F472878

General Info

Members Datasets Scaffolds Average Seq Length
654 396 1308 383

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0043781|Ga0496118_0043781_1394_2662
Length 422
Sequence MTVRSEQSGPKHDPRDIPEAGHGTPRGLVGEPAHEVPGEPARPLLTLGVLGTSQKPDERRLPIHPAHLERIDVDLRERMIVESGYGQAFGMTDDRLAALVGKVLPRDELIERADVVLLPKPQAAELSGLRDGQVLWGWPHCVQDVDMTQQAIDRHLTLIAFEAMNHWSSDGRFALHVFHKNNEIAGYCSVLHALQLAGSTGDYGRRLNAIVIGFGATARGAVTALRAHGVHDVHVLTNRDVAAVGSPIHAARIVQLDHDDAAPHASHVLTEEGRVPLAPYLAEFDIVVNCTLQDTDAPQTYLHESDLGAFAPGSLVVDVSCDEGMGFSWARPTTFAEPTFEVGDHILYYAVDHSPSYLWNSATWEISDAVLPFLRSVMEGPDGWAADETVARAVEIREGVVQNPAITRFQHRAEEYPHAVAG

Samples

Sample ID Description Type Environment
1 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
159 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
160 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
303 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
311 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
312 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
313 2643221553 Microbacterium sp. Root553 Isolate Unclassified
314 2643221572 Leifsonia sp. Root60 Isolate Unclassified
315 2643221619 Agromyces sp. Root81 Isolate Unclassified
316 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
317 2643221641 Nocardioides sp. Root122 Isolate Unclassified
318 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
319 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
320 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
321 2643221711 Terrabacter sp. Root85 Isolate Unclassified
322 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
323 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
324 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
325 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
326 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
327 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
328 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
329 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
330 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
331 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
332 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
333 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
334 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
335 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
336 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
337 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
338 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
339 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
340 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
341 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
342 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
343 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
344 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
345 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
346 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
347 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
348 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
349 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
350 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
351 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
352 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
353 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
354 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
355 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
356 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
357 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
