F472996

General Info

Members Datasets Scaffolds Average Seq Length
656 345 1312 289

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100372740|Ga0070663_1003727402
Length 317
Sequence VIAKNVMTDKLEIVIPAGAGGEGDYSLSITPERAGWGYSSFKVLELAAGSTHTFATGEDEWVVLPLSGSCTVACDGETFTLAGRRGVFTRVTDFAYVPRDADTTVTSQDGGRFALCGARAQRRLTARYGPAEGVQVELRGAGQASRQVNNFCTPATFEADKLIAVEVITPGGNWSSFPPHKHDEAGPNESRLEEVYYFEADSGYAAGQAGACGYQRVYGSGPGKEIDVCAEVRTGDAILIPYGWHGPAMAAPGYDLYYLNVMAGPDPERVWKICDDPAHAWVRTLWDGQEIDPRLPLTSTVEKSSPEESGTEKEEVR

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
199 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
319 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
320 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
321 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
322 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
323 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
324 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
325 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
326 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
327 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
328 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
329 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
330 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
331 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
332 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
333 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
334 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
335 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
336 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
337 2922554459 Rhodococcus sp. 66b Isolate Unclassified
338 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
339 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
340 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
341 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
342 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
343 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
344 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
345 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0.15
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 6.4
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100372740 3300005455 Bacteria 1161
2 JGI25405J52794_10009396 3300003911 Bacteria 1846
3 Ga0070683_100163023 3300005329 Bacteria 2115
4 Ga0070683_100341451 3300005329 Bacteria 1426
5 Ga0070683_100344994 3300005329 Bacteria 1418
6 Ga0068869_100264239 3300005334 Bacteria 1378
7 Ga0070680_100013951 3300005336 Bacteria 6271
8 Ga0068868_100114912 3300005338 Bacteria 2190
9 Ga0068868_100231464 3300005338 Bacteria 1550
10 Ga0070660_100281849 3300005339 Bacteria 1360
11 Ga0070660_100319860 3300005339 Bacteria 1274
12 Ga0070687_100027165 3300005343 Bacteria 2761
13 Ga0070661_100075807 3300005344 Bacteria 2478
14 Ga0070661_100316528 3300005344 Bacteria 1218
15 Ga0070668_100000258 3300005347 Bacteria 35205
16 Ga0070669_100003538 3300005353 Bacteria 11269
17 Ga0070669_100054966 3300005353 Bacteria 2917
18 Ga0070688_100123905 3300005365 Bacteria 1735
19 Ga0070667_100000077 3300005367 Bacteria 120245
20 Ga0070667_100019017 3300005367 Bacteria 5695
21 Ga0070667_100047178 3300005367 Bacteria 3624
22 Ga0070709_10013070 3300005434 Bacteria 4660
23 Ga0070709_10173513 3300005434 Bacteria 1509
24 Ga0070709_10419568 3300005434 Bacteria 1002
25 Ga0070714_100032801 3300005435 Bacteria 4337
26 Ga0070714_100048621 3300005435 Bacteria 3608
27 Ga0070714_100071213 3300005435 Bacteria 3005
28 Ga0070713_100024532 3300005436 Bacteria 4699
29 Ga0070713_100202114 3300005436 Bacteria 1795
30 Ga0070710_10140986 3300005437 Bacteria 1478
31 Ga0070710_10177488 3300005437 Bacteria 1331
32 Ga0070701_10001956 3300005438 Bacteria 7804
33 Ga0070701_10019488 3300005438 Bacteria 3205
34 Ga0070711_100045175 3300005439 Bacteria 2994
35 Ga0070711_100071752 3300005439 Bacteria 2442
36 Ga0070700_100037644 3300005441 Bacteria 2944
37 Ga0070700_100040522 3300005441 Bacteria 2851
38 Ga0070694_100209690 3300005444 Bacteria 1456
39 Ga0070708_100009370 3300005445 Bacteria 7893
40 Ga0070708_100186943 3300005445 Bacteria 1937
41 Ga0070708_100267579 3300005445 Bacteria 1607
42 Ga0070663_100060022 3300005455 Bacteria 2734
43 Ga0070663_100171154 3300005455 Bacteria 1679
44 Ga0070662_100483462 3300005457 Bacteria 1031
45 Ga0070681_10027284 3300005458 Bacteria 5741
46 Ga0070685_10024072 3300005466 Bacteria 3341
47 Ga0070706_100135561 3300005467 Bacteria 2298
48 Ga0070707_100044139 3300005468 Bacteria 4267
49 Ga0070707_100059687 3300005468 Bacteria 3658
50 Ga0070707_100135050 3300005468 Bacteria 2400
51 Ga0070698_100003844 3300005471 Bacteria 16514
52 Ga0070698_100036644 3300005471 Bacteria 5064
53 Ga0070698_100107775 3300005471 Bacteria 2753
54 Ga0070698_100109163 3300005471 Bacteria 2734
55 Ga0070699_100011563 3300005518 Bacteria 7620
56 Ga0070679_100133509 3300005530 Bacteria 2463
57 Ga0070684_100067903 3300005535 Bacteria 3132
58 Ga0070684_100393095 3300005535 Bacteria 1278
59 Ga0070684_100474416 3300005535 Bacteria 1157
60 Ga0070684_100588735 3300005535 Bacteria 1034
61 Ga0068853_100048944 3300005539 Bacteria 3631
62 Ga0070693_100037775 3300005547 Bacteria 2695
63 Ga0070693_100220684 3300005547 Bacteria 1242
64 Ga0070665_100004932 3300005548 Bacteria 13838
65 Ga0070665_100133315 3300005548 Bacteria 2486
66 Ga0070665_100312442 3300005548 Bacteria 1575
67 Ga0070665_100368594 3300005548 Bacteria 1443
68 Ga0070665_100432938 3300005548 Bacteria 1324
69 Ga0070665_100673478 3300005548 Bacteria 1047
70 Ga0068855_100420420 3300005563 Bacteria 1462
71 Ga0070664_100119666 3300005564 Bacteria 2304
72 Ga0068857_100070741 3300005577 Bacteria 3108
73 Ga0068854_100534025 3300005578 Bacteria 992
74 Ga0068856_100107629 3300005614 Bacteria 2784
75 Ga0070702_100106428 3300005615 Bacteria 1730
76 Ga0068852_100103556 3300005616 Bacteria 2574
77 Ga0068852_100206553 3300005616 Bacteria 1861
78 Ga0068852_100309688 3300005616 Bacteria 1531
79 Ga0068852_100397701 3300005616 Bacteria 1355
80 Ga0068852_100690761 3300005616 Bacteria 1030
81 Ga0068859_100000438 3300005617 Bacteria 41832
82 Ga0068859_100082177 3300005617 Bacteria 3264
83 Ga0068859_100176990 3300005617 Bacteria 2215
