 3300006028 | Bacteria | 2944 |
| 107 | Ga0070717_10182486 | 3300006028 | Bacteria | 1830 |
| 108 | Ga0070717_10240726 | 3300006028 | Bacteria | 1595 |
| 109 | Ga0075365_10039541 | 3300006038 | Bacteria | 3071 |
| 110 | Ga0075365_10326284 | 3300006038 | Bacteria | 1081 |
| 111 | Ga0075368_10004172 | 3300006042 | Bacteria | 4865 |
| 112 | Ga0075363_100003797 | 3300006048 | Bacteria | 6512 |
| 113 | Ga0075363_100024145 | 3300006048 | Bacteria | 3088 |
| 114 | Ga0075364_10012090 | 3300006051 | Bacteria | 5267 |
| 115 | Ga0075364_10190656 | 3300006051 | Bacteria | 1388 |
| 116 | Ga0070715_10051000 | 3300006163 | Bacteria | 1778 |
| 117 | Ga0070716_100055854 | 3300006173 | Bacteria | 2261 |
| 118 | Ga0070716_100071022 | 3300006173 | Bacteria | 2046 |
| 119 | Ga0070716_100087651 | 3300006173 | Bacteria | 1876 |
| 120 | Ga0070716_100155328 | 3300006173 | Bacteria | 1476 |
| 121 | Ga0070712_100228845 | 3300006175 | Bacteria | 1475 |
| 122 | Ga0075362_10006544 | 3300006177 | Bacteria | 4350 |
| 123 | Ga0075367_10021375 | 3300006178 | Bacteria | 3615 |
| 124 | Ga0075369_10043994 | 3300006186 | Bacteria | 1918 |
| 125 | Ga0075370_10021190 | 3300006353 | Bacteria | 3561 |
| 126 | Ga0068871_100169475 | 3300006358 | Bacteria | 1871 |
| 127 | Ga0068871_100201185 | 3300006358 | Bacteria | 1720 |
| 128 | Ga0075428_100016777 | 3300006844 | Bacteria | 8087 |
| 129 | Ga0075430_100141236 | 3300006846 | Bacteria | 2006 |
| 130 | Ga0075433_10237019 | 3300006852 | Bacteria | 1620 |
| 131 | Ga0075434_100000386 | 3300006871 | Bacteria | 32198 |
| 132 | Ga0075434_100126571 | 3300006871 | Bacteria | 2572 |
| 133 | Ga0097620_100000438 | 3300006931 | Bacteria | 41832 |
| 134 | Ga0097620_100082179 | 3300006931 | Bacteria | 3264 |
| 135 | Ga0097620_100177004 | 3300006931 | Bacteria | 2215 |
| 136 | Ga0105251_10019722 | 3300009011 | Bacteria | 3555 |
| 137 | Ga0105245_10017646 | 3300009098 | Bacteria | 6230 |
| 138 | Ga0105245_10449752 | 3300009098 | Bacteria | 1296 |
| 139 | Ga0105245_10527656 | 3300009098 | Bacteria | 1200 |
| 140 | Ga0105247_10000019 | 3300009101 | Bacteria | 245170 |
| 141 | Ga0105247_10201170 | 3300009101 | Bacteria | 1338 |
| 142 | Ga0114129_10106070 | 3300009147 | Bacteria | 3882 |
| 143 | Ga0105243_10000372 | 3300009148 | Bacteria | 48136 |
| 144 | Ga0105243_10027521 | 3300009148 | Bacteria | 4357 |
| 145 | Ga0105243_10164834 | 3300009148 | Bacteria | 1914 |
| 146 | Ga0105242_10412400 | 3300009176 | Bacteria | 1263 |
| 147 | Ga0105242_10494738 | 3300009176 | Bacteria | 1162 |
| 148 | Ga0105248_10000093 | 3300009177 | Bacteria | 98669 |
| 149 | Ga0105237_10114470 | 3300009545 | Bacteria | 2690 |
| 150 | Ga0105237_10641108 | 3300009545 | Bacteria | 1069 |
| 151 | Ga0105238_10318747 | 3300009551 | Bacteria | 1540 |
| 152 | Ga0105249_10000019 | 3300009553 | Bacteria | 273807 |
| 153 | Ga0105249_10141171 | 3300009553 | Bacteria | 2310 |
| 154 | Ga0105249_10465205 | 3300009553 | Bacteria | 1305 |
| 155 | Ga0099796_10036699 | 3300010159 | Bacteria | 1634 |
| 156 | Ga0105239_10098950 | 3300010375 | Bacteria | 3224 |
| 157 | Ga0105239_10535741 | 3300010375 | Bacteria | 1333 |
| 158 | Ga0105246_10211180 | 3300011119 | Bacteria | 1515 |
| 159 | Ga0105246_10435591 | 3300011119 | Bacteria | 1098 |
| 160 | Ga0157373_10250593 | 3300013100 | Bacteria | 1252 |
| 161 | Ga0157371_10200174 | 3300013102 | Bacteria | 1432 |
| 162 | Ga0157370_10017095 | 3300013104 | Bacteria | 7327 |
| 163 | Ga0157369_10312908 | 3300013105 | Bacteria | 1633 |
| 164 | Ga0157374_10021356 | 3300013296 | Bacteria | 5759 |
| 165 | Ga0157374_10087602 | 3300013296 | Bacteria | 2964 |
| 166 | Ga0157378_10331044 | 3300013297 | Bacteria | 1482 |
| 167 | Ga0157378_10560715 | 3300013297 | Bacteria | 1149 |
| 168 | Ga0163162_10254654 | 3300013306 | Bacteria | 1887 |
| 169 | Ga0163162_10348702 | 3300013306 | Bacteria | 1613 |
| 170 | Ga0157375_10051600 | 3300013308 | Bacteria | 4040 |
| 171 | Ga0157375_10294762 | 3300013308 | Bacteria | 1785 |
| 172 | Ga0157375_10394875 | 3300013308 | Bacteria | 1550 |
| 173 | Ga0163163_10015693 | 3300014325 | Bacteria | 7013 |
| 174 | Ga0163163_10018846 | 3300014325 | Bacteria | 6472 |
| 175 | Ga0163163_10108385 | 3300014325 | Bacteria | 2805 |
| 176 | Ga0163163_10681579 | 3300014325 | Bacteria | 1091 |
| 177 | Ga0157377_10012353 | 3300014745 | Bacteria | 4294 |
| 178 | Ga0157377_10015268 | 3300014745 | Bacteria | 3924 |
| 179 | Ga0157377_10174850 | 3300014745 | Bacteria | 1346 |
| 180 | Ga0157379_10037572 | 3300014968 | Bacteria | 4318 |
| 181 | Ga0157379_10143240 | 3300014968 | Bacteria | 2155 |
| 182 | Ga0157379_10210485 | 3300014968 | Bacteria | 1760 |
| 183 | Ga0157379_10240594 | 3300014968 | Bacteria | 1642 |
| 184 | Ga0157376_10017900 | 3300014969 | Bacteria | 5417 |
| 185 | Ga0157376_10439643 | 3300014969 | Bacteria | 1270 |
| 186 | Ga0206354_10540157 | 3300020081 | Bacteria | 2359 |
| 187 | Ga0213874_10000085 | 3300021377 | Bacteria | 14558 |
| 188 | Ga0213874_10026100 | 3300021377 | Bacteria | 1653 |
| 189 | Ga0213875_10000423 | 3300021388 | Bacteria | 37021 |
| 190 | Ga0213875_10002053 | 3300021388 | Bacteria | 12369 |
| 191 | Ga0224572_1004754 | 3300024225 | Bacteria | 2387 |
| 192 | Ga0209673_1031481 | 3300025273 | Bacteria | 1650 |
| 193 | Ga0209051_1007785 | 3300025303 | Bacteria | 5793 |
| 194 | Ga0207653_10002345 | 3300025885 | Bacteria | 6031 |
| 195 | Ga0207692_10026892 | 3300025898 | Bacteria | 2703 |
| 196 | Ga0207692_10075902 | 3300025898 | Bacteria | 1784 |
| 197 | Ga0207692_10209866 | 3300025898 | Bacteria | 1149 |
| 198 | Ga0207642_10122561 | 3300025899 | Bacteria | 1344 |
| 199 | Ga0207710_10000036 | 3300025900 | Bacteria | 245176 |
| 200 | Ga0207710_10077607 | 3300025900 | Bacteria | 1535 |
| 201 | Ga0207688_10009339 | 3300025901 | Bacteria | 5347 |
| 202 | Ga0207688_10010018 | 3300025901 | Bacteria | 5155 |
| 203 | Ga0207688_10022607 | 3300025901 | Bacteria | 3442 |
| 204 | Ga0207680_10063111 | 3300025903 | Bacteria | 2266 |
| 205 | Ga0207685_10042741 | 3300025905 | Bacteria | 1704 |
| 206 | Ga0207699_10107780 | 3300025906 | Bacteria | 1780 |
| 207 | Ga0207699_10108722 | 3300025906 | Bacteria | 1773 |
| 208 | Ga0207645_10042033 | 3300025907 | Bacteria | 2925 |
| 209 | Ga0207645_10111892 | 3300025907 | Bacteria | 1768 |
| 210 | Ga0207643_10040982 | 3300025908 | Bacteria | 2608 |
| 211 | Ga0207705_10303422 | 3300025909 | Bacteria | 1225 |
| 212 | Ga0207654_10378700 | 3300025911 | Bacteria | 980 |
| 213 | Ga0207707_10020673 | 3300025912 | Bacteria | 5748 |
| 214 | Ga0207695_10336794 | 3300025913 | Bacteria | 1397 |
| 215 | Ga0207671_10138071 | 3300025914 | Bacteria | 1876 |
| 216 | Ga0207671_10464236 | 3300025914 | Bacteria | 1009 |
| 217 | Ga0207693_10017461 | 3300025915 | Bacteria | 5723 |
| 218 | Ga0207693_10183202 | 3300025915 | Bacteria | 1648 |
| 219 | Ga0207663_10063303 | 3300025916 | Bacteria | 2355 |
| 220 | Ga0207663_10094214 | 3300025916 | Bacteria | 1995 |
| 221 | Ga0207663_10108141 | 3300025916 | Bacteria | 1882 |
| 222 | Ga0207663_10165354 | 3300025916 | Bacteria | 1566 |
