F472927

General Info

Members Datasets Scaffolds Average Seq Length
655 211 1310 96

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10590105|Ga0207678_105901052
Length 104
Sequence VSTFAIILGCIVFMIVVASVRGDPGRAIADTTLLVIFVGFVAALDFVFSRFMDTGYAASLITIFLAAGFALDALYGLLAPERQKRRDRKLRRLMTATATHRKEF

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
163 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
164 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
165 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
166 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
167 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
168 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
169 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.41
Rhizosphere 93.44
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10590105 3300026067 Bacteria 973
2 MBSR1b_contig_525930 2162886012 Bacteria 850
3 JGI24739J22299_10022368 3300001989 Bacteria 2243
4 JGI24739J22299_10098156 3300001989 Bacteria 886
5 JGI24739J22299_10252960 3300001989 Bacteria 516
6 JGI24748J21848_1056426 3300002074 Unclassified 519
7 JGI24738J21930_10120180 3300002075 Bacteria 570
8 JGI24744J21845_10004337 3300002077 Bacteria 2929
9 Ga0065712_10012271 3300005290 Bacteria 2253
10 Ga0065712_10100361 3300005290 Bacteria 2064
11 Ga0065712_10278316 3300005290 Bacteria 901
12 Ga0065712_10686398 3300005290 Bacteria 543
13 Ga0065715_10160804 3300005293 Bacteria 1631
14 Ga0065715_10214463 3300005293 Bacteria 1297
15 Ga0065715_10240730 3300005293 Bacteria 1200
16 Ga0065715_10392796 3300005293 Bacteria 889
17 Ga0070658_10013862 3300005327 Bacteria 6470
18 Ga0070658_10142809 3300005327 Bacteria 2000
19 Ga0070658_10175915 3300005327 Bacteria 1800
20 Ga0070658_10310460 3300005327 Bacteria 1345
21 Ga0070658_10827466 3300005327 Bacteria 804
22 Ga0070676_10110587 3300005328 Bacteria 1710
23 Ga0070676_10141147 3300005328 Bacteria 1534
24 Ga0070676_10652749 3300005328 Bacteria 764
25 Ga0070676_10698486 3300005328 Bacteria 740
26 Ga0070683_101711693 3300005329 Bacteria 605
27 Ga0070690_100066299 3300005330 Bacteria 2337
28 Ga0070690_100529546 3300005330 Bacteria 885
29 Ga0070670_100001880 3300005331 Bacteria 17138
30 Ga0070670_100024638 3300005331 Bacteria 5174
31 Ga0070670_100052439 3300005331 Bacteria 3503
32 Ga0070670_100323894 3300005331 Bacteria 1351
33 Ga0070670_100433723 3300005331 Bacteria 1163
34 Ga0070670_100864148 3300005331 Bacteria 819
35 Ga0070677_10018571 3300005333 Bacteria 2505
36 Ga0070677_10158012 3300005333 Bacteria 1061
37 Ga0070677_10209201 3300005333 Bacteria 946
38 Ga0070677_10533729 3300005333 Bacteria 641
39 Ga0068869_100042802 3300005334 Bacteria 3249
40 Ga0068869_100795224 3300005334 Bacteria 812
41 Ga0070666_10000753 3300005335 Bacteria 19635
42 Ga0070666_11243055 3300005335 Unclassified 555
43 Ga0070682_100422386 3300005337 Bacteria 1014
44 Ga0068868_100015820 3300005338 Bacteria 5588
45 Ga0068868_100064630 3300005338 Bacteria 2905
46 Ga0068868_100145813 3300005338 Bacteria 1946
47 Ga0068868_100607730 3300005338 Bacteria 969
48 Ga0070660_100201410 3300005339 Bacteria 1615
49 Ga0070660_100385892 3300005339 Bacteria 1157
50 Ga0070660_100398649 3300005339 Bacteria 1138
51 Ga0070660_100606510 3300005339 Bacteria 915
52 Ga0070660_101269204 3300005339 Bacteria 625
53 Ga0070689_101107872 3300005340 Bacteria 708
54 Ga0070661_100088607 3300005344 Bacteria 2291
55 Ga0070661_100164545 3300005344 Bacteria 1681
56 Ga0070661_100211230 3300005344 Bacteria 1486
57 Ga0070661_100510975 3300005344 Bacteria 963
58 Ga0070661_100801955 3300005344 Bacteria 773
59 Ga0070668_100044906 3300005347 Bacteria 3390
60 Ga0070668_100249287 3300005347 Bacteria 1473
61 Ga0070668_100699480 3300005347 Bacteria 894
62 Ga0070668_100737365 3300005347 Bacteria 871
63 Ga0070668_101057612 3300005347 Bacteria 731
64 Ga0070669_100146964 3300005353 Bacteria 1822
65 Ga0070669_100166345 3300005353 Bacteria 1717
66 Ga0070669_100327854 3300005353 Bacteria 1238
67 Ga0070669_100336203 3300005353 Bacteria 1223
68 Ga0070669_100614386 3300005353 Bacteria 912
69 Ga0070669_100876794 3300005353 Bacteria 766
70 Ga0070669_100921553 3300005353 Bacteria 747
71 Ga0070669_101076253 3300005353 Bacteria 692
72 Ga0070675_100002250 3300005354 Bacteria 14308
73 Ga0070675_100045513 3300005354 Bacteria 3591
74 Ga0070675_100106900 3300005354 Bacteria 2362
75 Ga0070675_102023181 3300005354 Bacteria 531
76 Ga0070671_100001083 3300005355 Bacteria 20150
77 Ga0070671_100005295 3300005355 Bacteria 10294
78 Ga0070671_100038926 3300005355 Bacteria 3946
79 Ga0070671_100118009 3300005355 Bacteria 2231
80 Ga0070671_100142598 3300005355 Bacteria 2022
81 Ga0070671_100227571 3300005355 Bacteria 1582
82 Ga0070671_100258317 3300005355 Bacteria 1480
83 Ga0070671_100379662 3300005355 Bacteria 1208
84 Ga0070674_100070714 3300005356 Bacteria 2466
85 Ga0070674_100108445 3300005356 Bacteria 2035
86 Ga0070674_100236642 3300005356 Bacteria 1427
87 Ga0070674_101215085 3300005356 Bacteria 670
88 Ga0070673_100086003 3300005364 Bacteria 2561
89 Ga0070673_100086455 3300005364 Bacteria 2554
90 Ga0070673_100106289 3300005364 Bacteria 2320
91 Ga0070673_100128297 3300005364 Bacteria 2125
92 Ga0070673_100181566 3300005364 Bacteria 1802
93 Ga0070673_100272324 3300005364 Bacteria 1482
94 Ga0070673_100403011 3300005364 Bacteria 1223
95 Ga0070673_101019181 3300005364 Bacteria 771
96 Ga0070673_101358876 3300005364 Bacteria 668
97 Ga0070688_101100659 3300005365 Bacteria 635
98 Ga0070659_100166023 3300005366 Bacteria 1806
99 Ga0070659_100367670 3300005366 Bacteria 1209
100 Ga0070659_100617788 3300005366 Bacteria 932
101 Ga0070659_100836970 3300005366 Bacteria 802
102 Ga0070659_101158625 3300005366 Bacteria 683
103 Ga0070667_100084374 3300005367 Bacteria 2722
104 Ga0070667_100143772 3300005367 Bacteria 2091
105 Ga0070714_100177981 3300005435 Bacteria 1934
106 Ga0070714_100327586 3300005435 Bacteria 1434
107 Ga0070714_100653263 3300005435 Bacteria 1012