358 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
359 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
360 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
361 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
362 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
363 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
364 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
365 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
366 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
367 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
368 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
369 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
370 2922554459 Rhodococcus sp. 66b Isolate Unclassified
371 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
372 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
373 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
374 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
375 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
376 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
377 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
378 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
379 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
380 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
381 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
382 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
383 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
384 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
385 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
386 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
387 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
388 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
389 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
390 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
391 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
392 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
393 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
394 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
395 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
396 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.54
Metatranscriptomes 0
Isolates 13.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0.15
Rhizoplane 11.62
Rhizosphere 74.92
Stem 0
Stem Tuber 0.15
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496118_0043781 3300048921 Bacteria 3514
2 JGI24737J22298_10029959 3300001990 Bacteria 1705
3 JGI24744J21845_10004149 3300002077 Bacteria 2987
4 JGI24744J21845_10009120 3300002077 Bacteria 2038
5 JGI24034J26672_10004744 3300002239 Bacteria 1934
6 JGI24742J22300_10003796 3300002244 Bacteria 2456
7 JGI25164J39214_1000184 3300002772 Bacteria 55562
8 JGI25165J46597_1000092 3300003214 Bacteria 165407
9 Ga0055540_1009213 3300003792 Bacteria 3437
10 Ga0055540_1011866 3300003792 Bacteria 2775
11 Ga0070658_10014549 3300005327 Bacteria 6314
12 Ga0070658_10020984 3300005327 Bacteria 5233
13 Ga0070658_10044793 3300005327 Bacteria 3576
14 Ga0070683_100004574 3300005329 Bacteria 11419
15 Ga0070683_100054207 3300005329 Bacteria 3718
16 Ga0070683_100173323 3300005329 Bacteria 2048
17 Ga0070690_100034465 3300005330 Bacteria 3172
18 Ga0070670_100246800 3300005331 Bacteria 1555
19 Ga0070677_10005997 3300005333 Bacteria 4031
20 Ga0068869_100036535 3300005334 Bacteria 3488
21 Ga0068869_100096013 3300005334 Bacteria 2237
22 Ga0070666_10003614 3300005335 Bacteria 9377
23 Ga0070666_10081259 3300005335 Bacteria 2215
24 Ga0070680_100045234 3300005336 Bacteria 3579
25 Ga0070680_100222119 3300005336 Bacteria 1595