| 223 | Ga0207660_10207933 | 3300025917 | Bacteria | 1531 |
| 224 | Ga0207660_10361807 | 3300025917 | Bacteria | 1164 |
| 225 | Ga0207662_10002478 | 3300025918 | Bacteria | 9267 |
| 226 | Ga0207662_10008401 | 3300025918 | Bacteria | 5652 |
| 227 | Ga0207657_10012369 | 3300025919 | Bacteria | 8430 |
| 228 | Ga0207657_10036933 | 3300025919 | Bacteria | 4369 |
| 229 | Ga0207646_10030314 | 3300025922 | Bacteria | 4905 |
| 230 | Ga0207646_10052184 | 3300025922 | Bacteria | 3659 |
| 231 | Ga0207646_10062007 | 3300025922 | Bacteria | 3338 |
| 232 | Ga0207646_10529302 | 3300025922 | Bacteria | 1061 |
| 233 | Ga0207681_10000911 | 3300025923 | Bacteria | 19299 |
| 234 | Ga0207687_10057575 | 3300025927 | Bacteria | 2731 |
| 235 | Ga0207687_10147140 | 3300025927 | Bacteria | 1793 |
| 236 | Ga0207687_10192749 | 3300025927 | Bacteria | 1587 |
| 237 | Ga0207700_10065026 | 3300025928 | Bacteria | 2781 |
| 238 | Ga0207700_10160561 | 3300025928 | Bacteria | 1866 |
| 239 | Ga0207700_10263299 | 3300025928 | Bacteria | 1477 |
| 240 | Ga0207700_10341897 | 3300025928 | Bacteria | 1301 |
| 241 | Ga0207664_10011884 | 3300025929 | Bacteria | 6211 |
| 242 | Ga0207664_10057718 | 3300025929 | Bacteria | 3086 |
| 243 | Ga0207664_10076777 | 3300025929 | Bacteria | 2705 |
| 244 | Ga0207664_10444799 | 3300025929 | Bacteria | 1156 |
| 245 | Ga0207690_10313774 | 3300025932 | Bacteria | 1230 |
| 246 | Ga0207690_10529230 | 3300025932 | Bacteria | 956 |
| 247 | Ga0207706_10095142 | 3300025933 | Bacteria | 2620 |
| 248 | Ga0207706_10302382 | 3300025933 | Bacteria | 1394 |
| 249 | Ga0207709_10002002 | 3300025935 | Bacteria | 13232 |
| 250 | Ga0207709_10299567 | 3300025935 | Bacteria | 1195 |
| 251 | Ga0207669_10092926 | 3300025937 | Bacteria | 1970 |
| 252 | Ga0207669_10200170 | 3300025937 | Bacteria | 1449 |
| 253 | Ga0207704_10219128 | 3300025938 | Bacteria | 1406 |
| 254 | Ga0207704_10249053 | 3300025938 | Bacteria | 1332 |
| 255 | Ga0207665_10004169 | 3300025939 | Bacteria | 9619 |
| 256 | Ga0207665_10051344 | 3300025939 | Bacteria | 2775 |
| 257 | Ga0207665_10084666 | 3300025939 | Bacteria | 2188 |
| 258 | Ga0207691_10099060 | 3300025940 | Bacteria | 2603 |
| 259 | Ga0207691_10187442 | 3300025940 | Bacteria | 1805 |
| 260 | Ga0207711_10000102 | 3300025941 | Bacteria | 90198 |
| 261 | Ga0207711_10164031 | 3300025941 | Bacteria | 2013 |
| 262 | Ga0207689_10004040 | 3300025942 | Bacteria | 13331 |
| 263 | Ga0207689_10055206 | 3300025942 | Bacteria | 3270 |
| 264 | Ga0207689_10254047 | 3300025942 | Bacteria | 1454 |
| 265 | Ga0207661_10538163 | 3300025944 | Bacteria | 1069 |
| 266 | Ga0207651_10076439 | 3300025960 | Bacteria | 2394 |
| 267 | Ga0207651_10295137 | 3300025960 | Bacteria | 1346 |
| 268 | Ga0207712_10000025 | 3300025961 | Bacteria | 274015 |
| 269 | Ga0207712_10074304 | 3300025961 | Bacteria | 2454 |
| 270 | Ga0207712_10190367 | 3300025961 | Bacteria | 1619 |
| 271 | Ga0207668_10000858 | 3300025972 | Bacteria | 18305 |
| 272 | Ga0207668_10000935 | 3300025972 | Bacteria | 17554 |
| 273 | Ga0207668_10102085 | 3300025972 | Bacteria | 2133 |
| 274 | Ga0207668_10191044 | 3300025972 | Bacteria | 1623 |
| 275 | Ga0207658_10000593 | 3300025986 | Bacteria | 32472 |
| 276 | Ga0207677_10039843 | 3300026023 | Bacteria | 3093 |
| 277 | Ga0207703_10019127 | 3300026035 | Bacteria | 5349 |
| 278 | Ga0207639_10430164 | 3300026041 | Bacteria | 1195 |
| 279 | Ga0207678_10001755 | 3300026067 | Bacteria | 19865 |
| 280 | Ga0207678_10007984 | 3300026067 | Bacteria | 9331 |
| 281 | Ga0207678_10069339 | 3300026067 | Bacteria | 3023 |
| 282 | Ga0207678_10141730 | 3300026067 | Bacteria | 2051 |
| 283 | Ga0207708_10006333 | 3300026075 | Bacteria | 8773 |
| 284 | Ga0207708_10134055 | 3300026075 | Bacteria | 1938 |
| 285 | Ga0207708_10259102 | 3300026075 | Bacteria | 1403 |
| 286 | Ga0207702_10046796 | 3300026078 | Bacteria | 3643 |
| 287 | Ga0207702_10051480 | 3300026078 | Bacteria | 3480 |
| 288 | Ga0207641_10001204 | 3300026088 | Bacteria | 25896 |
| 289 | Ga0207641_10097094 | 3300026088 | Bacteria | 2589 |
| 290 | Ga0207641_10273571 | 3300026088 | Bacteria | 1586 |
| 291 | Ga0207676_10041296 | 3300026095 | Bacteria | 3540 |
| 292 | Ga0207676_10104628 | 3300026095 | Bacteria | 2355 |
| 293 | Ga0207676_10502077 | 3300026095 | Bacteria | 1152 |
| 294 | Ga0207674_10003683 | 3300026116 | Bacteria | 18700 |
| 295 | Ga0207674_10024205 | 3300026116 | Bacteria | 6492 |
| 296 | Ga0207675_100038196 | 3300026118 | Bacteria | 4480 |
| 297 | Ga0207675_100154012 | 3300026118 | Bacteria | 2189 |
| 298 | Ga0207675_100301889 | 3300026118 | Bacteria | 1560 |
| 299 | Ga0207683_10001399 | 3300026121 | Bacteria | 21779 |
| 300 | Ga0207683_10204388 | 3300026121 | Bacteria | 1796 |
| 301 | Ga0207698_10126177 | 3300026142 | Bacteria | 2177 |
| 302 | Ga0207698_10150377 | 3300026142 | Bacteria | 2020 |
| 303 | Ga0207698_10236013 | 3300026142 | Bacteria | 1663 |
| 304 | Ga0207698_10236606 | 3300026142 | Bacteria | 1661 |
| 305 | Ga0207698_10320651 | 3300026142 | Bacteria | 1451 |
| 306 | Ga0207698_10502371 | 3300026142 | Bacteria | 1180 |
| 307 | Ga0207698_10552144 | 3300026142 | Bacteria | 1129 |
| 308 | Ga0268266_10069140 | 3300028379 | Bacteria | 3059 |
| 309 | Ga0268266_10069577 | 3300028379 | Bacteria | 3050 |
| 310 | Ga0268266_10187352 | 3300028379 | Bacteria | 1888 |
| 311 | Ga0268266_10232041 | 3300028379 | Bacteria | 1700 |
| 312 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 313 | Ga0268265_10046065 | 3300028380 | Bacteria | 3258 |
| 314 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 315 | Ga0307513_10000099 | 3300031456 | Bacteria | 125847 |
| 316 | Ga0307513_10028657 | 3300031456 | Bacteria | 6361 |
| 317 | Ga0307508_10019206 | 3300031616 | Bacteria | 6213 |
| 318 | Ga0307508_10037884 | 3300031616 | Bacteria | 4335 |
| 319 | Ga0307508_10240419 | 3300031616 | Bacteria | 1408 |
| 320 | Ga0307516_10005615 | 3300031730 | Bacteria | 14931 |
| 321 | Ga0307405_10069564 | 3300031731 | Bacteria | 2257 |
| 322 | Ga0307413_10013785 | 3300031824 | Bacteria | 4080 |
| 323 | Ga0307413_10361296 | 3300031824 | Bacteria | 1124 |
| 324 | Ga0307410_10049347 | 3300031852 | Bacteria | 2825 |
| 325 | Ga0307410_10288707 | 3300031852 | Bacteria | 1290 |
| 326 | Ga0307406_10203365 | 3300031901 | Bacteria | 1460 |
| 327 | Ga0307406_10295725 | 3300031901 | Bacteria | 1241 |
| 328 | Ga0307407_10054524 | 3300031903 | Bacteria | 2306 |
| 329 | Ga0307407_10113276 | 3300031903 | Bacteria | 1706 |
| 330 | Ga0307409_100026229 | 3300031995 | Bacteria | 4105 |
| 331 | Ga0307416_100019592 | 3300032002 | Bacteria | 4803 |
| 332 | Ga0307415_100150226 | 3300032126 | Bacteria | 1792 |
| 333 | Ga0373948_0000204 | 3300034817 | Bacteria | 6830 |
| 334 | Ga0373926_0001463 | 3300035083 | Bacteria | 7191 |
| 335 | Ga0373926_0017008 | 3300035083 | Bacteria | 2492 |
| 336 | Ga0373926_0058420 | 3300035083 | Bacteria | 1402 |
| 337 | Ga0373934_0011207 | 3300035086 | Bacteria | 3374 |
| 338 | Ga0373934_0020842 | 3300035086 | Bacteria | 2522 |
| 339 | Ga0373934_0102956 | 3300035086 | Bacteria | 1154 |