108 Ga0070714_101482673 3300005435 Bacteria 662
109 Ga0070713_100567793 3300005436 Bacteria 1076
110 Ga0070663_100301384 3300005455 Bacteria 1283
111 Ga0070663_100604384 3300005455 Bacteria 923
112 Ga0070663_100950483 3300005455 Bacteria 745
113 Ga0070663_101192381 3300005455 Bacteria 669
114 Ga0070678_100090164 3300005456 Bacteria 2349
115 Ga0070678_100182342 3300005456 Bacteria 1720
116 Ga0070678_102245317 3300005456 Bacteria 518
117 Ga0070662_100013148 3300005457 Bacteria 5502
118 Ga0070662_100027100 3300005457 Bacteria 3975
119 Ga0070662_100200909 3300005457 Bacteria 1582
120 Ga0070662_100335750 3300005457 Bacteria 1235
121 Ga0070662_100497867 3300005457 Bacteria 1016
122 Ga0070662_100500413 3300005457 Bacteria 1013
123 Ga0070662_100808458 3300005457 Bacteria 797
124 Ga0070662_100929559 3300005457 Bacteria 743
125 Ga0068867_100071782 3300005459 Bacteria 2590
126 Ga0070672_100001827 3300005543 Bacteria 13276
127 Ga0070672_100116053 3300005543 Bacteria 2187
128 Ga0070672_100143282 3300005543 Bacteria 1973
129 Ga0070672_100325581 3300005543 Bacteria 1307
130 Ga0070672_100363400 3300005543 Bacteria 1236
131 Ga0070686_100917576 3300005544 Bacteria 713
132 Ga0070693_100473122 3300005547 Bacteria 884
133 Ga0070665_100023392 3300005548 Bacteria 6220
134 Ga0070665_100331096 3300005548 Bacteria 1527
135 Ga0070665_100602690 3300005548 Bacteria 1111
136 Ga0070665_102293441 3300005548 Bacteria 543
137 Ga0070664_100001469 3300005564 Bacteria 18785
138 Ga0070664_100159857 3300005564 Bacteria 1993
139 Ga0070664_100231616 3300005564 Bacteria 1656
140 Ga0070664_100276687 3300005564 Bacteria 1513
141 Ga0070664_102237011 3300005564 Bacteria 519
142 Ga0068857_100439411 3300005577 Bacteria 1219
143 Ga0068854_100049937 3300005578 Bacteria 2990
144 Ga0068856_100617998 3300005614 Bacteria 1104
145 Ga0068856_100813970 3300005614 Bacteria 953
146 Ga0070702_100646680 3300005615 Bacteria 799
147 Ga0068852_100205490 3300005616 Bacteria 1865
148 Ga0068852_100251426 3300005616 Bacteria 1694
149 Ga0068852_100634290 3300005616 Bacteria 1075
150 Ga0068852_101807125 3300005616 Bacteria 633
151 Ga0068859_100660965 3300005617 Bacteria 1137
152 Ga0068864_100001619 3300005618 Bacteria 18541
153 Ga0068864_101139680 3300005618 Bacteria 777
154 Ga0068864_101663026 3300005618 Bacteria 643
155 Ga0068866_10039647 3300005718 Bacteria 2326
156 Ga0068861_100767215 3300005719 Bacteria 902
157 Ga0068851_10372175 3300005834 Bacteria 835
158 Ga0068870_10502344 3300005840 Bacteria 808
159 Ga0068863_100026932 3300005841 Bacteria 5482
160 Ga0068863_100684227 3300005841 Bacteria 1019
161 Ga0068863_102376615 3300005841 Bacteria 540
162 Ga0068858_100006170 3300005842 Bacteria 11688
163 Ga0068860_102306744 3300005843 Bacteria 559
164 Ga0070717_11174483 3300006028 Bacteria 698
165 Ga0097621_100313625 3300006237 Bacteria 1388
166 Ga0097621_100973033 3300006237 Bacteria 793
167 Ga0097621_101397024 3300006237 Bacteria 663
168 Ga0097621_101692729 3300006237 Unclassified 602
169 Ga0068871_100465221 3300006358 Bacteria 1135
170 Ga0068871_100636070 3300006358 Bacteria 973
171 Ga0068871_100798520 3300006358 Bacteria 870
172 Ga0068865_100128090 3300006881 Bacteria 1898
173 Ga0068865_100845314 3300006881 Bacteria 793
174 Ga0068865_101187716 3300006881 Bacteria 675
175 Ga0097620_100660896 3300006931 Bacteria 1137
176 Ga0105245_10072816 3300009098 Bacteria 3122
177 Ga0105245_10345585 3300009098 Bacteria 1472
178 Ga0105245_10381598 3300009098 Bacteria 1403
179 Ga0105243_11445609 3300009148 Unclassified 709
180 Ga0105241_11141883 3300009174 Bacteria 735
181 Ga0105242_10883452 3300009176 Bacteria 892
182 Ga0105242_11241590 3300009176 Unclassified 766
183 Ga0105248_10001364 3300009177 Bacteria 27266
184 Ga0105248_10002158 3300009177 Bacteria 21772
185 Ga0105248_10011642 3300009177 Bacteria 9692
186 Ga0105248_10080763 3300009177 Bacteria 3655
187 Ga0105248_10101724 3300009177 Bacteria 3239
188 Ga0105248_10150856 3300009177 Bacteria 2622
189 Ga0105248_12248674 3300009177 Bacteria 621
190 Ga0105249_11561639 3300009553 Bacteria 732
191 Ga0105246_10915028 3300011119 Bacteria 788
192 Ga0157373_10465333 3300013100 Bacteria 911
193 Ga0157371_10294542 3300013102 Bacteria 1174
194 Ga0157371_11030945 3300013102 Bacteria 629
195 Ga0157371_11241900 3300013102 Unclassified 575
196 Ga0157369_10877844 3300013105 Bacteria 920
197 Ga0157369_12032439 3300013105 Bacteria 583
198 Ga0157374_10906684 3300013296 Bacteria 899
199 Ga0157374_10921845 3300013296 Bacteria 892
200 Ga0157374_10994809 3300013296 Bacteria 858
201 Ga0157374_11528579 3300013296 Bacteria 691
202 Ga0157374_12485919 3300013296 Unclassified 545
203 Ga0157378_12110865 3300013297 Bacteria 614
204 Ga0163162_12861650 3300013306 Bacteria 555
205 Ga0157372_11220950 3300013307 Bacteria 869
206 Ga0157372_12113388 3300013307 Bacteria 647
207 Ga0157375_10258067 3300013308 Bacteria 1904
208 Ga0157375_10383603 3300013308 Bacteria 1572
209 Ga0157375_10729789 3300013308 Bacteria 1143
210 Ga0157375_10810202 3300013308 Bacteria 1085
211 Ga0157375_11114603 3300013308 Bacteria 924
212 Ga0157375_13005082 3300013308 Bacteria 563
213 Ga0163163_10416637 3300014325 Bacteria 1402
214 Ga0157380_10228229 3300014326 Bacteria 1670
215 Ga0157380_12646371 3300014326 Bacteria 568
216 Ga0157379_10058108 3300014968 Bacteria 3458
217 Ga0163161_10043355 3300017792 Bacteria 3239
218 Ga0163161_10077314 3300017792 Bacteria 2445
219 Ga0207697_10038945 3300025315 Bacteria 1950
220 Ga0207697_10480733 3300025315 Bacteria 549
221 Ga0207656_10181353 3300025321 Bacteria 1011
222 Ga0207682_10014876 3300025893 Bacteria 3030
223 Ga0207682_10141276 3300025893 Bacteria 1081
224 Ga0207682_10182254 3300025893 Bacteria 960
225 Ga0207642_10109605 3300025899 Bacteria 1403
226 Ga0207642_10302913 3300025899 Bacteria 927
227 Ga0207688_10131967 3300025901 Bacteria 1465
228 Ga0207688_10183039 3300025901 Bacteria 1250
229 Ga0207688_10293099 3300025901 Bacteria 993
230 Ga0207688_11013799 3300025901 Unclassified 525