84 Ga0068864_100131976 3300005618 Bacteria 2245
85 Ga0068864_100157826 3300005618 Bacteria 2060
86 Ga0068864_100176361 3300005618 Bacteria 1952
87 Ga0068861_100087967 3300005719 Bacteria 2445
88 Ga0068861_100456802 3300005719 Bacteria 1146
89 Ga0068851_10049393 3300005834 Bacteria 2134
90 Ga0068863_100000777 3300005841 Bacteria 32074
91 Ga0068863_100050783 3300005841 Bacteria 3930
92 Ga0068863_100076977 3300005841 Bacteria 3156
93 Ga0068863_100183588 3300005841 Bacteria 2008
94 Ga0068858_100008639 3300005842 Bacteria 9781
95 Ga0068858_100028166 3300005842 Bacteria 5220
96 Ga0068860_100000010 3300005843 Bacteria 359114
97 Ga0068862_100000008 3300005844 Bacteria 305510
98 Ga0068862_100282891 3300005844 Bacteria 1520
99 Ga0081455_10010888 3300005937 Bacteria 9179
100 Ga0081455_10139924 3300005937 Bacteria 1881
101 Ga0081455_10283189 3300005937 Bacteria 1197
102 Ga0081538_10001458 3300005981 Bacteria 24309
103 Ga0081538_10018782 3300005981 Bacteria 5173
104 Ga0081540_1000156 3300005983 Bacteria 70177
105 Ga0081540_1054742 3300005983 Bacteria 1947
106 Ga0070717_10068965 3300006028 Bacteria 2944
107 Ga0070717_10182486 3300006028 Bacteria 1830
108 Ga0070717_10240726 3300006028 Bacteria 1595
109 Ga0075365_10039541 3300006038 Bacteria 3071
110 Ga0075365_10326284 3300006038 Bacteria 1081
111 Ga0075368_10004172 3300006042 Bacteria 4865
112 Ga0075363_100003797 3300006048 Bacteria 6512
113 Ga0075363_100024145 3300006048 Bacteria 3088
114 Ga0075364_10012090 3300006051 Bacteria 5267
115 Ga0075364_10190656 3300006051 Bacteria 1388
116 Ga0070715_10051000 3300006163 Bacteria 1778
117 Ga0070716_100055854 3300006173 Bacteria 2261
118 Ga0070716_100071022 3300006173 Bacteria 2046
119 Ga0070716_100087651 3300006173 Bacteria 1876
120 Ga0070716_100155328 3300006173 Bacteria 1476
121 Ga0070712_100228845 3300006175 Bacteria 1475
122 Ga0075362_10006544 3300006177 Bacteria 4350
123 Ga0075367_10021375 3300006178 Bacteria 3615
124 Ga0075369_10043994 3300006186 Bacteria 1918
125 Ga0075370_10021190 3300006353 Bacteria 3561
126 Ga0068871_100169475 3300006358 Bacteria 1871
127 Ga0068871_100201185 3300006358 Bacteria 1720
128 Ga0075428_100016777 3300006844 Bacteria 8087
129 Ga0075430_100141236 3300006846 Bacteria 2006
130 Ga0075433_10237019 3300006852 Bacteria 1620
131 Ga0075434_100000386 3300006871 Bacteria 32198
132 Ga0075434_100126571 3300006871 Bacteria 2572
133 Ga0097620_100000438 3300006931 Bacteria 41832
134 Ga0097620_100082179 3300006931 Bacteria 3264
135 Ga0097620_100177004 3300006931 Bacteria 2215
136 Ga0105251_10019722 3300009011 Bacteria 3555
137 Ga0105245_10017646 3300009098 Bacteria 6230
138 Ga0105245_10449752 3300009098 Bacteria 1296
139 Ga0105245_10527656 3300009098 Bacteria 1200
140 Ga0105247_10000019 3300009101 Bacteria 245170
141 Ga0105247_10201170 3300009101 Bacteria 1338
142 Ga0114129_10106070 3300009147 Bacteria 3882
143 Ga0105243_10000372 3300009148 Bacteria 48136
144 Ga0105243_10027521 3300009148 Bacteria 4357
145 Ga0105243_10164834 3300009148 Bacteria 1914
146 Ga0105242_10412400 3300009176 Bacteria 1263
147 Ga0105242_10494738 3300009176 Bacteria 1162
148 Ga0105248_10000093 3300009177 Bacteria 98669
149 Ga0105237_10114470 3300009545 Bacteria 2690
150 Ga0105237_10641108 3300009545 Bacteria 1069
151 Ga0105238_10318747 3300009551 Bacteria 1540
152 Ga0105249_10000019 3300009553 Bacteria 273807
153 Ga0105249_10141171 3300009553 Bacteria 2310
154 Ga0105249_10465205 3300009553 Bacteria 1305
155 Ga0099796_10036699 3300010159 Bacteria 1634
156 Ga0105239_10098950 3300010375 Bacteria 3224
157 Ga0105239_10535741 3300010375 Bacteria 1333
158 Ga0105246_10211180 3300011119 Bacteria 1515
159 Ga0105246_10435591 3300011119 Bacteria 1098
160 Ga0157373_10250593 3300013100 Bacteria 1252
161 Ga0157371_10200174 3300013102 Bacteria 1432
162 Ga0157370_10017095 3300013104 Bacteria 7327
163 Ga0157369_10312908 3300013105 Bacteria 1633
164 Ga0157374_10021356 3300013296 Bacteria 5759
165 Ga0157374_10087602 3300013296 Bacteria 2964
166 Ga0157378_10331044 3300013297 Bacteria 1482
167 Ga0157378_10560715 3300013297 Bacteria 1149
168 Ga0163162_10254654 3300013306 Bacteria 1887
169 Ga0163162_10348702 3300013306 Bacteria 1613
170 Ga0157375_10051600 3300013308 Bacteria 4040
171 Ga0157375_10294762 3300013308 Bacteria 1785
172 Ga0157375_10394875 3300013308 Bacteria 1550
173 Ga0163163_10015693 3300014325 Bacteria 7013
174 Ga0163163_10018846 3300014325 Bacteria 6472
175 Ga0163163_10108385 3300014325 Bacteria 2805
176 Ga0163163_10681579 3300014325 Bacteria 1091
177 Ga0157377_10012353 3300014745 Bacteria 4294
178 Ga0157377_10015268 3300014745 Bacteria 3924
179 Ga0157377_10174850 3300014745 Bacteria 1346
180 Ga0157379_10037572 3300014968 Bacteria 4318
181 Ga0157379_10143240 3300014968 Bacteria 2155
182 Ga0157379_10210485 3300014968 Bacteria 1760
183 Ga0157379_10240594 3300014968 Bacteria 1642
184 Ga0157376_10017900 3300014969 Bacteria 5417
185 Ga0157376_10439643 3300014969 Bacteria 1270
186 Ga0206354_10540157 3300020081 Bacteria 2359
187 Ga0213874_10000085 3300021377 Bacteria 14558
188 Ga0213874_10026100 3300021377 Bacteria 1653
189 Ga0213875_10000423 3300021388 Bacteria 37021
190 Ga0213875_10002053 3300021388 Bacteria 12369
191 Ga0224572_1004754 3300024225 Bacteria 2387
192 Ga0209673_1031481 3300025273 Bacteria 1650
193 Ga0209051_1007785 3300025303 Bacteria 5793
194 Ga0207653_10002345 3300025885 Bacteria 6031
195 Ga0207692_10026892 3300025898 Bacteria 2703
196 Ga0207692_10075902 3300025898 Bacteria 1784
197 Ga0207692_10209866 3300025898 Bacteria 1149
198 Ga0207642_10122561 3300025899 Bacteria 1344
199 Ga0207710_10000036 3300025900 Bacteria 245176
200 Ga0207710_10077607 3300025900 Bacteria 1535
201 Ga0207688_10009339 3300025901 Bacteria 5347
202 Ga0207688_10010018 3300025901 Bacteria 5155
203 Ga0207688_10022607 3300025901 Bacteria 3442
204 Ga0207680_10063111 3300025903 Bacteria 2266
205 Ga0207685_10042741 3300025905 Bacteria 1704
206 Ga0207699_10107780 3300025906 Bacteria 1780
207 Ga0207699_10108722 3300025906 Bacteria 1773
208 Ga0207645_10042033 3300025907 Bacteria 2925
209 Ga0207645_10111892 3300025907 Bacteria 1768
210 Ga0207643_10040982 3300025908 Bacteria 2608
211 Ga0207705_10303422 3300025909 Bacteria 1225
212 Ga0207654_10378700 3300025911 Bacteria 980
213 Ga0207707_10020673 3300025912 Bacteria 5748