| 340 | Ga0373944_0001058 | 3300035089 | Bacteria | 6803 |
| 341 | Ga0373944_0004526 | 3300035089 | Bacteria | 3626 |
| 342 | Ga0373944_0040359 | 3300035089 | Bacteria | 1440 |
| 343 | Ga0373951_0000039 | 3300035091 | Bacteria | 51245 |
| 344 | Ga0373951_0007932 | 3300035091 | Bacteria | 2406 |
| 345 | Ga0373923_0010339 | 3300035111 | Bacteria | 3392 |
| 346 | Ga0373923_0047755 | 3300035111 | Bacteria | 1785 |
| 347 | Ga0373932_0007992 | 3300035112 | Bacteria | 2525 |
| 348 | Ga0373936_0002239 | 3300035113 | Bacteria | 7226 |
| 349 | Ga0373936_0026026 | 3300035113 | Bacteria | 2290 |
| 350 | Ga0373945_0001355 | 3300035116 | Bacteria | 7448 |
| 351 | Ga0373945_0105211 | 3300035116 | Bacteria | 1108 |
| 352 | Ga0373953_0040653 | 3300035117 | Bacteria | 1847 |
| 353 | Ga0373953_0061716 | 3300035117 | Bacteria | 1533 |
| 354 | Ga0373953_0114476 | 3300035117 | Bacteria | 1142 |
| 355 | Ga0373954_0045129 | 3300035118 | Bacteria | 2058 |
| 356 | Ga0373954_0085719 | 3300035118 | Bacteria | 1508 |
| 357 | Ga0373956_0003308 | 3300035119 | Bacteria | 6498 |
| 358 | Ga0373956_0013708 | 3300035119 | Bacteria | 3375 |
| 359 | Ga0373956_0063674 | 3300035119 | Bacteria | 1673 |
| 360 | Ga0373956_0066636 | 3300035119 | Bacteria | 1638 |
| 361 | Ga0373957_0032276 | 3300035120 | Bacteria | 1927 |
| 362 | Ga0373957_0069699 | 3300035120 | Bacteria | 1373 |
| 363 | Ga0373943_0000325 | 3300035170 | Bacteria | 19885 |
| 364 | Ga0373943_0112309 | 3300035170 | Bacteria | 1438 |
| 365 | Ga0373946_0000069 | 3300035171 | Bacteria | 27568 |
| 366 | Ga0373946_0032964 | 3300035171 | Bacteria | 2082 |
| 367 | Ga0373946_0096462 | 3300035171 | Bacteria | 1318 |
| 368 | Ga0373955_0008122 | 3300035172 | Bacteria | 4855 |
| 369 | Ga0373955_0027930 | 3300035172 | Bacteria | 2921 |
| 370 | Ga0373955_0045263 | 3300035172 | Bacteria | 2374 |
| 371 | Ga0373924_0005189 | 3300035410 | Bacteria | 4598 |
| 372 | Ga0373924_0163983 | 3300035410 | Bacteria | 975 |
| 373 | Ga0373931_0174836 | 3300035691 | Bacteria | 1268 |
| 374 | Ga0373935_0003836 | 3300035692 | Bacteria | 8767 |
| 375 | Ga0373935_0018326 | 3300035692 | Bacteria | 4256 |
| 376 | Ga0373935_0031499 | 3300035692 | Bacteria | 3292 |
| 377 | Ga0373935_0420021 | 3300035692 | Bacteria | 962 |
| 378 | Ga0373927_0001455 | 3300035695 | Bacteria | 17854 |
| 379 | Ga0373927_0002533 | 3300035695 | Bacteria | 13329 |
| 380 | Ga0373933_0000434 | 3300035724 | Bacteria | 26252 |
| 381 | Ga0373933_0029361 | 3300035724 | Bacteria | 3179 |
| 382 | Ga0373933_0097975 | 3300035724 | Bacteria | 1816 |
| 383 | Ga0373947_0001505 | 3300035725 | Bacteria | 14300 |
| 384 | Ga0373947_0104754 | 3300035725 | Bacteria | 1781 |
| 385 | Ga0373947_0302615 | 3300035725 | Bacteria | 1066 |
| 386 | Ga0373937_0005355 | 3300036401 | Bacteria | 10973 |
| 387 | Ga0373937_0066635 | 3300036401 | Bacteria | 3316 |
| 388 | Ga0373937_0096663 | 3300036401 | Bacteria | 2739 |
| 389 | Ga0373937_0213554 | 3300036401 | Bacteria | 1815 |
| 390 | Ga0373937_0257574 | 3300036401 | Bacteria | 1645 |
| 391 | Ga0373925_0020535 | 3300037068 | Bacteria | 4809 |
| 392 | Ga0373925_0081441 | 3300037068 | Bacteria | 2461 |
| 393 | Ga0373925_0263269 | 3300037068 | Bacteria | 1385 |
| 394 | Ga0373925_0263327 | 3300037068 | Bacteria | 1385 |
| 395 | Ga0395900_0337245 | 3300037418 | Bacteria | 1484 |
| 396 | Ga0395898_0029201 | 3300037466 | Bacteria | 5525 |
| 397 | Ga0395905_0092070 | 3300037471 | Bacteria | 2843 |
| 398 | Ga0436364_0735608 | 3300037853 | Bacteria | 41179 |
| 399 | Ga0436364_0838309 | 3300037853 | Bacteria | 1996 |
| 400 | Ga0436364_0862533 | 3300037853 | Bacteria | 12375 |
| 401 | Ga0395901_0066546 | 3300038443 | Bacteria | 3753 |
| 402 | Ga0436365_1234929 | 3300039437 | Bacteria | 1980 |
| 403 | Ga0436365_1703157 | 3300039437 | Bacteria | 1008 |
| 404 | Ga0436363_0164243 | 3300039450 | Bacteria | 2830 |
| 405 | Ga0436363_0825219 | 3300039450 | Bacteria | 14890 |
| 406 | Ga0439436_0005053 | 3300041404 | Bacteria | 4041 |
| 407 | Ga0439438_013265 | 3300041405 | Bacteria | 2492 |
| 408 | Ga0451807_1301487 | 3300041486 | Bacteria | 1300 |
| 409 | Ga0439449_0000216 | 3300042007 | Bacteria | 20485 |
| 410 | Ga0439457_006206 | 3300042014 | Bacteria | 2942 |
| 411 | Ga0439463_000928 | 3300042016 | Bacteria | 8037 |
| 412 | Ga0439464_0019912 | 3300042439 | Bacteria | 1834 |
| 413 | Ga0439464_0025373 | 3300042439 | Bacteria | 1641 |
| 414 | Ga0439440_0003462 | 3300042993 | Bacteria | 3041 |
| 415 | Ga0466965_0187958 | 3300044683 | Bacteria | 1092 |
| 416 | Ga0466963_0020613 | 3300044694 | Bacteria | 4146 |
| 417 | Ga0466963_0227983 | 3300044694 | Bacteria | 1305 |
| 418 | Ga0466957_0171689 | 3300044842 | Bacteria | 1413 |
| 419 | Ga0466967_0047459 | 3300045976 | Bacteria | 3744 |
| 420 | Ga0466967_0092960 | 3300045976 | Bacteria | 2744 |
| 421 | Ga0466967_0208199 | 3300045976 | Bacteria | 1854 |
| 422 | Ga0495592_0024346 | 3300046454 | Bacteria | 4603 |
| 423 | Ga0495592_0029555 | 3300046454 | Bacteria | 4149 |
| 424 | Ga0495592_0058465 | 3300046454 | Bacteria | 2844 |
| 425 | Ga0495629_0008427 | 3300046459 | Bacteria | 7587 |
| 426 | Ga0495629_0093762 | 3300046459 | Bacteria | 2095 |
| 427 | Ga0495641_0008239 | 3300046461 | Bacteria | 6382 |
| 428 | Ga0495641_0078155 | 3300046461 | Bacteria | 1483 |
| 429 | Ga0495651_0022055 | 3300046462 | Bacteria | 4952 |
| 430 | Ga0495651_0025478 | 3300046462 | Bacteria | 4604 |
| 431 | Ga0495651_0025943 | 3300046462 | Bacteria | 4562 |
| 432 | Ga0495651_0045168 | 3300046462 | Bacteria | 3413 |
| 433 | Ga0495653_0029313 | 3300046463 | Bacteria | 4395 |
| 434 | Ga0495653_0034662 | 3300046463 | Bacteria | 3988 |
| 435 | Ga0495580_0048944 | 3300046472 | Bacteria | 2990 |
| 436 | Ga0495580_0066432 | 3300046472 | Bacteria | 2524 |
| 437 | Ga0495582_0026256 | 3300046473 | Bacteria | 3192 |
| 438 | Ga0495639_0009968 | 3300046475 | Bacteria | 4083 |
| 439 | Ga0495639_0012393 | 3300046475 | Bacteria | 3677 |
| 440 | Ga0495662_0000819 | 3300046476 | Bacteria | 15106 |
| 441 | Ga0495662_0004408 | 3300046476 | Bacteria | 7068 |
| 442 | Ga0495664_0000883 | 3300046477 | Bacteria | 15417 |
| 443 | Ga0495664_0003645 | 3300046477 | Bacteria | 8392 |
| 444 | Ga0495664_0114570 | 3300046477 | Bacteria | 1629 |
| 445 | Ga0495594_0009238 | 3300046499 | Bacteria | 5089 |
| 446 | Ga0495594_0096576 | 3300046499 | Bacteria | 1660 |
| 447 | Ga0495606_0052930 | 3300046507 | Bacteria | 2636 |
| 448 | Ga0495608_0028889 | 3300046511 | Bacteria | 3767 |
| 449 | Ga0495608_0029982 | 3300046511 | Bacteria | 3685 |
| 450 | Ga0495608_0068113 | 3300046511 | Bacteria | 2327 |
| 451 | Ga0495618_0053268 | 3300046514 | Bacteria | 2558 |
| 452 | Ga0495618_0325986 | 3300046514 | Bacteria | 950 |
| 453 | Ga0495620_0114420 | 3300046515 | Bacteria | 1067 |
| 454 | Ga0495628_0018892 | 3300046516 | Bacteria | 5704 |
| 455 | Ga0495628_0063073 | 3300046516 | Bacteria | 2904 |
| 456 | Ga0495630_0050896 | 3300046517 | Bacteria | 3099 |
| 457 | Ga0495630_0277579 | 3300046517 | Bacteria | 1280 |