231 Ga0207680_10001044 3300025903 Bacteria 13083
232 Ga0207680_10195750 3300025903 Bacteria 1375
233 Ga0207647_10048524 3300025904 Bacteria 2636
234 Ga0207645_10015636 3300025907 Bacteria 5035
235 Ga0207645_10098403 3300025907 Bacteria 1886
236 Ga0207645_10193319 3300025907 Bacteria 1337
237 Ga0207645_10695600 3300025907 Bacteria 691
238 Ga0207643_10217544 3300025908 Bacteria 1168
239 Ga0207643_10253801 3300025908 Bacteria 1084
240 Ga0207705_10016677 3300025909 Bacteria 5261
241 Ga0207705_10078207 3300025909 Bacteria 2407
242 Ga0207705_10278022 3300025909 Bacteria 1281
243 Ga0207705_10350550 3300025909 Bacteria 1137
244 Ga0207654_11028611 3300025911 Bacteria 599
245 Ga0207693_10784583 3300025915 Bacteria 735
246 Ga0207657_10039308 3300025919 Bacteria 4206
247 Ga0207657_10251715 3300025919 Bacteria 1408
248 Ga0207657_10756852 3300025919 Bacteria 752
249 Ga0207657_10832339 3300025919 Bacteria 713
250 Ga0207649_10008681 3300025920 Bacteria 5550
251 Ga0207649_10063906 3300025920 Bacteria 2325
252 Ga0207649_10257775 3300025920 Bacteria 1259
253 Ga0207649_10486822 3300025920 Bacteria 936
254 Ga0207649_10764822 3300025920 Bacteria 752
255 Ga0207681_10040784 3300025923 Bacteria 3091
256 Ga0207681_10164164 3300025923 Bacteria 1677
257 Ga0207681_10199372 3300025923 Bacteria 1536
258 Ga0207681_10270657 3300025923 Bacteria 1333
259 Ga0207681_10421673 3300025923 Bacteria 1081
260 Ga0207681_10543614 3300025923 Bacteria 955
261 Ga0207681_10663914 3300025923 Bacteria 865
262 Ga0207681_10698712 3300025923 Bacteria 843
263 Ga0207681_10712864 3300025923 Bacteria 835
264 Ga0207650_10001425 3300025925 Bacteria 17234
265 Ga0207650_10021807 3300025925 Bacteria 4529
266 Ga0207650_10113694 3300025925 Bacteria 2099
267 Ga0207650_10175928 3300025925 Bacteria 1703
268 Ga0207650_10983033 3300025925 Bacteria 718
269 Ga0207650_11632466 3300025925 Bacteria 547
270 Ga0207659_10001814 3300025926 Bacteria 12637
271 Ga0207659_10070015 3300025926 Bacteria 2557
272 Ga0207659_10098898 3300025926 Bacteria 2195
273 Ga0207659_10489465 3300025926 Bacteria 1040
274 Ga0207659_11451532 3300025926 Bacteria 587
275 Ga0207687_10038652 3300025927 Bacteria 3262
276 Ga0207687_10112523 3300025927 Bacteria 2023
277 Ga0207687_10516589 3300025927 Bacteria 998
278 Ga0207700_10124615 3300025928 Bacteria 2094
279 Ga0207664_10193111 3300025929 Bacteria 1753
280 Ga0207664_10323262 3300025929 Bacteria 1361
281 Ga0207664_11555840 3300025929 Bacteria 583
282 Ga0207644_10000415 3300025931 Bacteria 27794
283 Ga0207644_10004423 3300025931 Bacteria 9121
284 Ga0207644_10089919 3300025931 Bacteria 2286
285 Ga0207644_10135685 3300025931 Bacteria 1889
286 Ga0207644_10261390 3300025931 Bacteria 1384
287 Ga0207644_10266805 3300025931 Bacteria 1370
288 Ga0207644_10369424 3300025931 Bacteria 1168
289 Ga0207644_10500661 3300025931 Bacteria 1002
290 Ga0207690_10082860 3300025932 Bacteria 2244
291 Ga0207690_10266412 3300025932 Bacteria 1329
292 Ga0207690_10943467 3300025932 Bacteria 717
293 Ga0207690_10963982 3300025932 Bacteria 709
294 Ga0207706_10078536 3300025933 Bacteria 2903
295 Ga0207706_10078674 3300025933 Bacteria 2900
296 Ga0207706_10109313 3300025933 Bacteria 2433
297 Ga0207706_10117905 3300025933 Bacteria 2335
298 Ga0207706_10127261 3300025933 Bacteria 2240
299 Ga0207706_10191796 3300025933 Bacteria 1793
300 Ga0207706_10200722 3300025933 Bacteria 1749
301 Ga0207706_10593540 3300025933 Bacteria 952
302 Ga0207706_10614588 3300025933 Bacteria 933
303 Ga0207706_11623621 3300025933 Bacteria 523
304 Ga0207709_11315419 3300025935 Bacteria 597
305 Ga0207670_10191420 3300025936 Bacteria 1548
306 Ga0207669_10002095 3300025937 Bacteria 8458
307 Ga0207669_10063236 3300025937 Bacteria 2283
308 Ga0207669_10224377 3300025937 Bacteria 1381
309 Ga0207704_10025142 3300025938 Bacteria 3245
310 Ga0207704_10915453 3300025938 Bacteria 738
311 Ga0207691_10021931 3300025940 Bacteria 6027
312 Ga0207691_10134728 3300025940 Bacteria 2180
313 Ga0207691_10286937 3300025940 Bacteria 1416
314 Ga0207691_10304889 3300025940 Bacteria 1367
315 Ga0207691_10342887 3300025940 Bacteria 1279
316 Ga0207691_10408397 3300025940 Bacteria 1158
317 Ga0207711_10000420 3300025941 Bacteria 44798
318 Ga0207711_10001208 3300025941 Bacteria 24465
319 Ga0207711_10373120 3300025941 Bacteria 1323
320 Ga0207711_10476110 3300025941 Bacteria 1163
321 Ga0207711_10551863 3300025941 Bacteria 1075
322 Ga0207711_11550389 3300025941 Bacteria 606
323 Ga0207689_10093842 3300025942 Bacteria 2465
324 Ga0207689_11042730 3300025942 Bacteria 690
325 Ga0207679_10137934 3300025945 Bacteria 1967
326 Ga0207679_10167947 3300025945 Bacteria 1803
327 Ga0207679_10223764 3300025945 Bacteria 1584
328 Ga0207679_10317119 3300025945 Bacteria 1349
329 Ga0207679_10412431 3300025945 Bacteria 1190
330 Ga0207679_10434715 3300025945 Bacteria 1161
331 Ga0207679_10568541 3300025945 Bacteria 1019
332 Ga0207679_10898988 3300025945 Bacteria 810
333 Ga0207679_11984453 3300025945 Bacteria 530
334 Ga0207667_10759452 3300025949 Bacteria 968
335 Ga0207651_10005284 3300025960 Bacteria 6608
336 Ga0207651_10016674 3300025960 Bacteria 4313
337 Ga0207651_10043084 3300025960 Bacteria 3009
338 Ga0207651_10167277 3300025960 Bacteria 1730
339 Ga0207651_10822740 3300025960 Bacteria 824
340 Ga0207651_10908953 3300025960 Bacteria 784
341 Ga0207668_10080512 3300025972 Bacteria 2360
342 Ga0207668_10351209 3300025972 Bacteria 1233
343 Ga0207668_10756278 3300025972 Unclassified 858
344 Ga0207668_11760826 3300025972 Bacteria 559
345 Ga0207668_11781815 3300025972 Bacteria 556
346 Ga0207658_10002673 3300025986 Bacteria 12909
347 Ga0207658_11682235 3300025986 Bacteria 580
348 Ga0207677_10011520 3300026023 Bacteria 5047
349 Ga0207677_10060771 3300026023 Bacteria 2613
350 Ga0207677_10400800 3300026023 Bacteria 1163
351 Ga0207677_10954910 3300026023 Bacteria 775
352 Ga0207703_10003391 3300026035 Bacteria 13382
353 Ga0207639_10695749 3300026041 Bacteria 943
354 Ga0207678_10095495 3300026067 Bacteria 2541
355 Ga0207678_10249372 3300026067 Bacteria 1520