214 Ga0207695_10336794 3300025913 Bacteria 1397
215 Ga0207671_10138071 3300025914 Bacteria 1876
216 Ga0207671_10464236 3300025914 Bacteria 1009
217 Ga0207693_10017461 3300025915 Bacteria 5723
218 Ga0207693_10183202 3300025915 Bacteria 1648
219 Ga0207663_10063303 3300025916 Bacteria 2355
220 Ga0207663_10094214 3300025916 Bacteria 1995
221 Ga0207663_10108141 3300025916 Bacteria 1882
222 Ga0207663_10165354 3300025916 Bacteria 1566
223 Ga0207660_10207933 3300025917 Bacteria 1531
224 Ga0207660_10361807 3300025917 Bacteria 1164
225 Ga0207662_10002478 3300025918 Bacteria 9267
226 Ga0207662_10008401 3300025918 Bacteria 5652
227 Ga0207657_10012369 3300025919 Bacteria 8430
228 Ga0207657_10036933 3300025919 Bacteria 4369
229 Ga0207646_10030314 3300025922 Bacteria 4905
230 Ga0207646_10052184 3300025922 Bacteria 3659
231 Ga0207646_10062007 3300025922 Bacteria 3338
232 Ga0207646_10529302 3300025922 Bacteria 1061
233 Ga0207681_10000911 3300025923 Bacteria 19299
234 Ga0207687_10057575 3300025927 Bacteria 2731
235 Ga0207687_10147140 3300025927 Bacteria 1793
236 Ga0207687_10192749 3300025927 Bacteria 1587
237 Ga0207700_10065026 3300025928 Bacteria 2781
238 Ga0207700_10160561 3300025928 Bacteria 1866
239 Ga0207700_10263299 3300025928 Bacteria 1477
240 Ga0207700_10341897 3300025928 Bacteria 1301
241 Ga0207664_10011884 3300025929 Bacteria 6211
242 Ga0207664_10057718 3300025929 Bacteria 3086
243 Ga0207664_10076777 3300025929 Bacteria 2705
244 Ga0207664_10444799 3300025929 Bacteria 1156
245 Ga0207690_10313774 3300025932 Bacteria 1230
246 Ga0207690_10529230 3300025932 Bacteria 956
247 Ga0207706_10095142 3300025933 Bacteria 2620
248 Ga0207706_10302382 3300025933 Bacteria 1394
249 Ga0207709_10002002 3300025935 Bacteria 13232
250 Ga0207709_10299567 3300025935 Bacteria 1195
251 Ga0207669_10092926 3300025937 Bacteria 1970
252 Ga0207669_10200170 3300025937 Bacteria 1449
253 Ga0207704_10219128 3300025938 Bacteria 1406
254 Ga0207704_10249053 3300025938 Bacteria 1332
255 Ga0207665_10004169 3300025939 Bacteria 9619
256 Ga0207665_10051344 3300025939 Bacteria 2775
257 Ga0207665_10084666 3300025939 Bacteria 2188
258 Ga0207691_10099060 3300025940 Bacteria 2603
259 Ga0207691_10187442 3300025940 Bacteria 1805
260 Ga0207711_10000102 3300025941 Bacteria 90198
261 Ga0207711_10164031 3300025941 Bacteria 2013
262 Ga0207689_10004040 3300025942 Bacteria 13331
263 Ga0207689_10055206 3300025942 Bacteria 3270
264 Ga0207689_10254047 3300025942 Bacteria 1454
265 Ga0207661_10538163 3300025944 Bacteria 1069
266 Ga0207651_10076439 3300025960 Bacteria 2394
267 Ga0207651_10295137 3300025960 Bacteria 1346
268 Ga0207712_10000025 3300025961 Bacteria 274015
269 Ga0207712_10074304 3300025961 Bacteria 2454
270 Ga0207712_10190367 3300025961 Bacteria 1619
271 Ga0207668_10000858 3300025972 Bacteria 18305
272 Ga0207668_10000935 3300025972 Bacteria 17554
273 Ga0207668_10102085 3300025972 Bacteria 2133
274 Ga0207668_10191044 3300025972 Bacteria 1623
275 Ga0207658_10000593 3300025986 Bacteria 32472
276 Ga0207677_10039843 3300026023 Bacteria 3093
277 Ga0207703_10019127 3300026035 Bacteria 5349
278 Ga0207639_10430164 3300026041 Bacteria 1195
279 Ga0207678_10001755 3300026067 Bacteria 19865
280 Ga0207678_10007984 3300026067 Bacteria 9331
281 Ga0207678_10069339 3300026067 Bacteria 3023
282 Ga0207678_10141730 3300026067 Bacteria 2051
283 Ga0207708_10006333 3300026075 Bacteria 8773
284 Ga0207708_10134055 3300026075 Bacteria 1938
285 Ga0207708_10259102 3300026075 Bacteria 1403
286 Ga0207702_10046796 3300026078 Bacteria 3643
287 Ga0207702_10051480 3300026078 Bacteria 3480
288 Ga0207641_10001204 3300026088 Bacteria 25896
289 Ga0207641_10097094 3300026088 Bacteria 2589
290 Ga0207641_10273571 3300026088 Bacteria 1586
291 Ga0207676_10041296 3300026095 Bacteria 3540
292 Ga0207676_10104628 3300026095 Bacteria 2355
293 Ga0207676_10502077 3300026095 Bacteria 1152
294 Ga0207674_10003683 3300026116 Bacteria 18700
295 Ga0207674_10024205 3300026116 Bacteria 6492
296 Ga0207675_100038196 3300026118 Bacteria 4480
297 Ga0207675_100154012 3300026118 Bacteria 2189
298 Ga0207675_100301889 3300026118 Bacteria 1560
299 Ga0207683_10001399 3300026121 Bacteria 21779
300 Ga0207683_10204388 3300026121 Bacteria 1796
301 Ga0207698_10126177 3300026142 Bacteria 2177
302 Ga0207698_10150377 3300026142 Bacteria 2020
303 Ga0207698_10236013 3300026142 Bacteria 1663
304 Ga0207698_10236606 3300026142 Bacteria 1661
305 Ga0207698_10320651 3300026142 Bacteria 1451
306 Ga0207698_10502371 3300026142 Bacteria 1180
307 Ga0207698_10552144 3300026142 Bacteria 1129
308 Ga0268266_10069140 3300028379 Bacteria 3059
309 Ga0268266_10069577 3300028379 Bacteria 3050
310 Ga0268266_10187352 3300028379 Bacteria 1888
311 Ga0268266_10232041 3300028379 Bacteria 1700
312 Ga0268265_10000007 3300028380 Bacteria 431817
313 Ga0268265_10046065 3300028380 Bacteria 3258
314 Ga0268264_10000007 3300028381 Bacteria 815790
315 Ga0307513_10000099 3300031456 Bacteria 125847
316 Ga0307513_10028657 3300031456 Bacteria 6361
317 Ga0307508_10019206 3300031616 Bacteria 6213
318 Ga0307508_10037884 3300031616 Bacteria 4335
319 Ga0307508_10240419 3300031616 Bacteria 1408
320 Ga0307516_10005615 3300031730 Bacteria 14931
321 Ga0307405_10069564 3300031731 Bacteria 2257
322 Ga0307413_10013785 3300031824 Bacteria 4080
323 Ga0307413_10361296 3300031824 Bacteria 1124
324 Ga0307410_10049347 3300031852 Bacteria 2825
325 Ga0307410_10288707 3300031852 Bacteria 1290
326 Ga0307406_10203365 3300031901 Bacteria 1460
327 Ga0307406_10295725 3300031901 Bacteria 1241
328 Ga0307407_10054524 3300031903 Bacteria 2306
329 Ga0307407_10113276 3300031903 Bacteria 1706
330 Ga0307409_100026229 3300031995 Bacteria 4105
331 Ga0307416_100019592 3300032002 Bacteria 4803
332 Ga0307415_100150226 3300032126 Bacteria 1792
333 Ga0373948_0000204 3300034817 Bacteria 6830
334 Ga0373926_0001463 3300035083 Bacteria 7191
335 Ga0373926_0017008 3300035083 Bacteria 2492
336 Ga0373926_0058420 3300035083 Bacteria 1402
337 Ga0373934_0011207 3300035086 Bacteria 3374
338 Ga0373934_0020842 3300035086 Bacteria 2522
339 Ga0373934_0102956 3300035086 Bacteria 1154
340 Ga0373944_0001058 3300035089 Bacteria 6803
341 Ga0373944_0004526 3300035089 Bacteria 3626
342 Ga0373944_0040359 3300035089 Bacteria 1440
343 Ga0373951_0000039 3300035091 Bacteria 51245