| 458 | Ga0495666_0087198 | 3300046526 | Bacteria | 1474 |
| 459 | Ga0495666_0183052 | 3300046526 | Bacteria | 967 |
| 460 | Ga0495652_0023577 | 3300046529 | Bacteria | 5456 |
| 461 | Ga0495652_0025743 | 3300046529 | Bacteria | 5200 |
| 462 | Ga0495652_0035521 | 3300046529 | Bacteria | 4338 |
| 463 | Ga0495665_0002411 | 3300046531 | Bacteria | 10101 |
| 464 | Ga0495665_0004125 | 3300046531 | Bacteria | 7834 |
| 465 | Ga0495665_0014147 | 3300046531 | Bacteria | 4306 |
| 466 | Ga0495640_0010552 | 3300046533 | Bacteria | 7130 |
| 467 | Ga0495640_0027073 | 3300046533 | Bacteria | 4138 |
| 468 | Ga0495640_0061442 | 3300046533 | Bacteria | 2552 |
| 469 | Ga0495586_0046288 | 3300046535 | Bacteria | 2345 |
| 470 | Ga0495586_0077666 | 3300046535 | Bacteria | 1820 |
| 471 | Ga0495587_0002559 | 3300046536 | Bacteria | 12147 |
| 472 | Ga0495645_0138447 | 3300046543 | Bacteria | 1700 |
| 473 | Ga0495645_0175013 | 3300046543 | Bacteria | 1474 |
| 474 | Ga0495667_0015949 | 3300046559 | Bacteria | 5078 |
| 475 | Ga0495667_0045814 | 3300046559 | Bacteria | 2893 |
| 476 | Ga0495667_0046453 | 3300046559 | Bacteria | 2871 |
| 477 | Ga0495667_0072397 | 3300046559 | Bacteria | 2246 |
| 478 | Ga0495667_0167141 | 3300046559 | Bacteria | 1414 |
| 479 | Ga0495668_0000128 | 3300046616 | Bacteria | 113090 |
| 480 | Ga0495634_0010342 | 3300046642 | Bacteria | 6836 |
| 481 | Ga0495634_0067153 | 3300046642 | Bacteria | 2372 |
| 482 | Ga0495634_0111847 | 3300046642 | Bacteria | 1755 |
| 483 | Ga0495635_0008079 | 3300046663 | Bacteria | 7352 |
| 484 | Ga0495635_0034952 | 3300046663 | Bacteria | 3485 |
| 485 | Ga0495635_0066121 | 3300046663 | Bacteria | 2479 |
| 486 | Ga0495635_0088451 | 3300046663 | Bacteria | 2119 |
| 487 | Ga0495588_0004164 | 3300046674 | Bacteria | 6376 |
| 488 | Ga0495588_0092392 | 3300046674 | Bacteria | 1586 |
| 489 | Ga0495657_0005036 | 3300046675 | Bacteria | 10498 |
| 490 | Ga0495657_0029175 | 3300046675 | Bacteria | 3871 |
| 491 | Ga0495657_0270262 | 3300046675 | Bacteria | 1019 |
| 492 | Ga0495599_0011459 | 3300046678 | Bacteria | 5448 |
| 493 | Ga0495623_0026928 | 3300046679 | Bacteria | 3699 |
| 494 | Ga0495646_0001127 | 3300046680 | Bacteria | 15586 |
| 495 | Ga0495647_0059680 | 3300046681 | Bacteria | 1502 |
| 496 | Ga0495647_0150932 | 3300046681 | Bacteria | 996 |
| 497 | Ga0495658_0043710 | 3300046683 | Bacteria | 2507 |
| 498 | Ga0495658_0068312 | 3300046683 | Bacteria | 2057 |
| 499 | Ga0495613_0085387 | 3300046689 | Bacteria | 2290 |
| 500 | Ga0495624_0003425 | 3300046690 | Bacteria | 11767 |
| 501 | Ga0495624_0122668 | 3300046690 | Bacteria | 1595 |
| 502 | Ga0495600_0008622 | 3300046809 | Bacteria | 6271 |
| 503 | Ga0495600_0025387 | 3300046809 | Bacteria | 3819 |
| 504 | Ga0495600_0083815 | 3300046809 | Bacteria | 2080 |
| 505 | Ga0495600_0111344 | 3300046809 | Bacteria | 1782 |
| 506 | Ga0495600_0176505 | 3300046809 | Bacteria | 1377 |
| 507 | Ga0495581_0002848 | 3300047315 | Bacteria | 9874 |
| 508 | Ga0495581_0024247 | 3300047315 | Bacteria | 3516 |
| 509 | Ga0495581_0036876 | 3300047315 | Bacteria | 2828 |
| 510 | Ga0495604_0270334 | 3300047317 | Bacteria | 1152 |
| 511 | Ga0495674_0000343 | 3300047319 | Bacteria | 41172 |
| 512 | Ga0495676_0004107 | 3300047321 | Bacteria | 13268 |
| 513 | Ga0495680_0012359 | 3300047322 | Bacteria | 7516 |
| 514 | Ga0495680_0020099 | 3300047322 | Bacteria | 5626 |
| 515 | Ga0495680_0090031 | 3300047322 | Bacteria | 2302 |
| 516 | Ga0495675_0004360 | 3300047444 | Bacteria | 8564 |
| 517 | Ga0495675_0025707 | 3300047444 | Bacteria | 3752 |
| 518 | Ga0495675_0072148 | 3300047444 | Bacteria | 2178 |
| 519 | Ga0495675_0175785 | 3300047444 | Bacteria | 1313 |
| 520 | Ga0495684_0009563 | 3300047471 | Bacteria | 7473 |
| 521 | Ga0495684_0022169 | 3300047471 | Bacteria | 4890 |
| 522 | Ga0495684_0029003 | 3300047471 | Bacteria | 4246 |
| 523 | Ga0495684_0117732 | 3300047471 | Bacteria | 2002 |
| 524 | Ga0495686_0011309 | 3300047472 | Bacteria | 6292 |
| 525 | Ga0495593_0003879 | 3300047673 | Bacteria | 8935 |
| 526 | Ga0495593_0055727 | 3300047673 | Bacteria | 2080 |
| 527 | Ga0495602_0036471 | 3300048088 | Bacteria | 4576 |
| 528 | Ga0495602_0036550 | 3300048088 | Bacteria | 4570 |
| 529 | Ga0495602_0241369 | 3300048088 | Bacteria | 1351 |
| 530 | Ga0496100_0001703 | 3300048903 | Bacteria | 10932 |
| 531 | Ga0496100_0006878 | 3300048903 | Bacteria | 6228 |
| 532 | Ga0496100_0063813 | 3300048903 | Bacteria | 2435 |
| 533 | Ga0496101_0001379 | 3300048904 | Bacteria | 14555 |
| 534 | Ga0496101_0022710 | 3300048904 | Bacteria | 4323 |
| 535 | Ga0496101_0270373 | 3300048904 | Bacteria | 1327 |
| 536 | Ga0496102_0000112 | 3300048905 | Bacteria | 116902 |
| 537 | Ga0496102_0157698 | 3300048905 | Bacteria | 2134 |
| 538 | Ga0496102_0308478 | 3300048905 | Bacteria | 1491 |
| 539 | Ga0496103_0002741 | 3300048906 | Bacteria | 10996 |
| 540 | Ga0496104_0019375 | 3300048907 | Bacteria | 6223 |
| 541 | Ga0496105_0004460 | 3300048908 | Bacteria | 10543 |
| 542 | Ga0496105_0050648 | 3300048908 | Bacteria | 3430 |
| 543 | Ga0496106_0009897 | 3300048909 | Bacteria | 7039 |
| 544 | Ga0496106_0061596 | 3300048909 | Bacteria | 2847 |
| 545 | Ga0496106_0136520 | 3300048909 | Bacteria | 1927 |
| 546 | Ga0496107_0034883 | 3300048910 | Bacteria | 3606 |
| 547 | Ga0496107_0122920 | 3300048910 | Bacteria | 1913 |
| 548 | Ga0496107_0125425 | 3300048910 | Bacteria | 1893 |
| 549 | Ga0496107_0242096 | 3300048910 | Bacteria | 1342 |
| 550 | Ga0496108_0008900 | 3300048911 | Bacteria | 8138 |
| 551 | Ga0496108_0015327 | 3300048911 | Bacteria | 6253 |
| 552 | Ga0496108_0026069 | 3300048911 | Bacteria | 4821 |
| 553 | Ga0496109_0006061 | 3300048912 | Bacteria | 10157 |
| 554 | Ga0496109_0162133 | 3300048912 | Bacteria | 2095 |
| 555 | Ga0496109_0318500 | 3300048912 | Bacteria | 1467 |
| 556 | Ga0496110_0012686 | 3300048913 | Bacteria | 6935 |
| 557 | Ga0496110_0065173 | 3300048913 | Bacteria | 3220 |
| 558 | Ga0496110_0159542 | 3300048913 | Bacteria | 2044 |
| 559 | Ga0496110_0240883 | 3300048913 | Bacteria | 1646 |
| 560 | Ga0496110_0356137 | 3300048913 | Bacteria | 1333 |
| 561 | Ga0496112_0202478 | 3300048915 | Bacteria | 1944 |
| 562 | Ga0496112_0243975 | 3300048915 | Bacteria | 1748 |
| 563 | Ga0496112_0247741 | 3300048915 | Bacteria | 1733 |
| 564 | Ga0496112_0342748 | 3300048915 | Bacteria | 1437 |
| 565 | Ga0496113_0262284 | 3300048916 | Bacteria | 1380 |
| 566 | Ga0496114_0003564 | 3300048917 | Bacteria | 11954 |
| 567 | Ga0496114_0046113 | 3300048917 | Bacteria | 3621 |
| 568 | Ga0496115_0004692 | 3300048918 | Bacteria | 9906 |
| 569 | Ga0496115_0013540 | 3300048918 | Bacteria | 6170 |
| 570 | Ga0496115_0497632 | 3300048918 | Bacteria | 980 |
| 571 | Ga0496117_0000719 | 3300048920 | Bacteria | 52226 |
| 572 | Ga0496118_0003063 | 3300048921 | Bacteria | 21476 |
| 573 | Ga0496119_0014589 | 3300048922 | Bacteria | 6129 |
| 574 | Ga0496120_0041032 | 3300048923 | Bacteria | 2715 |
| 575 | Ga0496121_0014867 | 3300048924 | Bacteria | 8209 |
| 576 | Ga0496124_0169980 | 3300048927 | Bacteria | 1689 |