26 Ga0070682_100023590 3300005337 Bacteria 3654
27 Ga0070682_100061659 3300005337 Bacteria 2374
28 Ga0070682_100193783 3300005337 Bacteria 1428
29 Ga0068868_100092353 3300005338 Bacteria 2439
30 Ga0070660_100019543 3300005339 Bacteria 4966
31 Ga0070660_100179210 3300005339 Bacteria 1714
32 Ga0070689_100013015 3300005340 Bacteria 6012
33 Ga0070687_100096896 3300005343 Bacteria 1643
34 Ga0070661_100030675 3300005344 Bacteria 3884
35 Ga0070661_100031061 3300005344 Bacteria 3861
36 Ga0070692_10007759 3300005345 Bacteria 4753
37 Ga0070692_10037451 3300005345 Bacteria 2466
38 Ga0070669_100009997 3300005353 Bacteria 6744
39 Ga0070669_100083312 3300005353 Bacteria 2384
40 Ga0070675_100002864 3300005354 Bacteria 12997
41 Ga0070675_100111535 3300005354 Bacteria 2315
42 Ga0070675_100202593 3300005354 Bacteria 1723
43 Ga0070673_100051148 3300005364 Bacteria 3234
44 Ga0070659_100029122 3300005366 Bacteria 4266
45 Ga0070659_100077600 3300005366 Bacteria 2650
46 Ga0070667_100174798 3300005367 Bacteria 1897
47 Ga0070667_100383974 3300005367 Bacteria 1276
48 Ga0070703_10024339 3300005406 Bacteria 1789
49 Ga0070709_10071681 3300005434 Bacteria 2237
50 Ga0070713_100304241 3300005436 Bacteria 1468
51 Ga0070701_10015653 3300005438 Bacteria 3508
52 Ga0070711_100127714 3300005439 Bacteria 1889
53 Ga0070700_100016484 3300005441 Bacteria 4209
54 Ga0070700_100025989 3300005441 Bacteria 3452
55 Ga0070694_100072012 3300005444 Bacteria 2384
56 Ga0070663_100040525 3300005455 Bacteria 3261
57 Ga0070663_100163319 3300005455 Bacteria 1716
58 Ga0070681_10035482 3300005458 Bacteria 5010
59 Ga0070681_10250481 3300005458 Bacteria 1684
60 Ga0070685_10082038 3300005466 Bacteria 1934
61 Ga0070698_100176966 3300005471 Bacteria 2072
62 Ga0070679_100001890 3300005530 Bacteria 18803
63 Ga0070679_100050434 3300005530 Bacteria 4146
64 Ga0070679_100130857 3300005530 Bacteria 2491
65 Ga0070684_100010264 3300005535 Bacteria 7413
66 Ga0070684_100054554 3300005535 Bacteria 3482
67 Ga0068853_100022825 3300005539 Bacteria 5230
68 Ga0068853_100106140 3300005539 Bacteria 2489
69 Ga0068853_100281060 3300005539 Bacteria 1534
70 Ga0070686_100165835 3300005544 Bacteria 1558
71 Ga0070696_100033323 3300005546 Bacteria 3539
72 Ga0070696_100249936 3300005546 Bacteria 1341
73 Ga0070665_100029834 3300005548 Bacteria 5488
74 Ga0070665_100234264 3300005548 Bacteria 1836
75 Ga0068855_100144526 3300005563 Bacteria 2709
76 Ga0070664_100079279 3300005564 Bacteria 2826
77 Ga0070664_100138882 3300005564 Bacteria 2138
78 Ga0068854_100029812 3300005578 Bacteria 3780
79 Ga0068856_100071081 3300005614 Bacteria 3444
80 Ga0070702_100000262 3300005615 Bacteria 17949
81 Ga0068852_100141095 3300005616 Bacteria 2230
82 Ga0068852_100338431 3300005616 Bacteria 1466
83 Ga0068864_100024414 3300005618 Bacteria 5086
84 Ga0068864_100261234 3300005618 Bacteria 1611
85 Ga0068864_100276209 3300005618 Bacteria 1567
86 Ga0068861_100041538 3300005719 Bacteria 3445
87 Ga0068863_100238625 3300005841 Bacteria 1755
88 Ga0068858_100063879 3300005842 Bacteria 3406
89 Ga0068858_100351979 3300005842 Bacteria 1411
90 Ga0075365_10083355 3300006038 Bacteria 2169
91 Ga0075365_10117829 3300006038 Bacteria 1830
92 Ga0075364_10010909 3300006051 Bacteria 5506
93 Ga0075364_10027992 3300006051 Bacteria 3604
94 Ga0075364_10196863 3300006051 Bacteria 1365
95 Ga0075432_10000814 3300006058 Bacteria 9763
96 Ga0070715_10047547 3300006163 Bacteria 1829
97 Ga0070712_100019448 3300006175 Bacteria 4430
98 Ga0075369_10001673 3300006186 Bacteria 7644
99 Ga0075369_10027107 3300006186 Bacteria 2393
100 Ga0097621_100075339 3300006237 Bacteria 2797
101 Ga0068871_100177798 3300006358 Bacteria 1827