356 Ga0207678_10420137 3300026067 Bacteria 1159
357 Ga0207678_10525335 3300026067 Bacteria 1033
358 Ga0207678_11702718 3300026067 Bacteria 554
359 Ga0207678_11983653 3300026067 Bacteria 507
360 Ga0207641_10023393 3300026088 Bacteria 5091
361 Ga0207641_10257275 3300026088 Bacteria 1633
362 Ga0207641_12464595 3300026088 Bacteria 519
363 Ga0207648_10130223 3300026089 Bacteria 2214
364 Ga0207676_10201336 3300026095 Bacteria 1759
365 Ga0207676_10399438 3300026095 Bacteria 1284
366 Ga0207674_10211205 3300026116 Bacteria 1890
367 Ga0207675_100374533 3300026118 Bacteria 1399
368 Ga0207683_10221045 3300026121 Bacteria 1726
369 Ga0207683_11842515 3300026121 Bacteria 554
370 Ga0207698_10173052 3300026142 Bacteria 1904
371 Ga0207698_10646003 3300026142 Bacteria 1048
372 Ga0207698_11377550 3300026142 Bacteria 720
373 Ga0207698_12542406 3300026142 Bacteria 522
374 Ga0210002_1037424 3300027617 Bacteria 819
375 Ga0209983_1157427 3300027665 Bacteria 521
376 Ga0209974_10117446 3300027876 Bacteria 940
377 Ga0268266_10014935 3300028379 Bacteria 6668
378 Ga0268266_10470864 3300028379 Bacteria 1196
379 Ga0268265_10258747 3300028380 Bacteria 1546
380 Ga0268265_11322582 3300028380 Bacteria 721
381 Ga0268265_12025393 3300028380 Unclassified 583
382 Ga0268264_11010456 3300028381 Bacteria 838
383 Ga0307408_100049049 3300031548 Bacteria 3031
384 Ga0307408_100334811 3300031548 Bacteria 1279
385 Ga0307408_100551928 3300031548 Bacteria 1017
386 Ga0307408_100699851 3300031548 Bacteria 911
387 Ga0307408_101198420 3300031548 Bacteria 708
388 Ga0307408_101832661 3300031548 Bacteria 580
389 Ga0307405_10150590 3300031731 Bacteria 1635
390 Ga0307405_10415602 3300031731 Bacteria 1057
391 Ga0307405_10527832 3300031731 Bacteria 951
392 Ga0307405_10938551 3300031731 Bacteria 734
393 Ga0307405_11389774 3300031731 Bacteria 613
394 Ga0307413_10002633 3300031824 Bacteria 7345
395 Ga0307413_10025910 3300031824 Bacteria 3223
396 Ga0307413_10072805 3300031824 Bacteria 2170
397 Ga0307413_10092964 3300031824 Bacteria 1970
398 Ga0307413_10121858 3300031824 Bacteria 1768
399 Ga0307413_10170739 3300031824 Bacteria 1539
400 Ga0307413_10292011 3300031824 Bacteria 1232
401 Ga0307413_10704383 3300031824 Bacteria 839
402 Ga0307413_10828313 3300031824 Bacteria 780
403 Ga0307413_11148025 3300031824 Bacteria 673
404 Ga0307413_11427885 3300031824 Bacteria 609
405 Ga0307413_11921993 3300031824 Unclassified 532
406 Ga0307413_12084203 3300031824 Bacteria 513
407 Ga0307410_10001226 3300031852 Bacteria 11385
408 Ga0307410_10003164 3300031852 Bacteria 8189
409 Ga0307410_10011968 3300031852 Bacteria 4989
410 Ga0307410_10017901 3300031852 Bacteria 4267
411 Ga0307410_10019816 3300031852 Bacteria 4100
412 Ga0307410_10052862 3300031852 Bacteria 2746
413 Ga0307410_10056591 3300031852 Bacteria 2667
414 Ga0307410_10097218 3300031852 Bacteria 2103
415 Ga0307410_10104049 3300031852 Bacteria 2040
416 Ga0307410_10115873 3300031852 Bacteria 1946
417 Ga0307410_10332570 3300031852 Bacteria 1208
418 Ga0307410_10458301 3300031852 Bacteria 1041
419 Ga0307410_10476182 3300031852 Bacteria 1023
420 Ga0307410_11297645 3300031852 Bacteria 637
421 Ga0307410_11744221 3300031852 Unclassified 552
422 Ga0307406_10089807 3300031901 Bacteria 2065
423 Ga0307406_10246701 3300031901 Bacteria 1343
424 Ga0307406_10303734 3300031901 Bacteria 1227
425 Ga0307406_10326325 3300031901 Bacteria 1189
426 Ga0307406_10580451 3300031901 Bacteria 921
427 Ga0307406_10661366 3300031901 Bacteria 868
428 Ga0307406_10874716 3300031901 Bacteria 763
429 Ga0307406_10926848 3300031901 Bacteria 743
430 Ga0307406_11332646 3300031901 Bacteria 627
431 Ga0307407_10007778 3300031903 Bacteria 4876
432 Ga0307407_10014477 3300031903 Bacteria 3865
433 Ga0307407_10017016 3300031903 Bacteria 3636
434 Ga0307407_10075338 3300031903 Bacteria 2022
435 Ga0307407_10091745 3300031903 Bacteria 1863
436 Ga0307407_10227290 3300031903 Bacteria 1265
437 Ga0307407_10275895 3300031903 Bacteria 1162
438 Ga0307412_10163948 3300031911 Bacteria 1655
439 Ga0307412_10245552 3300031911 Bacteria 1387
440 Ga0307412_10301044 3300031911 Bacteria 1267
441 Ga0307412_10493954 3300031911 Bacteria 1017
442 Ga0307412_10719249 3300031911 Bacteria 859
443 Ga0307412_10731165 3300031911 Bacteria 852
444 Ga0307409_100004995 3300031995 Bacteria 7552
445 Ga0307409_100013953 3300031995 Bacteria 5199
446 Ga0307409_100048713 3300031995 Bacteria 3227
447 Ga0307409_100076789 3300031995 Bacteria 2680
448 Ga0307409_100120313 3300031995 Bacteria 2222
449 Ga0307409_100132764 3300031995 Bacteria 2131
450 Ga0307409_100236254 3300031995 Bacteria 1660
451 Ga0307409_100266865 3300031995 Bacteria 1574
452 Ga0307409_100308282 3300031995 Bacteria 1476
453 Ga0307409_100435517 3300031995 Bacteria 1261
454 Ga0307409_100474455 3300031995 Bacteria 1212
455 Ga0307409_100669891 3300031995 Bacteria 1033
456 Ga0307409_100672642 3300031995 Bacteria 1031
457 Ga0307409_100727282 3300031995 Bacteria 994
458 Ga0307409_100980537 3300031995 Bacteria 862
459 Ga0307409_101895204 3300031995 Bacteria 626
460 Ga0307409_102124639 3300031995 Unclassified 591
461 Ga0307416_100009386 3300032002 Bacteria 6400
462 Ga0307416_100045333 3300032002 Bacteria 3462
463 Ga0307416_100052467 3300032002 Bacteria 3265
464 Ga0307416_100070989 3300032002 Bacteria 2891
465 Ga0307416_100239502 3300032002 Bacteria 1757
466 Ga0307416_100246771 3300032002 Bacteria 1735
467 Ga0307416_100609544 3300032002 Bacteria 1172
468 Ga0307416_100668073 3300032002 Bacteria 1125
469 Ga0307416_101430366 3300032002 Bacteria 797
470 Ga0307416_101433122 3300032002 Bacteria 796
471 Ga0307416_101514614 3300032002 Bacteria 776
472 Ga0307416_101566171 3300032002 Bacteria 764
473 Ga0307416_102248371 3300032002 Bacteria 646
474 Ga0307416_103603448 3300032002 Bacteria 518
475 Ga0307414_10006155 3300032004 Bacteria 6668
476 Ga0307414_10017302 3300032004 Bacteria 4407
477 Ga0307414_10064787 3300032004 Bacteria 2604
478 Ga0307414_10081371 3300032004 Bacteria 2371