344 Ga0373951_0007932 3300035091 Bacteria 2406
345 Ga0373923_0010339 3300035111 Bacteria 3392
346 Ga0373923_0047755 3300035111 Bacteria 1785
347 Ga0373932_0007992 3300035112 Bacteria 2525
348 Ga0373936_0002239 3300035113 Bacteria 7226
349 Ga0373936_0026026 3300035113 Bacteria 2290
350 Ga0373945_0001355 3300035116 Bacteria 7448
351 Ga0373945_0105211 3300035116 Bacteria 1108
352 Ga0373953_0040653 3300035117 Bacteria 1847
353 Ga0373953_0061716 3300035117 Bacteria 1533
354 Ga0373953_0114476 3300035117 Bacteria 1142
355 Ga0373954_0045129 3300035118 Bacteria 2058
356 Ga0373954_0085719 3300035118 Bacteria 1508
357 Ga0373956_0003308 3300035119 Bacteria 6498
358 Ga0373956_0013708 3300035119 Bacteria 3375
359 Ga0373956_0063674 3300035119 Bacteria 1673
360 Ga0373956_0066636 3300035119 Bacteria 1638
361 Ga0373957_0032276 3300035120 Bacteria 1927
362 Ga0373957_0069699 3300035120 Bacteria 1373
363 Ga0373943_0000325 3300035170 Bacteria 19885
364 Ga0373943_0112309 3300035170 Bacteria 1438
365 Ga0373946_0000069 3300035171 Bacteria 27568
366 Ga0373946_0032964 3300035171 Bacteria 2082
367 Ga0373946_0096462 3300035171 Bacteria 1318
368 Ga0373955_0008122 3300035172 Bacteria 4855
369 Ga0373955_0027930 3300035172 Bacteria 2921
370 Ga0373955_0045263 3300035172 Bacteria 2374
371 Ga0373924_0005189 3300035410 Bacteria 4598
372 Ga0373924_0163983 3300035410 Bacteria 975
373 Ga0373931_0174836 3300035691 Bacteria 1268
374 Ga0373935_0003836 3300035692 Bacteria 8767
375 Ga0373935_0018326 3300035692 Bacteria 4256
376 Ga0373935_0031499 3300035692 Bacteria 3292
377 Ga0373935_0420021 3300035692 Bacteria 962
378 Ga0373927_0001455 3300035695 Bacteria 17854
379 Ga0373927_0002533 3300035695 Bacteria 13329
380 Ga0373933_0000434 3300035724 Bacteria 26252
381 Ga0373933_0029361 3300035724 Bacteria 3179
382 Ga0373933_0097975 3300035724 Bacteria 1816
383 Ga0373947_0001505 3300035725 Bacteria 14300
384 Ga0373947_0104754 3300035725 Bacteria 1781
385 Ga0373947_0302615 3300035725 Bacteria 1066
386 Ga0373937_0005355 3300036401 Bacteria 10973
387 Ga0373937_0066635 3300036401 Bacteria 3316
388 Ga0373937_0096663 3300036401 Bacteria 2739
389 Ga0373937_0213554 3300036401 Bacteria 1815
390 Ga0373937_0257574 3300036401 Bacteria 1645
391 Ga0373925_0020535 3300037068 Bacteria 4809
392 Ga0373925_0081441 3300037068 Bacteria 2461
393 Ga0373925_0263269 3300037068 Bacteria 1385
394 Ga0373925_0263327 3300037068 Bacteria 1385
395 Ga0395900_0337245 3300037418 Bacteria 1484
396 Ga0395898_0029201 3300037466 Bacteria 5525
397 Ga0395905_0092070 3300037471 Bacteria 2843
398 Ga0436364_0735608 3300037853 Bacteria 41179
399 Ga0436364_0838309 3300037853 Bacteria 1996
400 Ga0436364_0862533 3300037853 Bacteria 12375
401 Ga0395901_0066546 3300038443 Bacteria 3753
402 Ga0436365_1234929 3300039437 Bacteria 1980
403 Ga0436365_1703157 3300039437 Bacteria 1008
404 Ga0436363_0164243 3300039450 Bacteria 2830
405 Ga0436363_0825219 3300039450 Bacteria 14890
406 Ga0439436_0005053 3300041404 Bacteria 4041
407 Ga0439438_013265 3300041405 Bacteria 2492
408 Ga0451807_1301487 3300041486 Bacteria 1300
409 Ga0439449_0000216 3300042007 Bacteria 20485
410 Ga0439457_006206 3300042014 Bacteria 2942
411 Ga0439463_000928 3300042016 Bacteria 8037
412 Ga0439464_0019912 3300042439 Bacteria 1834
413 Ga0439464_0025373 3300042439 Bacteria 1641
414 Ga0439440_0003462 3300042993 Bacteria 3041
415 Ga0466965_0187958 3300044683 Bacteria 1092
416 Ga0466963_0020613 3300044694 Bacteria 4146
417 Ga0466963_0227983 3300044694 Bacteria 1305
418 Ga0466957_0171689 3300044842 Bacteria 1413
419 Ga0466967_0047459 3300045976 Bacteria 3744
420 Ga0466967_0092960 3300045976 Bacteria 2744
421 Ga0466967_0208199 3300045976 Bacteria 1854
422 Ga0495592_0024346 3300046454 Bacteria 4603
423 Ga0495592_0029555 3300046454 Bacteria 4149
424 Ga0495592_0058465 3300046454 Bacteria 2844
425 Ga0495629_0008427 3300046459 Bacteria 7587
426 Ga0495629_0093762 3300046459 Bacteria 2095
427 Ga0495641_0008239 3300046461 Bacteria 6382
428 Ga0495641_0078155 3300046461 Bacteria 1483
429 Ga0495651_0022055 3300046462 Bacteria 4952
430 Ga0495651_0025478 3300046462 Bacteria 4604
431 Ga0495651_0025943 3300046462 Bacteria 4562
432 Ga0495651_0045168 3300046462 Bacteria 3413
433 Ga0495653_0029313 3300046463 Bacteria 4395
434 Ga0495653_0034662 3300046463 Bacteria 3988
435 Ga0495580_0048944 3300046472 Bacteria 2990
436 Ga0495580_0066432 3300046472 Bacteria 2524
437 Ga0495582_0026256 3300046473 Bacteria 3192
438 Ga0495639_0009968 3300046475 Bacteria 4083
439 Ga0495639_0012393 3300046475 Bacteria 3677
440 Ga0495662_0000819 3300046476 Bacteria 15106
441 Ga0495662_0004408 3300046476 Bacteria 7068
442 Ga0495664_0000883 3300046477 Bacteria 15417
443 Ga0495664_0003645 3300046477 Bacteria 8392
444 Ga0495664_0114570 3300046477 Bacteria 1629
445 Ga0495594_0009238 3300046499 Bacteria 5089
446 Ga0495594_0096576 3300046499 Bacteria 1660
447 Ga0495606_0052930 3300046507 Bacteria 2636
448 Ga0495608_0028889 3300046511 Bacteria 3767
449 Ga0495608_0029982 3300046511 Bacteria 3685
450 Ga0495608_0068113 3300046511 Bacteria 2327
451 Ga0495618_0053268 3300046514 Bacteria 2558
452 Ga0495618_0325986 3300046514 Bacteria 950
453 Ga0495620_0114420 3300046515 Bacteria 1067
454 Ga0495628_0018892 3300046516 Bacteria 5704
455 Ga0495628_0063073 3300046516 Bacteria 2904
456 Ga0495630_0050896 3300046517 Bacteria 3099
457 Ga0495630_0277579 3300046517 Bacteria 1280
458 Ga0495666_0087198 3300046526 Bacteria 1474
459 Ga0495666_0183052 3300046526 Bacteria 967
460 Ga0495652_0023577 3300046529 Bacteria 5456
461 Ga0495652_0025743 3300046529 Bacteria 5200
462 Ga0495652_0035521 3300046529 Bacteria 4338
463 Ga0495665_0002411 3300046531 Bacteria 10101
464 Ga0495665_0004125 3300046531 Bacteria 7834
465 Ga0495665_0014147 3300046531 Bacteria 4306
466 Ga0495640_0010552 3300046533 Bacteria 7130
467 Ga0495640_0027073 3300046533 Bacteria 4138
468 Ga0495640_0061442 3300046533 Bacteria 2552
469 Ga0495586_0046288 3300046535 Bacteria 2345
470 Ga0495586_0077666 3300046535 Bacteria 1820
471 Ga0495587_0002559 3300046536 Bacteria 12147
472 Ga0495645_0138447 3300046543 Bacteria 1700
473 Ga0495645_0175013 3300046543 Bacteria 1474
474 Ga0495667_0015949 3300046559 Bacteria 5078
475 Ga0495667_0045814 3300046559 Bacteria 2893
476 Ga0495667_0046453 3300046559 Bacteria 2871
477 Ga0495667_0072397 3300046559 Bacteria 2246