| 577 | Ga0496126_0026694 | 3300048929 | Bacteria | 5530 |
| 578 | Ga0496126_0106834 | 3300048929 | Bacteria | 2442 |
| 579 | Ga0501031_0000083 | 3300049568 | Bacteria | 50175 |
| 580 | Ga0501032_0000601 | 3300049569 | Bacteria | 29108 |
| 581 | Ga0501033_0000592 | 3300049570 | Bacteria | 33579 |
| 582 | Ga0501034_0002926 | 3300049571 | Bacteria | 19796 |
| 583 | Ga0501036_0020214 | 3300049572 | Bacteria | 5591 |
| 584 | Ga0501037_0000322 | 3300049573 | Bacteria | 40752 |
| 585 | Ga0501038_0000509 | 3300049574 | Bacteria | 34127 |
| 586 | Ga0501043_0001904 | 3300049579 | Bacteria | 17886 |
| 587 | Ga0501046_0001129 | 3300049580 | Bacteria | 26074 |
| 588 | Ga0501047_0005717 | 3300049581 | Bacteria | 11705 |
| 589 | Ga0501047_0148413 | 3300049581 | Bacteria | 2221 |
| 590 | Ga0501048_0001870 | 3300049582 | Bacteria | 15969 |
| 591 | Ga0501067_0011242 | 3300049583 | Bacteria | 4954 |
| 592 | Ga0501067_0045547 | 3300049583 | Bacteria | 2436 |
| 593 | Ga0501068_0031267 | 3300049584 | Bacteria | 3161 |
| 594 | Ga0501069_0000435 | 3300049585 | Bacteria | 18994 |
| 595 | Ga0501070_0000486 | 3300049586 | Bacteria | 36121 |
| 596 | Ga0501070_0530921 | 3300049586 | Bacteria | 943 |
| 597 | Ga0501071_0042825 | 3300049587 | Bacteria | 3245 |
| 598 | Ga0501072_0339111 | 3300049588 | Bacteria | 1194 |
| 599 | Ga0501074_0000485 | 3300049590 | Bacteria | 24195 |
| 600 | Ga0501080_0002417 | 3300049742 | Bacteria | 16298 |
| 601 | Ga0501083_0147908 | 3300049744 | Bacteria | 1538 |
| 602 | Ga0501035_0003142 | 3300049822 | Bacteria | 15865 |
| 603 | Ga0501044_0001000 | 3300049823 | Bacteria | 34011 |
| 604 | nmdc:mga03683_6280_c1 | 3300050489 | Bacteria | 4059 |
| 605 | nmdc:mga03n38_8967_c1 | 3300050490 | Bacteria | 3614 |
| 606 | nmdc:mga00v17_345864_c1 | 3300050491 | Bacteria | 967 |
| 607 | nmdc:mga00v17_49151_c1 | 3300050491 | Bacteria | 2558 |
| 608 | nmdc:mga07m45_139841_c1 | 3300050496 | Bacteria | 1402 |
| 609 | nmdc:mga07m45_39554_c1 | 3300050496 | Bacteria | 2635 |
| 610 | nmdc:mga09592_376781_c1 | 3300050508 | Bacteria | 1227 |
| 611 | nmdc:mga0qj67_121013_c1 | 3300050509 | Bacteria | 2117 |
| 612 | nmdc:mga0n895_84327_c1 | 3300050512 | Bacteria | 3170 |
| 613 | nmdc:mga0rr50_144412_c1 | 3300050513 | Bacteria | 1917 |
| 614 | nmdc:mga0rr50_172719_c1 | 3300050513 | Bacteria | 1762 |
| 615 | nmdc:mga0sz30_35646_c1 | 3300050516 | Bacteria | 2077 |
| 616 | Ga0495601_0013397 | 3300053077 | Bacteria | 4930 |
| 617 | Ga0495601_0034522 | 3300053077 | Bacteria | 3156 |
| 618 | Ga0495601_0090611 | 3300053077 | Bacteria | 1967 |
| 619 | Ga0495601_0103535 | 3300053077 | Bacteria | 1840 |
| 620 | Ga0495612_0002256 | 3300053078 | Bacteria | 7933 |
| 621 | Ga0495612_0023533 | 3300053078 | Bacteria | 2472 |
| 622 | Ga0500610_0068625 | 3300053079 | Bacteria | 1849 |
| 623 | Ga0495595_0012932 | 3300053084 | Bacteria | 3521 |
| 624 | Ga0495595_0057223 | 3300053084 | Bacteria | 1818 |
| 625 | Ga0495619_0013162 | 3300053085 | Bacteria | 5213 |
| 626 | Ga0495619_0210858 | 3300053085 | Bacteria | 1345 |
| 627 | Ga0501084_0000838 | 3300054114 | Bacteria | 23716 |
| 628 | Ga0590075_018405 | 3300059424 | Bacteria | 1727 |
| 629 | 2523384754 | 2523231044 | Bacteria | 6434991 |
| 630 | 2558914280 | 2558860112 | Bacteria | 9931328 |
| 631 | 2566992041 | 2565956761 | Bacteria | 6601618 |
| 632 | 2676496349 | 2675903060 | Bacteria | 10051191 |
| 633 | 2739236479 | 2738543011 | Bacteria | 5731169 |
| 634 | 2739366863 | 2738543034 | Bacteria | 6084756 |
| 635 | 2816509968 | 2816332139 | Bacteria | 9138787 |
| 636 | 2866553855 | 2866552031 | Bacteria | 5824618 |
| 637 | 2870788225 | 2870782633 | Bacteria | 9624083 |
| 638 | 2873316799 | 2873314349 | Bacteria | 8512634 |
| 639 | 2883823383 | 2883821847 | Bacteria | 5121194 |
| 640 | 2884695833 | 2884693830 | Bacteria | 11273186 |
| 641 | 2889305964 | 2889300758 | Bacteria | 5690814 |
| 642 | 2891397901 | 2891395885 | Bacteria | 9251614 |
| 643 | 2891559705 | 2891554331 | Bacteria | 8812224 |
| 644 | 2895438898 | 2895427314 | Bacteria | 13147766 |
| 645 | 2895445453 | 2895442618 | Bacteria | 11027144 |
| 646 | 2902838210 | 2902837492 | Bacteria | 6697721 |
| 647 | 2904538557 | 2904535858 | Bacteria | 6308016 |
| 648 | 2922559288 | 2922554459 | Bacteria | 6683962 |
| 649 | 2939744101 | 2939743619 | Bacteria | 5762299 |
| 650 | 2974318068 | 2974315732 | Bacteria | 4602776 |
| 651 | 2984526286 | 2984523437 | Bacteria | 4508481 |
| 652 | 3003003437 | 3002998708 | Bacteria | 11715108 |
| 653 | 8053951108 | 8053945823 | Bacteria | 8962862 |
| 654 | 8055174683 | 8055172936 | Bacteria | 9305943 |
| 655 | 8056055753 | 8056054917 | Bacteria | 5736694 |
| 656 | 8056063596 | 8056060235 | Bacteria | 7259403 |
| 657 | Ga0070663_100372740 | |||
| 658 | JGI25405J52794_10009396 | |||
| 659 | Ga0070683_100163023 | |||
| 660 | Ga0070683_100341451 | |||
| 661 | Ga0070683_100344994 | |||
| 662 | Ga0068869_100264239 | |||
| 663 | Ga0070680_100013951 | |||
| 664 | Ga0068868_100114912 | |||
| 665 | Ga0068868_100231464 | |||
| 666 | Ga0070660_100281849 | |||
| 667 | Ga0070660_100319860 | |||
| 668 | Ga0070687_100027165 | |||
| 669 | Ga0070661_100075807 | |||
| 670 | Ga0070661_100316528 | |||
| 671 | Ga0070668_100000258 | |||
| 672 | Ga0070669_100003538 | |||
| 673 | Ga0070669_100054966 | |||
| 674 | Ga0070688_100123905 | |||
| 675 | Ga0070667_100000077 | |||
| 676 | Ga0070667_100019017 | |||
| 677 | Ga0070667_100047178 | |||
| 678 | Ga0070709_10013070 | |||
| 679 | Ga0070709_10173513 | |||
| 680 | Ga0070709_10419568 | |||
| 681 | Ga0070714_100032801 | |||
| 682 | Ga0070714_100048621 | |||
| 683 | Ga0070714_100071213 | |||
| 684 | Ga0070713_100024532 | |||
| 685 | Ga0070713_100202114 | |||
| 686 | Ga0070710_10140986 | |||
| 687 | Ga0070710_10177488 | |||
| 688 | Ga0070701_10001956 | |||
| 689 | Ga0070701_10019488 | |||
| 690 | Ga0070711_100045175 | |||
| 691 | Ga0070711_100071752 | |||
| 692 | Ga0070700_100037644 | |||
| 693 | Ga0070700_100040522 | |||
| 694 | Ga0070694_100209690 | |||
| 695 | Ga0070708_100009370 | |||
| 696 | Ga0070708_100186943 | |||
| 697 | Ga0070708_100267579 | |||
| 698 | Ga0070663_100060022 | |||
| 699 | Ga0070663_100171154 | |||
| 700 | Ga0070662_100483462 | |||
| 701 | Ga0070681_10027284 | |||
| 702 | Ga0070685_10024072 | |||
| 703 | Ga0070706_100135561 | |||
| 704 | Ga0070707_100044139 | |||
| 705 | Ga0070707_100059687 | |||
| 706 | Ga0070707_100135050 | |||
| 707 | Ga0070698_100003844 | |||
| 708 | Ga0070698_100036644 | |||
| 709 | Ga0070698_100107775 | |||
| 710 | Ga0070698_100109163 | |||
| 711 | Ga0070699_100011563 | |||
| 712 | Ga0070679_100133509 | |||
| 713 | Ga0070684_100067903 | |||
| 714 | Ga0070684_100393095 | |||
| 715 | Ga0070684_100474416 | |||
| 716 | Ga0070684_100588735 | |||
| 717 | Ga0068853_100048944 | |||
| 718 | Ga0070693_100037775 | |||
| 719 | Ga0070693_100220684 | |||
| 720 | Ga0070665_100004932 | |||
| 721 | Ga0070665_100133315 | |||
| 722 | Ga0070665_100312442 | |||
| 723 | Ga0070665_100368594 | |||
| 724 | Ga0070665_100432938 | |||
| 725 | Ga0070665_100673478 | |||