479 Ga0307414_10172821 3300032004 Bacteria 1729
480 Ga0307414_10234554 3300032004 Bacteria 1515
481 Ga0307414_10364081 3300032004 Bacteria 1245
482 Ga0307414_10583813 3300032004 Bacteria 1000
483 Ga0307414_10729079 3300032004 Bacteria 899
484 Ga0307414_11018631 3300032004 Bacteria 763
485 Ga0307411_10002688 3300032005 Bacteria 7976
486 Ga0307411_10002769 3300032005 Bacteria 7887
487 Ga0307411_10005922 3300032005 Bacteria 6070
488 Ga0307411_10006005 3300032005 Bacteria 6034
489 Ga0307411_10009246 3300032005 Bacteria 5167
490 Ga0307411_10066465 3300032005 Bacteria 2422
491 Ga0307411_10101445 3300032005 Bacteria 2036
492 Ga0307411_10153081 3300032005 Bacteria 1716
493 Ga0307411_10163708 3300032005 Bacteria 1669
494 Ga0307411_10169835 3300032005 Bacteria 1643
495 Ga0307411_10470482 3300032005 Bacteria 1056
496 Ga0307411_10679412 3300032005 Bacteria 894
497 Ga0307411_10801111 3300032005 Bacteria 829
498 Ga0307411_10894281 3300032005 Bacteria 788
499 Ga0307411_11121158 3300032005 Bacteria 710
500 Ga0307411_11124202 3300032005 Bacteria 709
501 Ga0307411_11194802 3300032005 Bacteria 689
502 Ga0307411_11293208 3300032005 Bacteria 664
503 Ga0307415_100017172 3300032126 Bacteria 4332
504 Ga0307415_100038762 3300032126 Bacteria 3143
505 Ga0307415_100090847 3300032126 Bacteria 2210
506 Ga0307415_100101472 3300032126 Bacteria 2112
507 Ga0307415_100170551 3300032126 Bacteria 1696
508 Ga0307415_100223457 3300032126 Bacteria 1511
509 Ga0307415_100415957 3300032126 Bacteria 1152
510 Ga0307415_100474877 3300032126 Bacteria 1087
511 Ga0307415_100556197 3300032126 Bacteria 1013
512 Ga0307415_100671069 3300032126 Bacteria 932
513 Ga0307415_100684188 3300032126 Bacteria 924
514 Ga0307415_101553576 3300032126 Bacteria 634
515 Ga0307415_101968040 3300032126 Bacteria 568
516 Ga0307415_102235721 3300032126 Bacteria 536
517 Ga0373923_0231131 3300035111 Bacteria 862
518 Ga0373945_0266439 3300035116 Bacteria 727
519 Ga0373946_0176221 3300035171 Bacteria 1012
520 Ga0373931_0979339 3300035691 Bacteria 571
521 Ga0373935_0044530 3300035692 Bacteria 2797
522 Ga0395899_0065678 3300037312 Bacteria 2666
523 Ga0395899_0112396 3300037312 Bacteria 1957
524 Ga0395900_0004779 3300037418 Bacteria 14276
525 Ga0395900_0031249 3300037418 Bacteria 5469
526 Ga0395900_0045894 3300037418 Bacteria 4500
527 Ga0395900_1483604 3300037418 Bacteria 590
528 Ga0395900_1934808 3300037418 Bacteria 500
529 Ga0395898_0110948 3300037466 Bacteria 2629
530 Ga0395898_0426090 3300037466 Bacteria 1264
531 Ga0395898_1097854 3300037466 Bacteria 729
532 Ga0395905_0008540 3300037471 Bacteria 10100
533 Ga0395905_0099242 3300037471 Bacteria 2735
534 Ga0395905_0100678 3300037471 Bacteria 2713
535 Ga0395905_0192996 3300037471 Bacteria 1910
536 Ga0395905_0260255 3300037471 Bacteria 1620
537 Ga0395905_0731055 3300037471 Bacteria 892
538 Ga0395905_1129637 3300037471 Bacteria 687
539 Ga0395901_0086423 3300038443 Bacteria 3279
540 Ga0395901_0277483 3300038443 Bacteria 1742
541 Ga0395901_1480108 3300038443 Bacteria 635
542 Ga0436362_0937605 3300039453 Bacteria 719
543 Ga0439436_0074227 3300041404 Bacteria 948
544 Ga0439466_0115375 3300041411 Bacteria 831
545 Ga0439465_0211753 3300041413 Bacteria 709
546 Ga0451802_0856246 3300041460 Bacteria 539
547 Ga0451807_0442138 3300041486 Bacteria 820
548 Ga0451833_0543528 3300041491 Bacteria 522
549 Ga0439432_013514 3300042006 Bacteria 2776
550 Ga0439432_206964 3300042006 Bacteria 568
551 Ga0439449_0008014 3300042007 Bacteria 4012
552 Ga0439449_0109517 3300042007 Bacteria 1023
553 Ga0450912_003812 3300042116 Bacteria 1093
554 Ga0450914_007003 3300042118 Bacteria 1006
555 Ga0450920_006029 3300042122 Bacteria 2169
556 Ga0450921_005998 3300042123 Bacteria 934
557 Ga0450889_022024 3300042144 Bacteria 713
558 Ga0450910_093207 3300042147 Unclassified 535
559 Ga0450909_034650 3300042185 Bacteria 770
560 Ga0450918_048871 3300042531 Bacteria 768
561 Ga0451577_1324068 3300042876 Bacteria 640
562 Ga0466966_0126410 3300044684 Bacteria 1568
563 Ga0466961_0101213 3300044693 Bacteria 1815
564 Ga0466961_0768803 3300044693 Bacteria 575
565 Ga0466963_0008882 3300044694 Bacteria 6030
566 Ga0453684_1559971 3300044712 Bacteria 679
567 Ga0466971_0082426 3300044719 Bacteria 1468
568 Ga0466971_0091162 3300044719 Bacteria 1396
569 Ga0466957_0344406 3300044842 Bacteria 1010
570 Ga0466957_0507710 3300044842 Bacteria 836
571 Ga0466957_0649092 3300044842 Bacteria 742
572 Ga0466959_0835249 3300045049 Bacteria 615
573 Ga0466958_0184092 3300045836 Bacteria 1326
574 Ga0466958_0276253 3300045836 Bacteria 1076
575 Ga0466967_0110845 3300045976 Bacteria 2521
576 Ga0466967_1230862 3300045976 Bacteria 746
577 Ga0495629_0393035 3300046459 Bacteria 943
578 Ga0495629_0420731 3300046459 Bacteria 907
579 Ga0495580_0260146 3300046472 Bacteria 1187
580 Ga0495610_0192398 3300046512 Bacteria 841
581 Ga0495663_0005808 3300046525 Bacteria 3416
582 Ga0495598_0003480 3300046537 Bacteria 3351
583 Ga0495621_0001521 3300046539 Bacteria 6026
584 Ga0495621_0015823 3300046539 Bacteria 2411
585 Ga0495621_0149392 3300046539 Bacteria 918
586 Ga0495633_0017963 3300046558 Bacteria 3599
587 Ga0495633_0376969 3300046558 Bacteria 642
588 Ga0495668_0396013 3300046616 Bacteria 759
589 Ga0495599_0413738 3300046678 Bacteria 802
590 Ga0495669_0003969 3300046684 Bacteria 6089
591 Ga0495669_0010286 3300046684 Bacteria 3953
592 Ga0495669_0025777 3300046684 Bacteria 2566
593 Ga0495669_0043750 3300046684 Bacteria 1994
594 Ga0495669_0074857 3300046684 Bacteria 1548
595 Ga0495669_0109795 3300046684 Bacteria 1287
596 Ga0495669_0167160 3300046684 Bacteria 1045
597 Ga0495669_0566043 3300046684 Bacteria 553
598 Ga0495670_0015867 3300046691 Bacteria 3701
599 Ga0495670_0019253 3300046691 Bacteria 3363
600 Ga0495670_0079477 3300046691 Bacteria 1669
601 Ga0495670_0081875 3300046691 Bacteria 1645
602 Ga0495670_0134873 3300046691 Bacteria 1288
603 Ga0495670_0209622 3300046691 Bacteria 1033
604 Ga0495581_0308575 3300047315 Bacteria 925
605 Ga0495677_0018110 3300047445 Bacteria 2553