478 Ga0495667_0167141 3300046559 Bacteria 1414
479 Ga0495668_0000128 3300046616 Bacteria 113090
480 Ga0495634_0010342 3300046642 Bacteria 6836
481 Ga0495634_0067153 3300046642 Bacteria 2372
482 Ga0495634_0111847 3300046642 Bacteria 1755
483 Ga0495635_0008079 3300046663 Bacteria 7352
484 Ga0495635_0034952 3300046663 Bacteria 3485
485 Ga0495635_0066121 3300046663 Bacteria 2479
486 Ga0495635_0088451 3300046663 Bacteria 2119
487 Ga0495588_0004164 3300046674 Bacteria 6376
488 Ga0495588_0092392 3300046674 Bacteria 1586
489 Ga0495657_0005036 3300046675 Bacteria 10498
490 Ga0495657_0029175 3300046675 Bacteria 3871
491 Ga0495657_0270262 3300046675 Bacteria 1019
492 Ga0495599_0011459 3300046678 Bacteria 5448
493 Ga0495623_0026928 3300046679 Bacteria 3699
494 Ga0495646_0001127 3300046680 Bacteria 15586
495 Ga0495647_0059680 3300046681 Bacteria 1502
496 Ga0495647_0150932 3300046681 Bacteria 996
497 Ga0495658_0043710 3300046683 Bacteria 2507
498 Ga0495658_0068312 3300046683 Bacteria 2057
499 Ga0495613_0085387 3300046689 Bacteria 2290
500 Ga0495624_0003425 3300046690 Bacteria 11767
501 Ga0495624_0122668 3300046690 Bacteria 1595
502 Ga0495600_0008622 3300046809 Bacteria 6271
503 Ga0495600_0025387 3300046809 Bacteria 3819
504 Ga0495600_0083815 3300046809 Bacteria 2080
505 Ga0495600_0111344 3300046809 Bacteria 1782
506 Ga0495600_0176505 3300046809 Bacteria 1377
507 Ga0495581_0002848 3300047315 Bacteria 9874
508 Ga0495581_0024247 3300047315 Bacteria 3516
509 Ga0495581_0036876 3300047315 Bacteria 2828
510 Ga0495604_0270334 3300047317 Bacteria 1152
511 Ga0495674_0000343 3300047319 Bacteria 41172
512 Ga0495676_0004107 3300047321 Bacteria 13268
513 Ga0495680_0012359 3300047322 Bacteria 7516
514 Ga0495680_0020099 3300047322 Bacteria 5626
515 Ga0495680_0090031 3300047322 Bacteria 2302
516 Ga0495675_0004360 3300047444 Bacteria 8564
517 Ga0495675_0025707 3300047444 Bacteria 3752
518 Ga0495675_0072148 3300047444 Bacteria 2178
519 Ga0495675_0175785 3300047444 Bacteria 1313
520 Ga0495684_0009563 3300047471 Bacteria 7473
521 Ga0495684_0022169 3300047471 Bacteria 4890
522 Ga0495684_0029003 3300047471 Bacteria 4246
523 Ga0495684_0117732 3300047471 Bacteria 2002
524 Ga0495686_0011309 3300047472 Bacteria 6292
525 Ga0495593_0003879 3300047673 Bacteria 8935
526 Ga0495593_0055727 3300047673 Bacteria 2080
527 Ga0495602_0036471 3300048088 Bacteria 4576
528 Ga0495602_0036550 3300048088 Bacteria 4570
529 Ga0495602_0241369 3300048088 Bacteria 1351
530 Ga0496100_0001703 3300048903 Bacteria 10932
531 Ga0496100_0006878 3300048903 Bacteria 6228
532 Ga0496100_0063813 3300048903 Bacteria 2435
533 Ga0496101_0001379 3300048904 Bacteria 14555
534 Ga0496101_0022710 3300048904 Bacteria 4323
535 Ga0496101_0270373 3300048904 Bacteria 1327
536 Ga0496102_0000112 3300048905 Bacteria 116902
537 Ga0496102_0157698 3300048905 Bacteria 2134
538 Ga0496102_0308478 3300048905 Bacteria 1491
539 Ga0496103_0002741 3300048906 Bacteria 10996
540 Ga0496104_0019375 3300048907 Bacteria 6223
541 Ga0496105_0004460 3300048908 Bacteria 10543
542 Ga0496105_0050648 3300048908 Bacteria 3430
543 Ga0496106_0009897 3300048909 Bacteria 7039
544 Ga0496106_0061596 3300048909 Bacteria 2847
545 Ga0496106_0136520 3300048909 Bacteria 1927
546 Ga0496107_0034883 3300048910 Bacteria 3606
547 Ga0496107_0122920 3300048910 Bacteria 1913
548 Ga0496107_0125425 3300048910 Bacteria 1893
549 Ga0496107_0242096 3300048910 Bacteria 1342
550 Ga0496108_0008900 3300048911 Bacteria 8138
551 Ga0496108_0015327 3300048911 Bacteria 6253
552 Ga0496108_0026069 3300048911 Bacteria 4821
553 Ga0496109_0006061 3300048912 Bacteria 10157
554 Ga0496109_0162133 3300048912 Bacteria 2095
555 Ga0496109_0318500 3300048912 Bacteria 1467
556 Ga0496110_0012686 3300048913 Bacteria 6935
557 Ga0496110_0065173 3300048913 Bacteria 3220
558 Ga0496110_0159542 3300048913 Bacteria 2044
559 Ga0496110_0240883 3300048913 Bacteria 1646
560 Ga0496110_0356137 3300048913 Bacteria 1333
561 Ga0496112_0202478 3300048915 Bacteria 1944
562 Ga0496112_0243975 3300048915 Bacteria 1748
563 Ga0496112_0247741 3300048915 Bacteria 1733
564 Ga0496112_0342748 3300048915 Bacteria 1437
565 Ga0496113_0262284 3300048916 Bacteria 1380
566 Ga0496114_0003564 3300048917 Bacteria 11954
567 Ga0496114_0046113 3300048917 Bacteria 3621
568 Ga0496115_0004692 3300048918 Bacteria 9906
569 Ga0496115_0013540 3300048918 Bacteria 6170
570 Ga0496115_0497632 3300048918 Bacteria 980
571 Ga0496117_0000719 3300048920 Bacteria 52226
572 Ga0496118_0003063 3300048921 Bacteria 21476
573 Ga0496119_0014589 3300048922 Bacteria 6129
574 Ga0496120_0041032 3300048923 Bacteria 2715
575 Ga0496121_0014867 3300048924 Bacteria 8209
576 Ga0496124_0169980 3300048927 Bacteria 1689
577 Ga0496126_0026694 3300048929 Bacteria 5530
578 Ga0496126_0106834 3300048929 Bacteria 2442
579 Ga0501031_0000083 3300049568 Bacteria 50175
580 Ga0501032_0000601 3300049569 Bacteria 29108
581 Ga0501033_0000592 3300049570 Bacteria 33579
582 Ga0501034_0002926 3300049571 Bacteria 19796
583 Ga0501036_0020214 3300049572 Bacteria 5591
584 Ga0501037_0000322 3300049573 Bacteria 40752
585 Ga0501038_0000509 3300049574 Bacteria 34127
586 Ga0501043_0001904 3300049579 Bacteria 17886
587 Ga0501046_0001129 3300049580 Bacteria 26074
588 Ga0501047_0005717 3300049581 Bacteria 11705
589 Ga0501047_0148413 3300049581 Bacteria 2221
590 Ga0501048_0001870 3300049582 Bacteria 15969
591 Ga0501067_0011242 3300049583 Bacteria 4954
592 Ga0501067_0045547 3300049583 Bacteria 2436
593 Ga0501068_0031267 3300049584 Bacteria 3161
594 Ga0501069_0000435 3300049585 Bacteria 18994
595 Ga0501070_0000486 3300049586 Bacteria 36121
596 Ga0501070_0530921 3300049586 Bacteria 943
597 Ga0501071_0042825 3300049587 Bacteria 3245
598 Ga0501072_0339111 3300049588 Bacteria 1194
599 Ga0501074_0000485 3300049590 Bacteria 24195
600 Ga0501080_0002417 3300049742 Bacteria 16298
601 Ga0501083_0147908 3300049744 Bacteria 1538
602 Ga0501035_0003142 3300049822 Bacteria 15865
603 Ga0501044_0001000 3300049823 Bacteria 34011
604 nmdc:mga03683_6280_c1 3300050489 Bacteria 4059
605 nmdc:mga03n38_8967_c1 3300050490 Bacteria 3614
606 nmdc:mga00v17_345864_c1 3300050491 Bacteria 967
607 nmdc:mga00v17_49151_c1 3300050491 Bacteria 2558
608 nmdc:mga07m45_139841_c1 3300050496 Bacteria 1402
609 nmdc:mga07m45_39554_c1 3300050496 Bacteria 2635