| 726 | Ga0068855_100420420 | |||
| 727 | Ga0070664_100119666 | |||
| 728 | Ga0068857_100070741 | |||
| 729 | Ga0068854_100534025 | |||
| 730 | Ga0068856_100107629 | |||
| 731 | Ga0070702_100106428 | |||
| 732 | Ga0068852_100103556 | |||
| 733 | Ga0068852_100206553 | |||
| 734 | Ga0068852_100309688 | |||
| 735 | Ga0068852_100397701 | |||
| 736 | Ga0068852_100690761 | |||
| 737 | Ga0068859_100000438 | |||
| 738 | Ga0068859_100082177 | |||
| 739 | Ga0068859_100176990 | |||
| 740 | Ga0068864_100131976 | |||
| 741 | Ga0068864_100157826 | |||
| 742 | Ga0068864_100176361 | |||
| 743 | Ga0068861_100087967 | |||
| 744 | Ga0068861_100456802 | |||
| 745 | Ga0068851_10049393 | |||
| 746 | Ga0068863_100000777 | |||
| 747 | Ga0068863_100050783 | |||
| 748 | Ga0068863_100076977 | |||
| 749 | Ga0068863_100183588 | |||
| 750 | Ga0068858_100008639 | |||
| 751 | Ga0068858_100028166 | |||
| 752 | Ga0068860_100000010 | |||
| 753 | Ga0068862_100000008 | |||
| 754 | Ga0068862_100282891 | |||
| 755 | Ga0081455_10010888 | |||
| 756 | Ga0081455_10139924 | |||
| 757 | Ga0081455_10283189 | |||
| 758 | Ga0081538_10001458 | |||
| 759 | Ga0081538_10018782 | |||
| 760 | Ga0081540_1000156 | |||
| 761 | Ga0081540_1054742 | |||
| 762 | Ga0070717_10068965 | |||
| 763 | Ga0070717_10182486 | |||
| 764 | Ga0070717_10240726 | |||
| 765 | Ga0075365_10039541 | |||
| 766 | Ga0075365_10326284 | |||
| 767 | Ga0075368_10004172 | |||
| 768 | Ga0075363_100003797 | |||
| 769 | Ga0075363_100024145 | |||
| 770 | Ga0075364_10012090 | |||
| 771 | Ga0075364_10190656 | |||
| 772 | Ga0070715_10051000 | |||
| 773 | Ga0070716_100055854 | |||
| 774 | Ga0070716_100071022 | |||
| 775 | Ga0070716_100087651 | |||
| 776 | Ga0070716_100155328 | |||
| 777 | Ga0070712_100228845 | |||
| 778 | Ga0075362_10006544 | |||
| 779 | Ga0075367_10021375 | |||
| 780 | Ga0075369_10043994 | |||
| 781 | Ga0075370_10021190 | |||
| 782 | Ga0068871_100169475 | |||
| 783 | Ga0068871_100201185 | |||
| 784 | Ga0075428_100016777 | |||
| 785 | Ga0075430_100141236 | |||
| 786 | Ga0075433_10237019 | |||
| 787 | Ga0075434_100000386 | |||
| 788 | Ga0075434_100126571 | |||
| 789 | Ga0097620_100000438 | |||
| 790 | Ga0097620_100082179 | |||
| 791 | Ga0097620_100177004 | |||
| 792 | Ga0105251_10019722 | |||
| 793 | Ga0105245_10017646 | |||
| 794 | Ga0105245_10449752 | |||
| 795 | Ga0105245_10527656 | |||
| 796 | Ga0105247_10000019 | |||
| 797 | Ga0105247_10201170 | |||
| 798 | Ga0114129_10106070 | |||
| 799 | Ga0105243_10000372 | |||
| 800 | Ga0105243_10027521 | |||
| 801 | Ga0105243_10164834 | |||
| 802 | Ga0105242_10412400 | |||
| 803 | Ga0105242_10494738 | |||
| 804 | Ga0105248_10000093 | |||
| 805 | Ga0105237_10114470 | |||
| 806 | Ga0105237_10641108 | |||
| 807 | Ga0105238_10318747 | |||
| 808 | Ga0105249_10000019 | |||
| 809 | Ga0105249_10141171 | |||
| 810 | Ga0105249_10465205 | |||
| 811 | Ga0099796_10036699 | |||
| 812 | Ga0105239_10098950 | |||
| 813 | Ga0105239_10535741 | |||
| 814 | Ga0105246_10211180 | |||
| 815 | Ga0105246_10435591 | |||
| 816 | Ga0157373_10250593 | |||
| 817 | Ga0157371_10200174 | |||
| 818 | Ga0157370_10017095 | |||
| 819 | Ga0157369_10312908 | |||
| 820 | Ga0157374_10021356 | |||
| 821 | Ga0157374_10087602 | |||
| 822 | Ga0157378_10331044 | |||
| 823 | Ga0157378_10560715 | |||
| 824 | Ga0163162_10254654 | |||
| 825 | Ga0163162_10348702 | |||
| 826 | Ga0157375_10051600 | |||
| 827 | Ga0157375_10294762 | |||
| 828 | Ga0157375_10394875 | |||
| 829 | Ga0163163_10015693 | |||
| 830 | Ga0163163_10018846 | |||
| 831 | Ga0163163_10108385 | |||
| 832 | Ga0163163_10681579 | |||
| 833 | Ga0157377_10012353 | |||
| 834 | Ga0157377_10015268 | |||
| 835 | Ga0157377_10174850 | |||
| 836 | Ga0157379_10037572 | |||
| 837 | Ga0157379_10143240 | |||
| 838 | Ga0157379_10210485 | |||
| 839 | Ga0157379_10240594 | |||
| 840 | Ga0157376_10017900 | |||
| 841 | Ga0157376_10439643 | |||
| 842 | Ga0206354_10540157 | |||
| 843 | Ga0213874_10000085 | |||
| 844 | Ga0213874_10026100 | |||
| 845 | Ga0213875_10000423 | |||
| 846 | Ga0213875_10002053 | |||
| 847 | Ga0224572_1004754 | |||
| 848 | Ga0209673_1031481 | |||
| 849 | Ga0209051_1007785 | |||
| 850 | Ga0207653_10002345 | |||
| 851 | Ga0207692_10026892 | |||
| 852 | Ga0207692_10075902 | |||
| 853 | Ga0207692_10209866 | |||
| 854 | Ga0207642_10122561 | |||
| 855 | Ga0207710_10000036 | |||
| 856 | Ga0207710_10077607 | |||
| 857 | Ga0207688_10009339 | |||
| 858 | Ga0207688_10010018 | |||
| 859 | Ga0207688_10022607 | |||
| 860 | Ga0207680_10063111 | |||
| 861 | Ga0207685_10042741 | |||
| 862 | Ga0207699_10107780 | |||
| 863 | Ga0207699_10108722 | |||
| 864 | Ga0207645_10042033 | |||
| 865 | Ga0207645_10111892 | |||
| 866 | Ga0207643_10040982 | |||
| 867 | Ga0207705_10303422 | |||
| 868 | Ga0207654_10378700 | |||
| 869 | Ga0207707_10020673 | |||
| 870 | Ga0207695_10336794 | |||
| 871 | Ga0207671_10138071 | |||
| 872 | Ga0207671_10464236 | |||
| 873 | Ga0207693_10017461 | |||
| 874 | Ga0207693_10183202 | |||
| 875 | Ga0207663_10063303 | |||
| 876 | Ga0207663_10094214 | |||
| 877 | Ga0207663_10108141 | |||
| 878 | Ga0207663_10165354 | |||
| 879 | Ga0207660_10207933 | |||
| 880 | Ga0207660_10361807 | |||
| 881 | Ga0207662_10002478 | |||
| 882 | Ga0207662_10008401 | |||
| 883 | Ga0207657_10012369 | |||
| 884 | Ga0207657_10036933 | |||
| 885 | Ga0207646_10030314 | |||
| 886 | Ga0207646_10052184 | |||
| 887 | Ga0207646_10062007 | |||
| 888 | Ga0207646_10529302 | |||
| 889 | Ga0207681_10000911 | |||
| 890 | Ga0207687_10057575 | |||
| 891 | Ga0207687_10147140 | |||
| 892 | Ga0207687_10192749 | |||
| 893 | Ga0207700_10065026 | |||
| 894 | Ga0207700_10160561 | |||
| 895 | Ga0207700_10263299 | |||
| 896 | Ga0207700_10341897 | |||
| 897 | Ga0207664_10011884 | |||
| 898 | Ga0207664_10057718 | |||
| 899 | Ga0207664_10076777 | |||
| 900 | Ga0207664_10444799 | |||
| 901 | Ga0207690_10313774 | |||
| 902 | Ga0207690_10529230 | |||
| 903 | Ga0207706_10095142 | |||
| 904 | Ga0207706_10302382 | |||
| 905 | Ga0207709_10002002 | |||
| 906 | Ga0207709_10299567 | |||
| 907 | Ga0207669_10092926 | |||
| 908 | Ga0207669_10200170 | |||
| 909 | Ga0207704_10219128 | |||
| 910 | Ga0207704_10249053 | |||
| 911 | Ga0207665_10004169 | |||
| 912 | Ga0207665_10051344 | |||
| 913 | Ga0207665_10084666 | |||
| 914 | Ga0207691_10099060 | |||
| 915 | Ga0207691_10187442 | |||
| 916 | Ga0207711_10000102 | |||
| 917 | Ga0207711_10164031 | |||
| 918 | Ga0207689_10004040 | |||
| 919 | Ga0207689_10055206 | |||
| 920 | Ga0207689_10254047 | |||
| 921 | Ga0207661_10538163 | |||
| 922 | Ga0207651_10076439 | |||
| 923 | Ga0207651_10295137 | |||
| 924 | Ga0207712_10000025 | |||
| 925 | Ga0207712_10074304 | |||
| 926 | Ga0207712_10190367 | |||
| 927 | Ga0207668_10000858 | |||
| 928 | Ga0207668_10000935 | |||
| 929 | Ga0207668_10102085 | |||
| 930 | Ga0207668_10191044 | |||
| 931 | Ga0207658_10000593 | |||
| 932 | Ga0207677_10039843 | |||
| 933 | Ga0207703_10019127 | |||
| 934 | Ga0207639_10430164 | |||
| 935 | Ga0207678_10001755 | |||
| 936 | Ga0207678_10007984 | |||