606 Ga0495677_0031498 3300047445 Bacteria 1930
607 Ga0495677_0125227 3300047445 Bacteria 981
608 Ga0495677_0126138 3300047445 Bacteria 978
609 Ga0495677_0178722 3300047445 Bacteria 822
610 Ga0495677_0212064 3300047445 Bacteria 754
611 Ga0495677_0372579 3300047445 Bacteria 564
612 Ga0496100_0250131 3300048903 Bacteria 1311
613 Ga0496100_0326710 3300048903 Bacteria 1153
614 Ga0496100_0693754 3300048903 Bacteria 794
615 Ga0496101_0309327 3300048904 Bacteria 1238
616 Ga0496101_0844057 3300048904 Bacteria 722
617 Ga0496101_1293313 3300048904 Bacteria 570
618 Ga0496102_0814493 3300048905 Bacteria 856
619 Ga0496103_0220331 3300048906 Bacteria 1220
620 Ga0496103_0387080 3300048906 Bacteria 898
621 Ga0496103_0578796 3300048906 Bacteria 716
622 Ga0496104_1250233 3300048907 Bacteria 646
623 Ga0496105_0290089 3300048908 Bacteria 1317
624 Ga0496106_0309277 3300048909 Bacteria 1268
625 Ga0496106_1103690 3300048909 Unclassified 621
626 Ga0496107_0122903 3300048910 Bacteria 1913
627 Ga0496107_0144537 3300048910 Bacteria 1758
628 Ga0496107_0981931 3300048910 Bacteria 613
629 Ga0496107_1026608 3300048910 Bacteria 598
630 Ga0496108_0001490 3300048911 Bacteria 18506
631 Ga0496108_0736501 3300048911 Bacteria 853
632 Ga0496108_1199006 3300048911 Bacteria 642
633 Ga0496109_0000610 3300048912 Bacteria 29899
634 Ga0496109_0026246 3300048912 Bacteria 5195
635 Ga0496109_0137693 3300048912 Bacteria 2282
636 Ga0496109_1245194 3300048912 Bacteria 680
637 Ga0496110_0033204 3300048913 Bacteria 4462
638 Ga0496110_0047892 3300048913 Bacteria 3745
639 Ga0496110_0721926 3300048913 Bacteria 899
640 Ga0496110_1611658 3300048913 Bacteria 559
641 Ga0496111_0019385 3300048914 Bacteria 4723
642 Ga0496111_0149497 3300048914 Bacteria 1732
643 Ga0496112_0022559 3300048915 Bacteria 5999
644 Ga0496112_0449490 3300048915 Bacteria 1226
645 Ga0496112_0843024 3300048915 Bacteria 840
646 Ga0496113_0001927 3300048916 Bacteria 11871
647 Ga0496113_0368451 3300048916 Bacteria 1153
648 Ga0496113_1039365 3300048916 Bacteria 644
649 Ga0496114_0000016 3300048917 Bacteria 274656
650 Ga0496114_0023134 3300048917 Bacteria 5067
651 Ga0496114_0380156 3300048917 Bacteria 1250
652 Ga0501242_069384 3300049674 Bacteria 550
653 Ga0590071_117438 3300059421 Bacteria 678
654 Ga0590075_090282 3300059424 Bacteria 795
655 Ga0466962_0058341 3300061719 Bacteria 1843
656 Ga0207678_10590105
657 MBSR1b_contig_525930
658 JGI24739J22299_10022368
659 JGI24739J22299_10098156
660 JGI24739J22299_10252960
661 JGI24748J21848_1056426
662 JGI24738J21930_10120180
663 JGI24744J21845_10004337
664 Ga0065712_10012271
665 Ga0065712_10100361
666 Ga0065712_10278316
667 Ga0065712_10686398
668 Ga0065715_10160804
669 Ga0065715_10214463
670 Ga0065715_10240730
671 Ga0065715_10392796
672 Ga0070658_10013862
673 Ga0070658_10142809
674 Ga0070658_10175915
675 Ga0070658_10310460
676 Ga0070658_10827466
677 Ga0070676_10110587
678 Ga0070676_10141147
679 Ga0070676_10652749
680 Ga0070676_10698486
681 Ga0070683_101711693
682 Ga0070690_100066299
683 Ga0070690_100529546
684 Ga0070670_100001880
685 Ga0070670_100024638
686 Ga0070670_100052439
687 Ga0070670_100323894
688 Ga0070670_100433723
689 Ga0070670_100864148
690 Ga0070677_10018571
691 Ga0070677_10158012
692 Ga0070677_10209201
693 Ga0070677_10533729
694 Ga0068869_100042802
695 Ga0068869_100795224
696 Ga0070666_10000753
697 Ga0070666_11243055
698 Ga0070682_100422386
699 Ga0068868_100015820
700 Ga0068868_100064630
701 Ga0068868_100145813
702 Ga0068868_100607730
703 Ga0070660_100201410
704 Ga0070660_100385892
705 Ga0070660_100398649
706 Ga0070660_100606510
707 Ga0070660_101269204
708 Ga0070689_101107872
709 Ga0070661_100088607
710 Ga0070661_100164545
711 Ga0070661_100211230
712 Ga0070661_100510975
713 Ga0070661_100801955
714 Ga0070668_100044906
715 Ga0070668_100249287
716 Ga0070668_100699480
717 Ga0070668_100737365
718 Ga0070668_101057612
719 Ga0070669_100146964
720 Ga0070669_100166345
721 Ga0070669_100327854
722 Ga0070669_100336203
723 Ga0070669_100614386
724 Ga0070669_100876794
725 Ga0070669_100921553
726 Ga0070669_101076253
727 Ga0070675_100002250
728 Ga0070675_100045513
729 Ga0070675_100106900
730 Ga0070675_102023181
731 Ga0070671_100001083
732 Ga0070671_100005295
733 Ga0070671_100038926
734 Ga0070671_100118009
735 Ga0070671_100142598
736 Ga0070671_100227571
737 Ga0070671_100258317
738 Ga0070671_100379662
739 Ga0070674_100070714
740 Ga0070674_100108445
741 Ga0070674_100236642
742 Ga0070674_101215085
743 Ga0070673_100086003
744 Ga0070673_100086455
745 Ga0070673_100106289
746 Ga0070673_100128297
747 Ga0070673_100181566
748 Ga0070673_100272324
749 Ga0070673_100403011
750 Ga0070673_101019181
751 Ga0070673_101358876
752 Ga0070688_101100659
753 Ga0070659_100166023
754 Ga0070659_100367670
755 Ga0070659_100617788
756 Ga0070659_100836970
757 Ga0070659_101158625
758 Ga0070667_100084374
759 Ga0070667_100143772
760 Ga0070714_100177981
761 Ga0070714_100327586
762 Ga0070714_100653263
763 Ga0070714_101482673
764 Ga0070713_100567793
765 Ga0070663_100301384
766 Ga0070663_100604384
767 Ga0070663_100950483
768 Ga0070663_101192381
769 Ga0070678_100090164
770 Ga0070678_100182342
771 Ga0070678_102245317
772 Ga0070662_100013148
773 Ga0070662_100027100
774 Ga0070662_100200909
775 Ga0070662_100335750
776 Ga0070662_100497867
777 Ga0070662_100500413
778 Ga0070662_100808458
779 Ga0070662_100929559
780 Ga0068867_100071782
781 Ga0070672_100001827
782 Ga0070672_100116053
783 Ga0070672_100143282
784 Ga0070672_100325581
785 Ga0070672_100363400
786 Ga0070686_100917576
787 Ga0070693_100473122
788 Ga0070665_100023392
789 Ga0070665_100331096
790 Ga0070665_100602690
791 Ga0070665_102293441
792 Ga0070664_100001469
793 Ga0070664_100159857
794 Ga0070664_100231616
795 Ga0070664_100276687
796 Ga0070664_102237011
797 Ga0068857_100439411
798 Ga0068854_100049937
799 Ga0068856_100617998
800 Ga0068856_100813970
801 Ga0070702_100646680
802 Ga0068852_100205490
803 Ga0068852_100251426
804 Ga0068852_100634290
805 Ga0068852_101807125
806 Ga0068859_100660965