610 nmdc:mga09592_376781_c1 3300050508 Bacteria 1227
611 nmdc:mga0qj67_121013_c1 3300050509 Bacteria 2117
612 nmdc:mga0n895_84327_c1 3300050512 Bacteria 3170
613 nmdc:mga0rr50_144412_c1 3300050513 Bacteria 1917
614 nmdc:mga0rr50_172719_c1 3300050513 Bacteria 1762
615 nmdc:mga0sz30_35646_c1 3300050516 Bacteria 2077
616 Ga0495601_0013397 3300053077 Bacteria 4930
617 Ga0495601_0034522 3300053077 Bacteria 3156
618 Ga0495601_0090611 3300053077 Bacteria 1967
619 Ga0495601_0103535 3300053077 Bacteria 1840
620 Ga0495612_0002256 3300053078 Bacteria 7933
621 Ga0495612_0023533 3300053078 Bacteria 2472
622 Ga0500610_0068625 3300053079 Bacteria 1849
623 Ga0495595_0012932 3300053084 Bacteria 3521
624 Ga0495595_0057223 3300053084 Bacteria 1818
625 Ga0495619_0013162 3300053085 Bacteria 5213
626 Ga0495619_0210858 3300053085 Bacteria 1345
627 Ga0501084_0000838 3300054114 Bacteria 23716
628 Ga0590075_018405 3300059424 Bacteria 1727
629 2523384754 2523231044 Bacteria 6434991
630 2558914280 2558860112 Bacteria 9931328
631 2566992041 2565956761 Bacteria 6601618
632 2676496349 2675903060 Bacteria 10051191
633 2739236479 2738543011 Bacteria 5731169
634 2739366863 2738543034 Bacteria 6084756
635 2816509968 2816332139 Bacteria 9138787
636 2866553855 2866552031 Bacteria 5824618
637 2870788225 2870782633 Bacteria 9624083
638 2873316799 2873314349 Bacteria 8512634
639 2883823383 2883821847 Bacteria 5121194
640 2884695833 2884693830 Bacteria 11273186
641 2889305964 2889300758 Bacteria 5690814
642 2891397901 2891395885 Bacteria 9251614
643 2891559705 2891554331 Bacteria 8812224
644 2895438898 2895427314 Bacteria 13147766
645 2895445453 2895442618 Bacteria 11027144
646 2902838210 2902837492 Bacteria 6697721
647 2904538557 2904535858 Bacteria 6308016
648 2922559288 2922554459 Bacteria 6683962
649 2939744101 2939743619 Bacteria 5762299
650 2974318068 2974315732 Bacteria 4602776
651 2984526286 2984523437 Bacteria 4508481
652 3003003437 3002998708 Bacteria 11715108
653 8053951108 8053945823 Bacteria 8962862
654 8055174683 8055172936 Bacteria 9305943
655 8056055753 8056054917 Bacteria 5736694
656 8056063596 8056060235 Bacteria 7259403
657 Ga0070663_100372740
658 JGI25405J52794_10009396
659 Ga0070683_100163023
660 Ga0070683_100341451
661 Ga0070683_100344994
662 Ga0068869_100264239
663 Ga0070680_100013951
664 Ga0068868_100114912
665 Ga0068868_100231464
666 Ga0070660_100281849
667 Ga0070660_100319860
668 Ga0070687_100027165
669 Ga0070661_100075807
670 Ga0070661_100316528
671 Ga0070668_100000258
672 Ga0070669_100003538
673 Ga0070669_100054966
674 Ga0070688_100123905
675 Ga0070667_100000077
676 Ga0070667_100019017
677 Ga0070667_100047178
678 Ga0070709_10013070
679 Ga0070709_10173513
680 Ga0070709_10419568
681 Ga0070714_100032801
682 Ga0070714_100048621
683 Ga0070714_100071213
684 Ga0070713_100024532
685 Ga0070713_100202114
686 Ga0070710_10140986
687 Ga0070710_10177488
688 Ga0070701_10001956
689 Ga0070701_10019488
690 Ga0070711_100045175
691 Ga0070711_100071752
692 Ga0070700_100037644
693 Ga0070700_100040522
694 Ga0070694_100209690
695 Ga0070708_100009370
696 Ga0070708_100186943
697 Ga0070708_100267579
698 Ga0070663_100060022
699 Ga0070663_100171154
700 Ga0070662_100483462
701 Ga0070681_10027284
702 Ga0070685_10024072
703 Ga0070706_100135561
704 Ga0070707_100044139
705 Ga0070707_100059687
706 Ga0070707_100135050
707 Ga0070698_100003844
708 Ga0070698_100036644
709 Ga0070698_100107775
710 Ga0070698_100109163
711 Ga0070699_100011563
712 Ga0070679_100133509
713 Ga0070684_100067903
714 Ga0070684_100393095
715 Ga0070684_100474416
716 Ga0070684_100588735
717 Ga0068853_100048944
718 Ga0070693_100037775
719 Ga0070693_100220684
720 Ga0070665_100004932
721 Ga0070665_100133315
722 Ga0070665_100312442
723 Ga0070665_100368594
724 Ga0070665_100432938
725 Ga0070665_100673478
726 Ga0068855_100420420
727 Ga0070664_100119666
728 Ga0068857_100070741
729 Ga0068854_100534025
730 Ga0068856_100107629
731 Ga0070702_100106428
732 Ga0068852_100103556
733 Ga0068852_100206553
734 Ga0068852_100309688
735 Ga0068852_100397701
736 Ga0068852_100690761
737 Ga0068859_100000438
738 Ga0068859_100082177
739 Ga0068859_100176990
740 Ga0068864_100131976
741 Ga0068864_100157826
742 Ga0068864_100176361
743 Ga0068861_100087967
744 Ga0068861_100456802
745 Ga0068851_10049393
746 Ga0068863_100000777
747 Ga0068863_100050783
748 Ga0068863_100076977
749 Ga0068863_100183588
750 Ga0068858_100008639
751 Ga0068858_100028166
752 Ga0068860_100000010
753 Ga0068862_100000008
754 Ga0068862_100282891
755 Ga0081455_10010888
756 Ga0081455_10139924
757 Ga0081455_10283189
758 Ga0081538_10001458
759 Ga0081538_10018782
760 Ga0081540_1000156
761 Ga0081540_1054742
762 Ga0070717_10068965
763 Ga0070717_10182486
764 Ga0070717_10240726
765 Ga0075365_10039541
766 Ga0075365_10326284
767 Ga0075368_10004172
768 Ga0075363_100003797
769 Ga0075363_100024145
770 Ga0075364_10012090
771 Ga0075364_10190656
772 Ga0070715_10051000
773 Ga0070716_100055854
774 Ga0070716_100071022
775 Ga0070716_100087651
776 Ga0070716_100155328
777 Ga0070712_100228845
778 Ga0075362_10006544
779 Ga0075367_10021375
780 Ga0075369_10043994
781 Ga0075370_10021190
782 Ga0068871_100169475
783 Ga0068871_100201185
784 Ga0075428_100016777
785 Ga0075430_100141236
786 Ga0075433_10237019
787 Ga0075434_100000386
788 Ga0075434_100126571
789 Ga0097620_100000438
790 Ga0097620_100082179
791 Ga0097620_100177004
792 Ga0105251_10019722
793 Ga0105245_10017646
794 Ga0105245_10449752
795 Ga0105245_10527656
796 Ga0105247_10000019
797 Ga0105247_10201170
798 Ga0114129_10106070
799 Ga0105243_10000372
800 Ga0105243_10027521
801 Ga0105243_10164834
802 Ga0105242_10412400
803 Ga0105242_10494738
804 Ga0105248_10000093
805 Ga0105237_10114470
806 Ga0105237_10641108
807 Ga0105238_10318747
808 Ga0105249_10000019
809 Ga0105249_10141171
810 Ga0105249_10465205
811 Ga0099796_10036699
812 Ga0105239_10098950
813 Ga0105239_10535741
814 Ga0105246_10211180
815 Ga0105246_10435591
816 Ga0157373_10250593
817 Ga0157371_10200174
818 Ga0157370_10017095
819 Ga0157369_10312908
820 Ga0157374_10021356
821 Ga0157374_10087602
822 Ga0157378_10331044
823 Ga0157378_10560715
824 Ga0163162_10254654
825 Ga0163162_10348702
826 Ga0157375_10051600
827 Ga0157375_10294762
828 Ga0157375_10394875
829 Ga0163163_10015693
830 Ga0163163_10018846
831 Ga0163163_10108385