| 937 | Ga0207678_10069339 | |||
| 938 | Ga0207678_10141730 | |||
| 939 | Ga0207708_10006333 | |||
| 940 | Ga0207708_10134055 | |||
| 941 | Ga0207708_10259102 | |||
| 942 | Ga0207702_10046796 | |||
| 943 | Ga0207702_10051480 | |||
| 944 | Ga0207641_10001204 | |||
| 945 | Ga0207641_10097094 | |||
| 946 | Ga0207641_10273571 | |||
| 947 | Ga0207676_10041296 | |||
| 948 | Ga0207676_10104628 | |||
| 949 | Ga0207676_10502077 | |||
| 950 | Ga0207674_10003683 | |||
| 951 | Ga0207674_10024205 | |||
| 952 | Ga0207675_100038196 | |||
| 953 | Ga0207675_100154012 | |||
| 954 | Ga0207675_100301889 | |||
| 955 | Ga0207683_10001399 | |||
| 956 | Ga0207683_10204388 | |||
| 957 | Ga0207698_10126177 | |||
| 958 | Ga0207698_10150377 | |||
| 959 | Ga0207698_10236013 | |||
| 960 | Ga0207698_10236606 | |||
| 961 | Ga0207698_10320651 | |||
| 962 | Ga0207698_10502371 | |||
| 963 | Ga0207698_10552144 | |||
| 964 | Ga0268266_10069140 | |||
| 965 | Ga0268266_10069577 | |||
| 966 | Ga0268266_10187352 | |||
| 967 | Ga0268266_10232041 | |||
| 968 | Ga0268265_10000007 | |||
| 969 | Ga0268265_10046065 | |||
| 970 | Ga0268264_10000007 | |||
| 971 | Ga0307513_10000099 | |||
| 972 | Ga0307513_10028657 | |||
| 973 | Ga0307508_10019206 | |||
| 974 | Ga0307508_10037884 | |||
| 975 | Ga0307508_10240419 | |||
| 976 | Ga0307516_10005615 | |||
| 977 | Ga0307405_10069564 | |||
| 978 | Ga0307413_10013785 | |||
| 979 | Ga0307413_10361296 | |||
| 980 | Ga0307410_10049347 | |||
| 981 | Ga0307410_10288707 | |||
| 982 | Ga0307406_10203365 | |||
| 983 | Ga0307406_10295725 | |||
| 984 | Ga0307407_10054524 | |||
| 985 | Ga0307407_10113276 | |||
| 986 | Ga0307409_100026229 | |||
| 987 | Ga0307416_100019592 | |||
| 988 | Ga0307415_100150226 | |||
| 989 | Ga0373948_0000204 | |||
| 990 | Ga0373926_0001463 | |||
| 991 | Ga0373926_0017008 | |||
| 992 | Ga0373926_0058420 | |||
| 993 | Ga0373934_0011207 | |||
| 994 | Ga0373934_0020842 | |||
| 995 | Ga0373934_0102956 | |||
| 996 | Ga0373944_0001058 | |||
| 997 | Ga0373944_0004526 | |||
| 998 | Ga0373944_0040359 | |||
| 999 | Ga0373951_0000039 | |||
| 1000 | Ga0373951_0007932 | |||
| 1001 | Ga0373923_0010339 | |||
| 1002 | Ga0373923_0047755 | |||
| 1003 | Ga0373932_0007992 | |||
| 1004 | Ga0373936_0002239 | |||
| 1005 | Ga0373936_0026026 | |||
| 1006 | Ga0373945_0001355 | |||
| 1007 | Ga0373945_0105211 | |||
| 1008 | Ga0373953_0040653 | |||
| 1009 | Ga0373953_0061716 | |||
| 1010 | Ga0373953_0114476 | |||
| 1011 | Ga0373954_0045129 | |||
| 1012 | Ga0373954_0085719 | |||
| 1013 | Ga0373956_0003308 | |||
| 1014 | Ga0373956_0013708 | |||
| 1015 | Ga0373956_0063674 | |||
| 1016 | Ga0373956_0066636 | |||
| 1017 | Ga0373957_0032276 | |||
| 1018 | Ga0373957_0069699 | |||
| 1019 | Ga0373943_0000325 | |||
| 1020 | Ga0373943_0112309 | |||
| 1021 | Ga0373946_0000069 | |||
| 1022 | Ga0373946_0032964 | |||
| 1023 | Ga0373946_0096462 | |||
| 1024 | Ga0373955_0008122 | |||
| 1025 | Ga0373955_0027930 | |||
| 1026 | Ga0373955_0045263 | |||
| 1027 | Ga0373924_0005189 | |||
| 1028 | Ga0373924_0163983 | |||
| 1029 | Ga0373931_0174836 | |||
| 1030 | Ga0373935_0003836 | |||
| 1031 | Ga0373935_0018326 | |||
| 1032 | Ga0373935_0031499 | |||
| 1033 | Ga0373935_0420021 | |||
| 1034 | Ga0373927_0001455 | |||
| 1035 | Ga0373927_0002533 | |||
| 1036 | Ga0373933_0000434 | |||
| 1037 | Ga0373933_0029361 | |||
| 1038 | Ga0373933_0097975 | |||
| 1039 | Ga0373947_0001505 | |||
| 1040 | Ga0373947_0104754 | |||
| 1041 | Ga0373947_0302615 | |||
| 1042 | Ga0373937_0005355 | |||
| 1043 | Ga0373937_0066635 | |||
| 1044 | Ga0373937_0096663 | |||
| 1045 | Ga0373937_0213554 | |||
| 1046 | Ga0373937_0257574 | |||
| 1047 | Ga0373925_0020535 | |||
| 1048 | Ga0373925_0081441 | |||
| 1049 | Ga0373925_0263269 | |||
| 1050 | Ga0373925_0263327 | |||
| 1051 | Ga0395900_0337245 | |||
| 1052 | Ga0395898_0029201 | |||
| 1053 | Ga0395905_0092070 | |||
| 1054 | Ga0436364_0735608 | |||
| 1055 | Ga0436364_0838309 | |||
| 1056 | Ga0436364_0862533 | |||
| 1057 | Ga0395901_0066546 | |||
| 1058 | Ga0436365_1234929 | |||
| 1059 | Ga0436365_1703157 | |||
| 1060 | Ga0436363_0164243 | |||
| 1061 | Ga0436363_0825219 | |||
| 1062 | Ga0439436_0005053 | |||
| 1063 | Ga0439438_013265 | |||
| 1064 | Ga0451807_1301487 | |||
| 1065 | Ga0439449_0000216 | |||
| 1066 | Ga0439457_006206 | |||
| 1067 | Ga0439463_000928 | |||
| 1068 | Ga0439464_0019912 | |||
| 1069 | Ga0439464_0025373 | |||
| 1070 | Ga0439440_0003462 | |||
| 1071 | Ga0466965_0187958 | |||
| 1072 | Ga0466963_0020613 | |||
| 1073 | Ga0466963_0227983 | |||
| 1074 | Ga0466957_0171689 | |||
| 1075 | Ga0466967_0047459 | |||
| 1076 | Ga0466967_0092960 | |||
| 1077 | Ga0466967_0208199 | |||
| 1078 | Ga0495592_0024346 | |||
| 1079 | Ga0495592_0029555 | |||
| 1080 | Ga0495592_0058465 | |||
| 1081 | Ga0495629_0008427 | |||
| 1082 | Ga0495629_0093762 | |||
| 1083 | Ga0495641_0008239 | |||
| 1084 | Ga0495641_0078155 | |||
| 1085 | Ga0495651_0022055 | |||
| 1086 | Ga0495651_0025478 | |||
| 1087 | Ga0495651_0025943 | |||
| 1088 | Ga0495651_0045168 | |||
| 1089 | Ga0495653_0029313 | |||
| 1090 | Ga0495653_0034662 | |||
| 1091 | Ga0495580_0048944 | |||
| 1092 | Ga0495580_0066432 | |||
| 1093 | Ga0495582_0026256 | |||
| 1094 | Ga0495639_0009968 | |||
| 1095 | Ga0495639_0012393 | |||
| 1096 | Ga0495662_0000819 | |||
| 1097 | Ga0495662_0004408 | |||
| 1098 | Ga0495664_0000883 | |||
| 1099 | Ga0495664_0003645 | |||
| 1100 | Ga0495664_0114570 | |||
| 1101 | Ga0495594_0009238 | |||
| 1102 | Ga0495594_0096576 | |||
| 1103 | Ga0495606_0052930 | |||
| 1104 | Ga0495608_0028889 | |||
| 1105 | Ga0495608_0029982 | |||
| 1106 | Ga0495608_0068113 | |||
| 1107 | Ga0495618_0053268 | |||
| 1108 | Ga0495618_0325986 | |||
| 1109 | Ga0495620_0114420 | |||
| 1110 | Ga0495628_0018892 | |||
| 1111 | Ga0495628_0063073 | |||
| 1112 | Ga0495630_0050896 | |||
| 1113 | Ga0495630_0277579 | |||
| 1114 | Ga0495666_0087198 | |||
| 1115 | Ga0495666_0183052 | |||
| 1116 | Ga0495652_0023577 | |||
| 1117 | Ga0495652_0025743 | |||
| 1118 | Ga0495652_0035521 | |||
| 1119 | Ga0495665_0002411 | |||
| 1120 | Ga0495665_0004125 | |||
| 1121 | Ga0495665_0014147 | |||
| 1122 | Ga0495640_0010552 | |||
| 1123 | Ga0495640_0027073 | |||
| 1124 | Ga0495640_0061442 | |||
| 1125 | Ga0495586_0046288 | |||
| 1126 | Ga0495586_0077666 | |||
| 1127 | Ga0495587_0002559 | |||
| 1128 | Ga0495645_0138447 | |||
| 1129 | Ga0495645_0175013 | |||
| 1130 | Ga0495667_0015949 | |||
| 1131 | Ga0495667_0045814 | |||
| 1132 | Ga0495667_0046453 | |||
| 1133 | Ga0495667_0072397 | |||
| 1134 | Ga0495667_0167141 | |||
| 1135 | Ga0495668_0000128 | |||
| 1136 | Ga0495634_0010342 | |||
| 1137 | Ga0495634_0067153 | |||
| 1138 | Ga0495634_0111847 | |||
| 1139 | Ga0495635_0008079 | |||
| 1140 | Ga0495635_0034952 | |||
| 1141 | Ga0495635_0066121 | |||
| 1142 | Ga0495635_0088451 | |||
| 1143 | Ga0495588_0004164 | |||
| 1144 | Ga0495588_0092392 | |||
| 1145 | Ga0495657_0005036 | |||
| 1146 | Ga0495657_0029175 | |||
| 1147 | Ga0495657_0270262 | |||
| 1148 | Ga0495599_0011459 | |||
| 1149 | Ga0495623_0026928 | |||