102 Ga0075431_100000036 3300006847 Bacteria 68411
103 Ga0075434_100012101 3300006871 Bacteria 8169
104 Ga0068865_100008643 3300006881 Bacteria 6301
105 Ga0099795_10027033 3300007788 Bacteria 1938
106 Ga0105251_10024059 3300009011 Bacteria 3133
107 Ga0105244_10004212 3300009036 Bacteria 9998
108 Ga0105240_10357393 3300009093 Bacteria 1656
109 Ga0111539_10247388 3300009094 Bacteria 2076
110 Ga0111539_10274575 3300009094 Bacteria 1962
111 Ga0105245_10287231 3300009098 Bacteria 1610
112 Ga0105245_10323785 3300009098 Bacteria 1519
113 Ga0105247_10019751 3300009101 Bacteria 4047
114 Ga0114129_10202437 3300009147 Bacteria 2688
115 Ga0114129_10351994 3300009147 Bacteria 1951
116 Ga0105243_10002416 3300009148 Bacteria 15648
117 Ga0105243_10027022 3300009148 Bacteria 4395
118 Ga0105243_10062805 3300009148 Bacteria 2974
119 Ga0105243_10086785 3300009148 Bacteria 2567
120 Ga0105243_10144138 3300009148 Bacteria 2036
121 Ga0105241_10030805 3300009174 Bacteria 4013
122 Ga0105241_10036978 3300009174 Bacteria 3676
123 Ga0105242_10145469 3300009176 Bacteria 2062
124 Ga0105248_10149618 3300009177 Bacteria 2634
125 Ga0105248_10160887 3300009177 Bacteria 2532
126 Ga0105248_10190953 3300009177 Bacteria 2308
127 Ga0105237_10235735 3300009545 Bacteria 1831
128 Ga0105237_10388560 3300009545 Bacteria 1400
129 Ga0105238_10140877 3300009551 Bacteria 2388
130 Ga0105238_10320832 3300009551 Bacteria 1535
131 Ga0105239_10111986 3300010375 Bacteria 3026
132 Ga0105239_10383798 3300010375 Bacteria 1588
133 Ga0105246_10004322 3300011119 Bacteria 8640
134 Ga0105246_10162559 3300011119 Bacteria 1702
135 Ga0105246_10268468 3300011119 Bacteria 1363
136 Ga0157373_10179082 3300013100 Bacteria 1492
137 Ga0157371_10087997 3300013102 Bacteria 2199
138 Ga0157370_10002881 3300013104 Bacteria 20492
139 Ga0157370_10076701 3300013104 Bacteria 3148
140 Ga0157370_10357205 3300013104 Bacteria 1346
141 Ga0157369_10006908 3300013105 Bacteria 13099
142 Ga0157369_10011101 3300013105 Bacteria 10248
143 Ga0157374_10071045 3300013296 Bacteria 3281
144 Ga0157374_10111925 3300013296 Bacteria 2627
145 Ga0157374_10155576 3300013296 Bacteria 2225
146 Ga0157374_10334108 3300013296 Bacteria 1503
147 Ga0157378_10099207 3300013297 Bacteria 2657
148 Ga0157378_10346208 3300013297 Bacteria 1451
149 Ga0163162_10113745 3300013306 Bacteria 2805
150 Ga0163162_10263497 3300013306 Bacteria 1855
151 Ga0157372_10132844 3300013307 Bacteria 2865
152 Ga0157372_10162283 3300013307 Bacteria 2583
153 Ga0157372_10412314 3300013307 Bacteria 1574
154 Ga0157375_10241325 3300013308 Bacteria 1967
155 Ga0157375_10388057 3300013308 Bacteria 1563
156 Ga0163163_10329322 3300014325 Bacteria 1581
157 Ga0157377_10048414 3300014745 Bacteria 2385
158 Ga0157377_10165445 3300014745 Bacteria 1379
159 Ga0157379_10052288 3300014968 Bacteria 3649
160 Ga0157379_10148033 3300014968 Bacteria 2118
161 Ga0157376_10145857 3300014969 Bacteria 2129
162 Ga0157376_10345923 3300014969 Bacteria 1421
163 Ga0163161_10060029 3300017792 Bacteria 2767
164 Ga0163161_10111262 3300017792 Bacteria 2047
165 Ga0207427_100041 3300025231 Bacteria 263659
166 Ga0209437_100371 3300025233 Bacteria 46718
167 Ga0209148_1003704 3300025254 Bacteria 4045
168 Ga0209233_1000014 3300025261 Bacteria 996641
169 Ga0209673_1028423 3300025273 Bacteria 1800
170 Ga0209051_1001791 3300025303 Bacteria 17057
171 Ga0209051_1006529 3300025303 Bacteria 6552
172 Ga0209051_1010880 3300025303 Bacteria 4546
173 Ga0207697_10000015 3300025315 Bacteria 59450
174 Ga0207655_1002155 3300025728 Bacteria 16405
175 Ga0207655_1003325 3300025728 Bacteria 12048
176 Ga0207682_10008880 3300025893 Bacteria 3975
177 Ga0207642_10008581 3300025899 Bacteria 3514