832 Ga0163163_10681579
833 Ga0157377_10012353
834 Ga0157377_10015268
835 Ga0157377_10174850
836 Ga0157379_10037572
837 Ga0157379_10143240
838 Ga0157379_10210485
839 Ga0157379_10240594
840 Ga0157376_10017900
841 Ga0157376_10439643
842 Ga0206354_10540157
843 Ga0213874_10000085
844 Ga0213874_10026100
845 Ga0213875_10000423
846 Ga0213875_10002053
847 Ga0224572_1004754
848 Ga0209673_1031481
849 Ga0209051_1007785
850 Ga0207653_10002345
851 Ga0207692_10026892
852 Ga0207692_10075902
853 Ga0207692_10209866
854 Ga0207642_10122561
855 Ga0207710_10000036
856 Ga0207710_10077607
857 Ga0207688_10009339
858 Ga0207688_10010018
859 Ga0207688_10022607
860 Ga0207680_10063111
861 Ga0207685_10042741
862 Ga0207699_10107780
863 Ga0207699_10108722
864 Ga0207645_10042033
865 Ga0207645_10111892
866 Ga0207643_10040982
867 Ga0207705_10303422
868 Ga0207654_10378700
869 Ga0207707_10020673
870 Ga0207695_10336794
871 Ga0207671_10138071
872 Ga0207671_10464236
873 Ga0207693_10017461
874 Ga0207693_10183202
875 Ga0207663_10063303
876 Ga0207663_10094214
877 Ga0207663_10108141
878 Ga0207663_10165354
879 Ga0207660_10207933
880 Ga0207660_10361807
881 Ga0207662_10002478
882 Ga0207662_10008401
883 Ga0207657_10012369
884 Ga0207657_10036933
885 Ga0207646_10030314
886 Ga0207646_10052184
887 Ga0207646_10062007
888 Ga0207646_10529302
889 Ga0207681_10000911
890 Ga0207687_10057575
891 Ga0207687_10147140
892 Ga0207687_10192749
893 Ga0207700_10065026
894 Ga0207700_10160561
895 Ga0207700_10263299
896 Ga0207700_10341897
897 Ga0207664_10011884
898 Ga0207664_10057718
899 Ga0207664_10076777
900 Ga0207664_10444799
901 Ga0207690_10313774
902 Ga0207690_10529230
903 Ga0207706_10095142
904 Ga0207706_10302382
905 Ga0207709_10002002
906 Ga0207709_10299567
907 Ga0207669_10092926
908 Ga0207669_10200170
909 Ga0207704_10219128
910 Ga0207704_10249053
911 Ga0207665_10004169
912 Ga0207665_10051344
913 Ga0207665_10084666
914 Ga0207691_10099060
915 Ga0207691_10187442
916 Ga0207711_10000102
917 Ga0207711_10164031
918 Ga0207689_10004040
919 Ga0207689_10055206
920 Ga0207689_10254047
921 Ga0207661_10538163
922 Ga0207651_10076439
923 Ga0207651_10295137
924 Ga0207712_10000025
925 Ga0207712_10074304
926 Ga0207712_10190367
927 Ga0207668_10000858
928 Ga0207668_10000935
929 Ga0207668_10102085
930 Ga0207668_10191044
931 Ga0207658_10000593
932 Ga0207677_10039843
933 Ga0207703_10019127
934 Ga0207639_10430164
935 Ga0207678_10001755
936 Ga0207678_10007984
937 Ga0207678_10069339
938 Ga0207678_10141730
939 Ga0207708_10006333
940 Ga0207708_10134055
941 Ga0207708_10259102
942 Ga0207702_10046796
943 Ga0207702_10051480
944 Ga0207641_10001204
945 Ga0207641_10097094
946 Ga0207641_10273571
947 Ga0207676_10041296
948 Ga0207676_10104628
949 Ga0207676_10502077
950 Ga0207674_10003683
951 Ga0207674_10024205
952 Ga0207675_100038196
953 Ga0207675_100154012
954 Ga0207675_100301889
955 Ga0207683_10001399
956 Ga0207683_10204388
957 Ga0207698_10126177
958 Ga0207698_10150377
959 Ga0207698_10236013
960 Ga0207698_10236606
961 Ga0207698_10320651
962 Ga0207698_10502371
963 Ga0207698_10552144
964 Ga0268266_10069140
965 Ga0268266_10069577
966 Ga0268266_10187352
967 Ga0268266_10232041
968 Ga0268265_10000007
969 Ga0268265_10046065
970 Ga0268264_10000007
971 Ga0307513_10000099
972 Ga0307513_10028657
973 Ga0307508_10019206
974 Ga0307508_10037884
975 Ga0307508_10240419
976 Ga0307516_10005615
977 Ga0307405_10069564
978 Ga0307413_10013785
979 Ga0307413_10361296
980 Ga0307410_10049347
981 Ga0307410_10288707
982 Ga0307406_10203365
983 Ga0307406_10295725
984 Ga0307407_10054524
985 Ga0307407_10113276
986 Ga0307409_100026229
987 Ga0307416_100019592
988 Ga0307415_100150226
989 Ga0373948_0000204
990 Ga0373926_0001463
991 Ga0373926_0017008
992 Ga0373926_0058420
993 Ga0373934_0011207
994 Ga0373934_0020842
995 Ga0373934_0102956
996 Ga0373944_0001058
997 Ga0373944_0004526
998 Ga0373944_0040359
999 Ga0373951_0000039
1000 Ga0373951_0007932
1001 Ga0373923_0010339
1002 Ga0373923_0047755
1003 Ga0373932_0007992
1004 Ga0373936_0002239
1005 Ga0373936_0026026
1006 Ga0373945_0001355
1007 Ga0373945_0105211
1008 Ga0373953_0040653
1009 Ga0373953_0061716
1010 Ga0373953_0114476
1011 Ga0373954_0045129
1012 Ga0373954_0085719
1013 Ga0373956_0003308
1014 Ga0373956_0013708
1015 Ga0373956_0063674
1016 Ga0373956_0066636
1017 Ga0373957_0032276
1018 Ga0373957_0069699
1019 Ga0373943_0000325
1020 Ga0373943_0112309
1021 Ga0373946_0000069
1022 Ga0373946_0032964
1023 Ga0373946_0096462
1024 Ga0373955_0008122
1025 Ga0373955_0027930
1026 Ga0373955_0045263
1027 Ga0373924_0005189
1028 Ga0373924_0163983
1029 Ga0373931_0174836
1030 Ga0373935_0003836
1031 Ga0373935_0018326
1032 Ga0373935_0031499
1033 Ga0373935_0420021
1034 Ga0373927_0001455
1035 Ga0373927_0002533
1036 Ga0373933_0000434
1037 Ga0373933_0029361
1038 Ga0373933_0097975
1039 Ga0373947_0001505
1040 Ga0373947_0104754
1041 Ga0373947_0302615
1042 Ga0373937_0005355
1043 Ga0373937_0066635
1044 Ga0373937_0096663
1045 Ga0373937_0213554
1046 Ga0373937_0257574
1047 Ga0373925_0020535
1048 Ga0373925_0081441
1049 Ga0373925_0263269
1050 Ga0373925_0263327
1051 Ga0395900_0337245
1052 Ga0395898_0029201
1053 Ga0395905_0092070
1054 Ga0436364_0735608
1055 Ga0436364_0838309
1056 Ga0436364_0862533
1057 Ga0395901_0066546
1058 Ga0436365_1234929
1059 Ga0436365_1703157
1060 Ga0436363_0164243
1061 Ga0436363_0825219
1062 Ga0439436_0005053
1063 Ga0439438_013265
1064 Ga0451807_1301487
1065 Ga0439449_0000216
1066 Ga0439457_006206
1067 Ga0439463_000928
1068 Ga0439464_0019912
1069 Ga0439464_0025373
1070 Ga0439440_0003462
1071 Ga0466965_0187958
1072 Ga0466963_0020613
1073 Ga0466963_0227983
1074 Ga0466957_0171689
1075 Ga0466967_0047459
1076 Ga0466967_0092960
1077 Ga0466967_0208199
1078 Ga0495592_0024346
1079 Ga0495592_0029555
1080 Ga0495592_0058465
1081 Ga0495629_0008427
1082 Ga0495629_0093762
1083 Ga0495641_0008239
1084 Ga0495641_0078155
1085 Ga0495651_0022055
1086 Ga0495651_0025478
1087 Ga0495651_0025943
1088 Ga0495651_0045168
1089 Ga0495653_0029313
1090 Ga0495653_0034662
1091 Ga0495580_0048944
1092 Ga0495580_0066432
1093 Ga0495582_0026256
1094 Ga0495639_0009968
1095 Ga0495639_0012393
1096 Ga0495662_0000819
1097 Ga0495662_0004408
1098 Ga0495664_0000883
1099 Ga0495664_0003645
1100 Ga0495664_0114570
1101 Ga0495594_0009238
1102 Ga0495594_0096576
1103 Ga0495606_0052930
1104 Ga0495608_0028889