807 Ga0068864_100001619
808 Ga0068864_101139680
809 Ga0068864_101663026
810 Ga0068866_10039647
811 Ga0068861_100767215
812 Ga0068851_10372175
813 Ga0068870_10502344
814 Ga0068863_100026932
815 Ga0068863_100684227
816 Ga0068863_102376615
817 Ga0068858_100006170
818 Ga0068860_102306744
819 Ga0070717_11174483
820 Ga0097621_100313625
821 Ga0097621_100973033
822 Ga0097621_101397024
823 Ga0097621_101692729
824 Ga0068871_100465221
825 Ga0068871_100636070
826 Ga0068871_100798520
827 Ga0068865_100128090
828 Ga0068865_100845314
829 Ga0068865_101187716
830 Ga0097620_100660896
831 Ga0105245_10072816
832 Ga0105245_10345585
833 Ga0105245_10381598
834 Ga0105243_11445609
835 Ga0105241_11141883
836 Ga0105242_10883452
837 Ga0105242_11241590
838 Ga0105248_10001364
839 Ga0105248_10002158
840 Ga0105248_10011642
841 Ga0105248_10080763
842 Ga0105248_10101724
843 Ga0105248_10150856
844 Ga0105248_12248674
845 Ga0105249_11561639
846 Ga0105246_10915028
847 Ga0157373_10465333
848 Ga0157371_10294542
849 Ga0157371_11030945
850 Ga0157371_11241900
851 Ga0157369_10877844
852 Ga0157369_12032439
853 Ga0157374_10906684
854 Ga0157374_10921845
855 Ga0157374_10994809
856 Ga0157374_11528579
857 Ga0157374_12485919
858 Ga0157378_12110865
859 Ga0163162_12861650
860 Ga0157372_11220950
861 Ga0157372_12113388
862 Ga0157375_10258067
863 Ga0157375_10383603
864 Ga0157375_10729789
865 Ga0157375_10810202
866 Ga0157375_11114603
867 Ga0157375_13005082
868 Ga0163163_10416637
869 Ga0157380_10228229
870 Ga0157380_12646371
871 Ga0157379_10058108
872 Ga0163161_10043355
873 Ga0163161_10077314
874 Ga0207697_10038945
875 Ga0207697_10480733
876 Ga0207656_10181353
877 Ga0207682_10014876
878 Ga0207682_10141276
879 Ga0207682_10182254
880 Ga0207642_10109605
881 Ga0207642_10302913
882 Ga0207688_10131967
883 Ga0207688_10183039
884 Ga0207688_10293099
885 Ga0207688_11013799
886 Ga0207680_10001044
887 Ga0207680_10195750
888 Ga0207647_10048524
889 Ga0207645_10015636
890 Ga0207645_10098403
891 Ga0207645_10193319
892 Ga0207645_10695600
893 Ga0207643_10217544
894 Ga0207643_10253801
895 Ga0207705_10016677
896 Ga0207705_10078207
897 Ga0207705_10278022
898 Ga0207705_10350550
899 Ga0207654_11028611
900 Ga0207693_10784583
901 Ga0207657_10039308
902 Ga0207657_10251715
903 Ga0207657_10756852
904 Ga0207657_10832339
905 Ga0207649_10008681
906 Ga0207649_10063906
907 Ga0207649_10257775
908 Ga0207649_10486822
909 Ga0207649_10764822
910 Ga0207681_10040784
911 Ga0207681_10164164
912 Ga0207681_10199372
913 Ga0207681_10270657
914 Ga0207681_10421673
915 Ga0207681_10543614
916 Ga0207681_10663914
917 Ga0207681_10698712
918 Ga0207681_10712864
919 Ga0207650_10001425
920 Ga0207650_10021807
921 Ga0207650_10113694
922 Ga0207650_10175928
923 Ga0207650_10983033
924 Ga0207650_11632466
925 Ga0207659_10001814
926 Ga0207659_10070015
927 Ga0207659_10098898
928 Ga0207659_10489465
929 Ga0207659_11451532
930 Ga0207687_10038652
931 Ga0207687_10112523
932 Ga0207687_10516589
933 Ga0207700_10124615
934 Ga0207664_10193111
935 Ga0207664_10323262
936 Ga0207664_11555840
937 Ga0207644_10000415
938 Ga0207644_10004423
939 Ga0207644_10089919
940 Ga0207644_10135685
941 Ga0207644_10261390
942 Ga0207644_10266805
943 Ga0207644_10369424
944 Ga0207644_10500661
945 Ga0207690_10082860
946 Ga0207690_10266412
947 Ga0207690_10943467
948 Ga0207690_10963982
949 Ga0207706_10078536
950 Ga0207706_10078674
951 Ga0207706_10109313
952 Ga0207706_10117905
953 Ga0207706_10127261
954 Ga0207706_10191796
955 Ga0207706_10200722
956 Ga0207706_10593540
957 Ga0207706_10614588
958 Ga0207706_11623621
959 Ga0207709_11315419
960 Ga0207670_10191420
961 Ga0207669_10002095
962 Ga0207669_10063236
963 Ga0207669_10224377
964 Ga0207704_10025142
965 Ga0207704_10915453
966 Ga0207691_10021931
967 Ga0207691_10134728
968 Ga0207691_10286937
969 Ga0207691_10304889
970 Ga0207691_10342887
971 Ga0207691_10408397
972 Ga0207711_10000420
973 Ga0207711_10001208
974 Ga0207711_10373120
975 Ga0207711_10476110
976 Ga0207711_10551863
977 Ga0207711_11550389
978 Ga0207689_10093842
979 Ga0207689_11042730
980 Ga0207679_10137934
981 Ga0207679_10167947
982 Ga0207679_10223764
983 Ga0207679_10317119
984 Ga0207679_10412431
985 Ga0207679_10434715
986 Ga0207679_10568541
987 Ga0207679_10898988
988 Ga0207679_11984453
989 Ga0207667_10759452
990 Ga0207651_10005284
991 Ga0207651_10016674
992 Ga0207651_10043084
993 Ga0207651_10167277
994 Ga0207651_10822740
995 Ga0207651_10908953
996 Ga0207668_10080512
997 Ga0207668_10351209
998 Ga0207668_10756278
999 Ga0207668_11760826
1000 Ga0207668_11781815
1001 Ga0207658_10002673
1002 Ga0207658_11682235
1003 Ga0207677_10011520
1004 Ga0207677_10060771
1005 Ga0207677_10400800
1006 Ga0207677_10954910
1007 Ga0207703_10003391
1008 Ga0207639_10695749
1009 Ga0207678_10095495
1010 Ga0207678_10249372
1011 Ga0207678_10420137
1012 Ga0207678_10525335
1013 Ga0207678_11702718
1014 Ga0207678_11983653
1015 Ga0207641_10023393
1016 Ga0207641_10257275
1017 Ga0207641_12464595
1018 Ga0207648_10130223
1019 Ga0207676_10201336
1020 Ga0207676_10399438
1021 Ga0207674_10211205
1022 Ga0207675_100374533
1023 Ga0207683_10221045
1024 Ga0207683_11842515
1025 Ga0207698_10173052
1026 Ga0207698_10646003
1027 Ga0207698_11377550
1028 Ga0207698_12542406
1029 Ga0210002_1037424
1030 Ga0209983_1157427
1031 Ga0209974_10117446
1032 Ga0268266_10014935
1033 Ga0268266_10470864
1034 Ga0268265_10258747
1035 Ga0268265_11322582
1036 Ga0268265_12025393
1037 Ga0268264_11010456
1038 Ga0307408_100049049
1039 Ga0307408_100334811
1040 Ga0307408_100551928
1041 Ga0307408_100699851
1042 Ga0307408_101198420
1043 Ga0307408_101832661
1044 Ga0307405_10150590
1045 Ga0307405_10415602
1046 Ga0307405_10527832
1047 Ga0307405_10938551
1048 Ga0307405_11389774
1049 Ga0307413_10002633
1050 Ga0307413_10025910
1051 Ga0307413_10072805
1052 Ga0307413_10092964
1053 Ga0307413_10121858
1054 Ga0307413_10170739
1055 Ga0307413_10292011
1056 Ga0307413_10704383
1057 Ga0307413_10828313
1058 Ga0307413_11148025
1059 Ga0307413_11427885
1060 Ga0307413_11921993