| 1150 | Ga0495646_0001127 | |||
| 1151 | Ga0495647_0059680 | |||
| 1152 | Ga0495647_0150932 | |||
| 1153 | Ga0495658_0043710 | |||
| 1154 | Ga0495658_0068312 | |||
| 1155 | Ga0495613_0085387 | |||
| 1156 | Ga0495624_0003425 | |||
| 1157 | Ga0495624_0122668 | |||
| 1158 | Ga0495600_0008622 | |||
| 1159 | Ga0495600_0025387 | |||
| 1160 | Ga0495600_0083815 | |||
| 1161 | Ga0495600_0111344 | |||
| 1162 | Ga0495600_0176505 | |||
| 1163 | Ga0495581_0002848 | |||
| 1164 | Ga0495581_0024247 | |||
| 1165 | Ga0495581_0036876 | |||
| 1166 | Ga0495604_0270334 | |||
| 1167 | Ga0495674_0000343 | |||
| 1168 | Ga0495676_0004107 | |||
| 1169 | Ga0495680_0012359 | |||
| 1170 | Ga0495680_0020099 | |||
| 1171 | Ga0495680_0090031 | |||
| 1172 | Ga0495675_0004360 | |||
| 1173 | Ga0495675_0025707 | |||
| 1174 | Ga0495675_0072148 | |||
| 1175 | Ga0495675_0175785 | |||
| 1176 | Ga0495684_0009563 | |||
| 1177 | Ga0495684_0022169 | |||
| 1178 | Ga0495684_0029003 | |||
| 1179 | Ga0495684_0117732 | |||
| 1180 | Ga0495686_0011309 | |||
| 1181 | Ga0495593_0003879 | |||
| 1182 | Ga0495593_0055727 | |||
| 1183 | Ga0495602_0036471 | |||
| 1184 | Ga0495602_0036550 | |||
| 1185 | Ga0495602_0241369 | |||
| 1186 | Ga0496100_0001703 | |||
| 1187 | Ga0496100_0006878 | |||
| 1188 | Ga0496100_0063813 | |||
| 1189 | Ga0496101_0001379 | |||
| 1190 | Ga0496101_0022710 | |||
| 1191 | Ga0496101_0270373 | |||
| 1192 | Ga0496102_0000112 | |||
| 1193 | Ga0496102_0157698 | |||
| 1194 | Ga0496102_0308478 | |||
| 1195 | Ga0496103_0002741 | |||
| 1196 | Ga0496104_0019375 | |||
| 1197 | Ga0496105_0004460 | |||
| 1198 | Ga0496105_0050648 | |||
| 1199 | Ga0496106_0009897 | |||
| 1200 | Ga0496106_0061596 | |||
| 1201 | Ga0496106_0136520 | |||
| 1202 | Ga0496107_0034883 | |||
| 1203 | Ga0496107_0122920 | |||
| 1204 | Ga0496107_0125425 | |||
| 1205 | Ga0496107_0242096 | |||
| 1206 | Ga0496108_0008900 | |||
| 1207 | Ga0496108_0015327 | |||
| 1208 | Ga0496108_0026069 | |||
| 1209 | Ga0496109_0006061 | |||
| 1210 | Ga0496109_0162133 | |||
| 1211 | Ga0496109_0318500 | |||
| 1212 | Ga0496110_0012686 | |||
| 1213 | Ga0496110_0065173 | |||
| 1214 | Ga0496110_0159542 | |||
| 1215 | Ga0496110_0240883 | |||
| 1216 | Ga0496110_0356137 | |||
| 1217 | Ga0496112_0202478 | |||
| 1218 | Ga0496112_0243975 | |||
| 1219 | Ga0496112_0247741 | |||
| 1220 | Ga0496112_0342748 | |||
| 1221 | Ga0496113_0262284 | |||
| 1222 | Ga0496114_0003564 | |||
| 1223 | Ga0496114_0046113 | |||
| 1224 | Ga0496115_0004692 | |||
| 1225 | Ga0496115_0013540 | |||
| 1226 | Ga0496115_0497632 | |||
| 1227 | Ga0496117_0000719 | |||
| 1228 | Ga0496118_0003063 | |||
| 1229 | Ga0496119_0014589 | |||
| 1230 | Ga0496120_0041032 | |||
| 1231 | Ga0496121_0014867 | |||
| 1232 | Ga0496124_0169980 | |||
| 1233 | Ga0496126_0026694 | |||
| 1234 | Ga0496126_0106834 | |||
| 1235 | Ga0501031_0000083 | |||
| 1236 | Ga0501032_0000601 | |||
| 1237 | Ga0501033_0000592 | |||
| 1238 | Ga0501034_0002926 | |||
| 1239 | Ga0501036_0020214 | |||
| 1240 | Ga0501037_0000322 | |||
| 1241 | Ga0501038_0000509 | |||
| 1242 | Ga0501043_0001904 | |||
| 1243 | Ga0501046_0001129 | |||
| 1244 | Ga0501047_0005717 | |||
| 1245 | Ga0501047_0148413 | |||
| 1246 | Ga0501048_0001870 | |||
| 1247 | Ga0501067_0011242 | |||
| 1248 | Ga0501067_0045547 | |||
| 1249 | Ga0501068_0031267 | |||
| 1250 | Ga0501069_0000435 | |||
| 1251 | Ga0501070_0000486 | |||
| 1252 | Ga0501070_0530921 | |||
| 1253 | Ga0501071_0042825 | |||
| 1254 | Ga0501072_0339111 | |||
| 1255 | Ga0501074_0000485 | |||
| 1256 | Ga0501080_0002417 | |||
| 1257 | Ga0501083_0147908 | |||
| 1258 | Ga0501035_0003142 | |||
| 1259 | Ga0501044_0001000 | |||
| 1260 | nmdc:mga03683_6280_c1 | |||
| 1261 | nmdc:mga03n38_8967_c1 | |||
| 1262 | nmdc:mga00v17_345864_c1 | |||
| 1263 | nmdc:mga00v17_49151_c1 | |||
| 1264 | nmdc:mga07m45_139841_c1 | |||
| 1265 | nmdc:mga07m45_39554_c1 | |||
| 1266 | nmdc:mga09592_376781_c1 | |||
| 1267 | nmdc:mga0qj67_121013_c1 | |||
| 1268 | nmdc:mga0n895_84327_c1 | |||
| 1269 | nmdc:mga0rr50_144412_c1 | |||
| 1270 | nmdc:mga0rr50_172719_c1 | |||
| 1271 | nmdc:mga0sz30_35646_c1 | |||
| 1272 | Ga0495601_0013397 | |||
| 1273 | Ga0495601_0034522 | |||
| 1274 | Ga0495601_0090611 | |||
| 1275 | Ga0495601_0103535 | |||
| 1276 | Ga0495612_0002256 | |||
| 1277 | Ga0495612_0023533 | |||
| 1278 | Ga0500610_0068625 | |||
| 1279 | Ga0495595_0012932 | |||
| 1280 | Ga0495595_0057223 | |||
| 1281 | Ga0495619_0013162 | |||
| 1282 | Ga0495619_0210858 | |||
| 1283 | Ga0501084_0000838 | |||
| 1284 | Ga0590075_018405 | |||
| 1285 | 2523384754 | |||
| 1286 | 2558914280 | |||
| 1287 | 2566992041 | |||
| 1288 | 2676496349 | |||
| 1289 | 2739236479 | |||
| 1290 | 2739366863 | |||
| 1291 | 2816509968 | |||
| 1292 | 2866553855 | |||
| 1293 | 2870788225 | |||
| 1294 | 2873316799 | |||
| 1295 | 2883823383 | |||
| 1296 | 2884695833 | |||
| 1297 | 2889305964 | |||
| 1298 | 2891397901 | |||
| 1299 | 2891559705 | |||
| 1300 | 2895438898 | |||
| 1301 | 2895445453 | |||
| 1302 | 2902838210 | |||
| 1303 | 2904538557 | |||
| 1304 | 2922559288 | |||
| 1305 | 2939744101 | |||
| 1306 | 2974318068 | |||
| 1307 | 2984526286 | |||
| 1308 | 3003003437 | |||
| 1309 | 8053951108 | |||
| 1310 | 8055174683 | |||
| 1311 | 8056055753 | |||
| 1312 | 8056063596 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qjv-assembly1.cif.gz_A | crystal structure of an iolb-like protein (stm4420) from salmonella typhimurium lt2 at 1.90 a resolution | 0.9338 | 5 | 272 |
| 2qjv-assembly1.cif.gz_A | crystal structure of an iolb-like protein (stm4420) from salmonella typhimurium lt2 at 1.90 a resolution | 0.9235 | 5 | 272 |
| 3fjs-assembly2.cif.gz_D | crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.8378 | 31 | 112 |
| 7zyb-assembly1.cif.gz_A | bekdgf with ca | 0.83 | 32 | 114 |
| 2pfw-assembly1.cif.gz_B | crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution | 0.8256 | 30 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qjvB01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9179 | 129 | 272 | 2.60.120.10 |
| 2qjvB02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8776 | 22 | 125 | 2.60.120.10 |
| af_I1N5B5_339_414_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8543 | 33 | 112 | 2.60.120.10 |
| af_Q9FZH5_335_433_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8512 | 14 | 110 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8458 | 32 | 112 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0HAC0-F1-model_v4 | 5-deoxy-glucuronate isomerase | 0.9953 | 9 | 164 |
GO:0008880
GO:0019310 |
| AF-A0A3D0R0C0-F1-model_v4 | 5-deoxy-glucuronate isomerase | 0.9925 | 9 | 122 |
GO:0008880
GO:0019310 |
| AF-A0A4Z0HG21-F1-model_v4 | 5-deoxy-glucuronate isomerase (EC 5.3.1.30) | 0.992 | 6 | 285 |
GO:0008880
GO:0019310 GO:0102482 |
| AF-A0A4Q4D420-F1-model_v4 | 5-deoxy-glucuronate isomerase (EC 5.3.1.30) | 0.9911 | 7 | 246 |
GO:0008880
GO:0019310 GO:0102482 |
| AF-A0A3P1SGG9-F1-model_v4 | 5-deoxy-glucuronate isomerase (EC 5.3.1.30) | 0.9883 | 6 | 285 |
GO:0008880
GO:0019310 GO:0102482 |