1105 Ga0495608_0029982
1106 Ga0495608_0068113
1107 Ga0495618_0053268
1108 Ga0495618_0325986
1109 Ga0495620_0114420
1110 Ga0495628_0018892
1111 Ga0495628_0063073
1112 Ga0495630_0050896
1113 Ga0495630_0277579
1114 Ga0495666_0087198
1115 Ga0495666_0183052
1116 Ga0495652_0023577
1117 Ga0495652_0025743
1118 Ga0495652_0035521
1119 Ga0495665_0002411
1120 Ga0495665_0004125
1121 Ga0495665_0014147
1122 Ga0495640_0010552
1123 Ga0495640_0027073
1124 Ga0495640_0061442
1125 Ga0495586_0046288
1126 Ga0495586_0077666
1127 Ga0495587_0002559
1128 Ga0495645_0138447
1129 Ga0495645_0175013
1130 Ga0495667_0015949
1131 Ga0495667_0045814
1132 Ga0495667_0046453
1133 Ga0495667_0072397
1134 Ga0495667_0167141
1135 Ga0495668_0000128
1136 Ga0495634_0010342
1137 Ga0495634_0067153
1138 Ga0495634_0111847
1139 Ga0495635_0008079
1140 Ga0495635_0034952
1141 Ga0495635_0066121
1142 Ga0495635_0088451
1143 Ga0495588_0004164
1144 Ga0495588_0092392
1145 Ga0495657_0005036
1146 Ga0495657_0029175
1147 Ga0495657_0270262
1148 Ga0495599_0011459
1149 Ga0495623_0026928
1150 Ga0495646_0001127
1151 Ga0495647_0059680
1152 Ga0495647_0150932
1153 Ga0495658_0043710
1154 Ga0495658_0068312
1155 Ga0495613_0085387
1156 Ga0495624_0003425
1157 Ga0495624_0122668
1158 Ga0495600_0008622
1159 Ga0495600_0025387
1160 Ga0495600_0083815
1161 Ga0495600_0111344
1162 Ga0495600_0176505
1163 Ga0495581_0002848
1164 Ga0495581_0024247
1165 Ga0495581_0036876
1166 Ga0495604_0270334
1167 Ga0495674_0000343
1168 Ga0495676_0004107
1169 Ga0495680_0012359
1170 Ga0495680_0020099
1171 Ga0495680_0090031
1172 Ga0495675_0004360
1173 Ga0495675_0025707
1174 Ga0495675_0072148
1175 Ga0495675_0175785
1176 Ga0495684_0009563
1177 Ga0495684_0022169
1178 Ga0495684_0029003
1179 Ga0495684_0117732
1180 Ga0495686_0011309
1181 Ga0495593_0003879
1182 Ga0495593_0055727
1183 Ga0495602_0036471
1184 Ga0495602_0036550
1185 Ga0495602_0241369
1186 Ga0496100_0001703
1187 Ga0496100_0006878
1188 Ga0496100_0063813
1189 Ga0496101_0001379
1190 Ga0496101_0022710
1191 Ga0496101_0270373
1192 Ga0496102_0000112
1193 Ga0496102_0157698
1194 Ga0496102_0308478
1195 Ga0496103_0002741
1196 Ga0496104_0019375
1197 Ga0496105_0004460
1198 Ga0496105_0050648
1199 Ga0496106_0009897
1200 Ga0496106_0061596
1201 Ga0496106_0136520
1202 Ga0496107_0034883
1203 Ga0496107_0122920
1204 Ga0496107_0125425
1205 Ga0496107_0242096
1206 Ga0496108_0008900
1207 Ga0496108_0015327
1208 Ga0496108_0026069
1209 Ga0496109_0006061
1210 Ga0496109_0162133
1211 Ga0496109_0318500
1212 Ga0496110_0012686
1213 Ga0496110_0065173
1214 Ga0496110_0159542
1215 Ga0496110_0240883
1216 Ga0496110_0356137
1217 Ga0496112_0202478
1218 Ga0496112_0243975
1219 Ga0496112_0247741
1220 Ga0496112_0342748
1221 Ga0496113_0262284
1222 Ga0496114_0003564
1223 Ga0496114_0046113
1224 Ga0496115_0004692
1225 Ga0496115_0013540
1226 Ga0496115_0497632
1227 Ga0496117_0000719
1228 Ga0496118_0003063
1229 Ga0496119_0014589
1230 Ga0496120_0041032
1231 Ga0496121_0014867
1232 Ga0496124_0169980
1233 Ga0496126_0026694
1234 Ga0496126_0106834
1235 Ga0501031_0000083
1236 Ga0501032_0000601
1237 Ga0501033_0000592
1238 Ga0501034_0002926
1239 Ga0501036_0020214
1240 Ga0501037_0000322
1241 Ga0501038_0000509
1242 Ga0501043_0001904
1243 Ga0501046_0001129
1244 Ga0501047_0005717
1245 Ga0501047_0148413
1246 Ga0501048_0001870
1247 Ga0501067_0011242
1248 Ga0501067_0045547
1249 Ga0501068_0031267
1250 Ga0501069_0000435
1251 Ga0501070_0000486
1252 Ga0501070_0530921
1253 Ga0501071_0042825
1254 Ga0501072_0339111
1255 Ga0501074_0000485
1256 Ga0501080_0002417
1257 Ga0501083_0147908
1258 Ga0501035_0003142
1259 Ga0501044_0001000
1260 nmdc:mga03683_6280_c1
1261 nmdc:mga03n38_8967_c1
1262 nmdc:mga00v17_345864_c1
1263 nmdc:mga00v17_49151_c1
1264 nmdc:mga07m45_139841_c1
1265 nmdc:mga07m45_39554_c1
1266 nmdc:mga09592_376781_c1
1267 nmdc:mga0qj67_121013_c1
1268 nmdc:mga0n895_84327_c1
1269 nmdc:mga0rr50_144412_c1
1270 nmdc:mga0rr50_172719_c1
1271 nmdc:mga0sz30_35646_c1
1272 Ga0495601_0013397
1273 Ga0495601_0034522
1274 Ga0495601_0090611
1275 Ga0495601_0103535
1276 Ga0495612_0002256
1277 Ga0495612_0023533
1278 Ga0500610_0068625
1279 Ga0495595_0012932
1280 Ga0495595_0057223
1281 Ga0495619_0013162
1282 Ga0495619_0210858
1283 Ga0501084_0000838
1284 Ga0590075_018405
1285 2523384754
1286 2558914280
1287 2566992041
1288 2676496349
1289 2739236479
1290 2739366863
1291 2816509968
1292 2866553855
1293 2870788225
1294 2873316799
1295 2883823383
1296 2884695833
1297 2889305964
1298 2891397901
1299 2891559705
1300 2895438898
1301 2895445453
1302 2902838210
1303 2904538557
1304 2922559288
1305 2939744101
1306 2974318068
1307 2984526286
1308 3003003437
1309 8053951108
1310 8055174683
1311 8056055753
1312 8056063596

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04962

KduI

KduI/IolB family

14

282

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qjv-assembly1.cif.gz_A crystal structure of an iolb-like protein (stm4420) from salmonella typhimurium lt2 at 1.90 a resolution 0.9338 5 272
2qjv-assembly1.cif.gz_A crystal structure of an iolb-like protein (stm4420) from salmonella typhimurium lt2 at 1.90 a resolution 0.9235 5 272
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8378 31 112
7zyb-assembly1.cif.gz_A bekdgf with ca 0.83 32 114
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.8256 30 115
ID Description Score Start End Superfamily
2qjvB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9179 129 272 2.60.120.10
2qjvB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8776 22 125 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8543 33 112 2.60.120.10
af_Q9FZH5_335_433_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8512 14 110 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8458 32 112 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W0HAC0-F1-model_v4 5-deoxy-glucuronate isomerase 0.9953 9 164 GO:0008880
GO:0019310
AF-A0A3D0R0C0-F1-model_v4 5-deoxy-glucuronate isomerase 0.9925 9 122 GO:0008880
GO:0019310
AF-A0A4Z0HG21-F1-model_v4 5-deoxy-glucuronate isomerase (EC 5.3.1.30) 0.992 6 285 GO:0008880
GO:0019310
GO:0102482
AF-A0A4Q4D420-F1-model_v4 5-deoxy-glucuronate isomerase (EC 5.3.1.30) 0.9911 7 246 GO:0008880
GO:0019310
GO:0102482
AF-A0A3P1SGG9-F1-model_v4 5-deoxy-glucuronate isomerase (EC 5.3.1.30) 0.9883 6 285 GO:0008880
GO:0019310
GO:0102482

Map