178 Ga0207688_10002220 3300025901 Bacteria 10459
179 Ga0207680_10043144 3300025903 Bacteria 2643
180 Ga0207685_10014083 3300025905 Bacteria 2494
181 Ga0207645_10002039 3300025907 Bacteria 16218
182 Ga0207645_10032519 3300025907 Bacteria 3353
183 Ga0207643_10089321 3300025908 Bacteria 1794
184 Ga0207705_10020037 3300025909 Bacteria 4782
185 Ga0207705_10046090 3300025909 Bacteria 3132
186 Ga0207654_10026985 3300025911 Bacteria 3117
187 Ga0207707_10037498 3300025912 Bacteria 4236
188 Ga0207693_10012464 3300025915 Bacteria 6868
189 Ga0207663_10051214 3300025916 Bacteria 2570
190 Ga0207660_10259941 3300025917 Bacteria 1373
191 Ga0207662_10005556 3300025918 Bacteria 6735
192 Ga0207657_10022118 3300025919 Bacteria 5966
193 Ga0207657_10170195 3300025919 Bacteria 1765
194 Ga0207649_10036555 3300025920 Bacteria 2959
195 Ga0207652_10002331 3300025921 Bacteria 16081
196 Ga0207652_10141661 3300025921 Bacteria 2150
197 Ga0207681_10103436 3300025923 Bacteria 2058
198 Ga0207681_10178505 3300025923 Bacteria 1615
199 Ga0207694_10111874 3300025924 Bacteria 2173
200 Ga0207650_10005566 3300025925 Bacteria 8599
201 Ga0207687_10014898 3300025927 Bacteria 5093
202 Ga0207687_10023526 3300025927 Bacteria 4108
203 Ga0207687_10024839 3300025927 Bacteria 4006
204 Ga0207644_10231967 3300025931 Bacteria 1467
205 Ga0207690_10032441 3300025932 Bacteria 3351
206 Ga0207706_10056755 3300025933 Bacteria 3452
207 Ga0207686_10082337 3300025934 Bacteria 2103
208 Ga0207686_10082479 3300025934 Bacteria 2102
209 Ga0207686_10201995 3300025934 Bacteria 1424
210 Ga0207709_10010585 3300025935 Bacteria 5081
211 Ga0207709_10014858 3300025935 Bacteria 4307
212 Ga0207709_10117828 3300025935 Bacteria 1788
213 Ga0207670_10001198 3300025936 Bacteria 13719
214 Ga0207669_10045222 3300025937 Bacteria 2592
215 Ga0207704_10003999 3300025938 Bacteria 6711
216 Ga0207704_10018401 3300025938 Bacteria 3646
217 Ga0207665_10037187 3300025939 Bacteria 3240
218 Ga0207665_10039867 3300025939 Bacteria 3132
219 Ga0207691_10000240 3300025940 Bacteria 53770
220 Ga0207689_10054876 3300025942 Bacteria 3280
221 Ga0207661_10005846 3300025944 Bacteria 8679
222 Ga0207661_10019363 3300025944 Bacteria 5073
223 Ga0207661_10094913 3300025944 Bacteria 2492
224 Ga0207661_10221192 3300025944 Bacteria 1673
225 Ga0207679_10080753 3300025945 Bacteria 2484
226 Ga0207667_10145849 3300025949 Bacteria 2437
227 Ga0207640_10052317 3300025981 Bacteria 2659
228 Ga0207658_10091963 3300025986 Bacteria 2355
229 Ga0207677_10021987 3300026023 Bacteria 3911
230 Ga0207677_10047229 3300026023 Bacteria 2889
231 Ga0207677_10052857 3300026023 Bacteria 2762
232 Ga0207639_10039349 3300026041 Bacteria 3523
233 Ga0207678_10053617 3300026067 Bacteria 3475
234 Ga0207708_10012736 3300026075 Bacteria 6272
235 Ga0207708_10048753 3300026075 Bacteria 3225
236 Ga0207702_10112179 3300026078 Bacteria 2426
237 Ga0207641_10309730 3300026088 Bacteria 1494
238 Ga0207641_10424595 3300026088 Bacteria 1281
239 Ga0207648_10040858 3300026089 Bacteria 4074
240 Ga0207648_10102360 3300026089 Bacteria 2510
241 Ga0207676_10132687 3300026095 Bacteria 2120
242 Ga0207676_10210877 3300026095 Bacteria 1723
243 Ga0207674_10045551 3300026116 Bacteria 4511
244 Ga0207675_100074528 3300026118 Bacteria 3176
245 Ga0207683_10013671 3300026121 Bacteria 6923
246 Ga0207683_10052127 3300026121 Bacteria 3585
247 Ga0207683_10054230 3300026121 Bacteria 3515
248 Ga0207698_10123561 3300026142 Bacteria 2196
249 Ga0207698_10182174 3300026142 Bacteria 1862
250 Ga0207428_10006626 3300027907 Bacteria 10650
251 Ga0268266_10076974 3300028379 Bacteria 2900
252 Ga0268266_10155009 3300028379 Bacteria 2068
253 Ga0268265_10075776 3300028380 Bacteria 2636