1061 Ga0307413_12084203
1062 Ga0307410_10001226
1063 Ga0307410_10003164
1064 Ga0307410_10011968
1065 Ga0307410_10017901
1066 Ga0307410_10019816
1067 Ga0307410_10052862
1068 Ga0307410_10056591
1069 Ga0307410_10097218
1070 Ga0307410_10104049
1071 Ga0307410_10115873
1072 Ga0307410_10332570
1073 Ga0307410_10458301
1074 Ga0307410_10476182
1075 Ga0307410_11297645
1076 Ga0307410_11744221
1077 Ga0307406_10089807
1078 Ga0307406_10246701
1079 Ga0307406_10303734
1080 Ga0307406_10326325
1081 Ga0307406_10580451
1082 Ga0307406_10661366
1083 Ga0307406_10874716
1084 Ga0307406_10926848
1085 Ga0307406_11332646
1086 Ga0307407_10007778
1087 Ga0307407_10014477
1088 Ga0307407_10017016
1089 Ga0307407_10075338
1090 Ga0307407_10091745
1091 Ga0307407_10227290
1092 Ga0307407_10275895
1093 Ga0307412_10163948
1094 Ga0307412_10245552
1095 Ga0307412_10301044
1096 Ga0307412_10493954
1097 Ga0307412_10719249
1098 Ga0307412_10731165
1099 Ga0307409_100004995
1100 Ga0307409_100013953
1101 Ga0307409_100048713
1102 Ga0307409_100076789
1103 Ga0307409_100120313
1104 Ga0307409_100132764
1105 Ga0307409_100236254
1106 Ga0307409_100266865
1107 Ga0307409_100308282
1108 Ga0307409_100435517
1109 Ga0307409_100474455
1110 Ga0307409_100669891
1111 Ga0307409_100672642
1112 Ga0307409_100727282
1113 Ga0307409_100980537
1114 Ga0307409_101895204
1115 Ga0307409_102124639
1116 Ga0307416_100009386
1117 Ga0307416_100045333
1118 Ga0307416_100052467
1119 Ga0307416_100070989
1120 Ga0307416_100239502
1121 Ga0307416_100246771
1122 Ga0307416_100609544
1123 Ga0307416_100668073
1124 Ga0307416_101430366
1125 Ga0307416_101433122
1126 Ga0307416_101514614
1127 Ga0307416_101566171
1128 Ga0307416_102248371
1129 Ga0307416_103603448
1130 Ga0307414_10006155
1131 Ga0307414_10017302
1132 Ga0307414_10064787
1133 Ga0307414_10081371
1134 Ga0307414_10172821
1135 Ga0307414_10234554
1136 Ga0307414_10364081
1137 Ga0307414_10583813
1138 Ga0307414_10729079
1139 Ga0307414_11018631
1140 Ga0307411_10002688
1141 Ga0307411_10002769
1142 Ga0307411_10005922
1143 Ga0307411_10006005
1144 Ga0307411_10009246
1145 Ga0307411_10066465
1146 Ga0307411_10101445
1147 Ga0307411_10153081
1148 Ga0307411_10163708
1149 Ga0307411_10169835
1150 Ga0307411_10470482
1151 Ga0307411_10679412
1152 Ga0307411_10801111
1153 Ga0307411_10894281
1154 Ga0307411_11121158
1155 Ga0307411_11124202
1156 Ga0307411_11194802
1157 Ga0307411_11293208
1158 Ga0307415_100017172
1159 Ga0307415_100038762
1160 Ga0307415_100090847
1161 Ga0307415_100101472
1162 Ga0307415_100170551
1163 Ga0307415_100223457
1164 Ga0307415_100415957
1165 Ga0307415_100474877
1166 Ga0307415_100556197
1167 Ga0307415_100671069
1168 Ga0307415_100684188
1169 Ga0307415_101553576
1170 Ga0307415_101968040
1171 Ga0307415_102235721
1172 Ga0373923_0231131
1173 Ga0373945_0266439
1174 Ga0373946_0176221
1175 Ga0373931_0979339
1176 Ga0373935_0044530
1177 Ga0395899_0065678
1178 Ga0395899_0112396
1179 Ga0395900_0004779
1180 Ga0395900_0031249
1181 Ga0395900_0045894
1182 Ga0395900_1483604
1183 Ga0395900_1934808
1184 Ga0395898_0110948
1185 Ga0395898_0426090
1186 Ga0395898_1097854
1187 Ga0395905_0008540
1188 Ga0395905_0099242
1189 Ga0395905_0100678
1190 Ga0395905_0192996
1191 Ga0395905_0260255
1192 Ga0395905_0731055
1193 Ga0395905_1129637
1194 Ga0395901_0086423
1195 Ga0395901_0277483
1196 Ga0395901_1480108
1197 Ga0436362_0937605
1198 Ga0439436_0074227
1199 Ga0439466_0115375
1200 Ga0439465_0211753
1201 Ga0451802_0856246
1202 Ga0451807_0442138
1203 Ga0451833_0543528
1204 Ga0439432_013514
1205 Ga0439432_206964
1206 Ga0439449_0008014
1207 Ga0439449_0109517
1208 Ga0450912_003812
1209 Ga0450914_007003
1210 Ga0450920_006029
1211 Ga0450921_005998
1212 Ga0450889_022024
1213 Ga0450910_093207
1214 Ga0450909_034650
1215 Ga0450918_048871
1216 Ga0451577_1324068
1217 Ga0466966_0126410
1218 Ga0466961_0101213
1219 Ga0466961_0768803
1220 Ga0466963_0008882
1221 Ga0453684_1559971
1222 Ga0466971_0082426
1223 Ga0466971_0091162
1224 Ga0466957_0344406
1225 Ga0466957_0507710
1226 Ga0466957_0649092
1227 Ga0466959_0835249
1228 Ga0466958_0184092
1229 Ga0466958_0276253
1230 Ga0466967_0110845
1231 Ga0466967_1230862
1232 Ga0495629_0393035
1233 Ga0495629_0420731
1234 Ga0495580_0260146
1235 Ga0495610_0192398
1236 Ga0495663_0005808
1237 Ga0495598_0003480
1238 Ga0495621_0001521
1239 Ga0495621_0015823
1240 Ga0495621_0149392
1241 Ga0495633_0017963
1242 Ga0495633_0376969
1243 Ga0495668_0396013
1244 Ga0495599_0413738
1245 Ga0495669_0003969
1246 Ga0495669_0010286
1247 Ga0495669_0025777
1248 Ga0495669_0043750
1249 Ga0495669_0074857
1250 Ga0495669_0109795
1251 Ga0495669_0167160
1252 Ga0495669_0566043
1253 Ga0495670_0015867
1254 Ga0495670_0019253
1255 Ga0495670_0079477
1256 Ga0495670_0081875
1257 Ga0495670_0134873
1258 Ga0495670_0209622
1259 Ga0495581_0308575
1260 Ga0495677_0018110
1261 Ga0495677_0031498
1262 Ga0495677_0125227
1263 Ga0495677_0126138
1264 Ga0495677_0178722
1265 Ga0495677_0212064
1266 Ga0495677_0372579
1267 Ga0496100_0250131
1268 Ga0496100_0326710
1269 Ga0496100_0693754
1270 Ga0496101_0309327
1271 Ga0496101_0844057
1272 Ga0496101_1293313
1273 Ga0496102_0814493
1274 Ga0496103_0220331
1275 Ga0496103_0387080
1276 Ga0496103_0578796
1277 Ga0496104_1250233
1278 Ga0496105_0290089
1279 Ga0496106_0309277
1280 Ga0496106_1103690
1281 Ga0496107_0122903
1282 Ga0496107_0144537
1283 Ga0496107_0981931
1284 Ga0496107_1026608
1285 Ga0496108_0001490
1286 Ga0496108_0736501
1287 Ga0496108_1199006
1288 Ga0496109_0000610
1289 Ga0496109_0026246
1290 Ga0496109_0137693
1291 Ga0496109_1245194
1292 Ga0496110_0033204
1293 Ga0496110_0047892
1294 Ga0496110_0721926
1295 Ga0496110_1611658
1296 Ga0496111_0019385
1297 Ga0496111_0149497
1298 Ga0496112_0022559
1299 Ga0496112_0449490
1300 Ga0496112_0843024
1301 Ga0496113_0001927
1302 Ga0496113_0368451
1303 Ga0496113_1039365
1304 Ga0496114_0000016
1305 Ga0496114_0023134
1306 Ga0496114_0380156
1307 Ga0501242_069384
1308 Ga0590071_117438
1309 Ga0590075_090282
1310 Ga0466962_0058341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map