254 Ga0265338_10021640 3300028800 Bacteria 6695
255 Ga0307512_10011601 3300030522 Bacteria 8343
256 Ga0316177_1000403 3300030731 Bacteria 3088
257 Ga0314311_1114875 3300030733 Bacteria 11645
258 Ga0265327_10000018 3300031251 Bacteria 439197
259 Ga0265327_10003464 3300031251 Bacteria 15020
260 Ga0265316_10087215 3300031344 Bacteria 2385
261 Ga0307408_100001088 3300031548 Bacteria 20782
262 Ga0307408_100023078 3300031548 Bacteria 4234
263 Ga0307408_100023675 3300031548 Bacteria 4186
264 Ga0307408_100058454 3300031548 Bacteria 2803
265 Ga0307408_100249367 3300031548 Bacteria 1463
266 Ga0316575_10008468 3300031665 Bacteria 3748
267 Ga0316579_10003003 3300031691 Bacteria 6484
268 Ga0316576_10000437 3300031727 Bacteria 19400
269 Ga0316576_10015278 3300031727 Bacteria 5149
270 Ga0316576_10024649 3300031727 Bacteria 4201
271 Ga0316578_10002858 3300031728 Bacteria 7725
272 Ga0316578_10064850 3300031728 Bacteria 2156
273 Ga0307405_10025293 3300031731 Bacteria 3405
274 Ga0307405_10025357 3300031731 Bacteria 3402
275 Ga0307405_10030495 3300031731 Bacteria 3162
276 Ga0307405_10032420 3300031731 Bacteria 3088
277 Ga0307405_10073512 3300031731 Bacteria 2207
278 Ga0307405_10083008 3300031731 Bacteria 2099
279 Ga0307405_10141661 3300031731 Bacteria 1677
280 Ga0316577_10140192 3300031733 Bacteria 1362
281 Ga0307413_10006151 3300031824 Bacteria 5449
282 Ga0307413_10012845 3300031824 Bacteria 4183
283 Ga0307518_10000341 3300031838 Bacteria 35232
284 Ga0307518_10150399 3300031838 Bacteria 1611
285 Ga0307410_10006495 3300031852 Bacteria 6314
286 Ga0307410_10020051 3300031852 Bacteria 4081
287 Ga0307410_10042055 3300031852 Bacteria 3018
288 Ga0307410_10048407 3300031852 Bacteria 2847
289 Ga0307410_10057820 3300031852 Bacteria 2642
290 Ga0307410_10064891 3300031852 Bacteria 2510
291 Ga0307410_10131465 3300031852 Bacteria 1839
292 Ga0307406_10006959 3300031901 Bacteria 6267
293 Ga0307406_10080352 3300031901 Bacteria 2165
294 Ga0307407_10011064 3300031903 Bacteria 4280
295 Ga0307407_10030894 3300031903 Bacteria 2895
296 Ga0307407_10173160 3300031903 Bacteria 1424
297 Ga0307412_10013526 3300031911 Bacteria 4787
298 Ga0307412_10045554 3300031911 Bacteria 2868
299 Ga0307412_10052859 3300031911 Bacteria 2691
300 Ga0307412_10054605 3300031911 Bacteria 2652
301 Ga0307412_10066898 3300031911 Bacteria 2437
302 Ga0307412_10118261 3300031911 Bacteria 1903
303 Ga0307412_10123356 3300031911 Bacteria 1869
304 Ga0307409_100000781 3300031995 Bacteria 14433
305 Ga0307409_100055427 3300031995 Bacteria 3060
306 Ga0307409_100075834 3300031995 Bacteria 2694
307 Ga0307409_100239630 3300031995 Bacteria 1650
308 Ga0307409_100354295 3300031995 Bacteria 1386
309 Ga0307416_100000543 3300032002 Bacteria 19195
310 Ga0307416_100017917 3300032002 Bacteria 4973
311 Ga0307416_100043615 3300032002 Bacteria 3513
312 Ga0307416_100110740 3300032002 Bacteria 2418
313 Ga0307416_100142516 3300032002 Bacteria 2181
314 Ga0307416_100185952 3300032002 Bacteria 1953
315 Ga0307416_100196778 3300032002 Bacteria 1907
316 Ga0307416_100249312 3300032002 Bacteria 1727
317 Ga0307414_10021779 3300032004 Bacteria 4032
318 Ga0307414_10080265 3300032004 Bacteria 2385
319 Ga0307414_10094826 3300032004 Bacteria 2228
320 Ga0307411_10022376 3300032005 Bacteria 3720
321 Ga0307411_10051145 3300032005 Bacteria 2694
322 Ga0307415_100023738 3300032126 Bacteria 3815
323 Ga0316583_10018696 3300032133 Bacteria 2489
324 Ga0316574_0004264 3300035398 Bacteria 7471
325 Ga0316574_0009948 3300035398 Bacteria 5350
326 Ga0316574_0129401 3300035398 Bacteria 1624
327 Ga0373927_0034118 3300035695 Bacteria 3311
328 Ga0316582_0002622 3300036647 Bacteria 8521
329 Ga0316582_0006271 3300036647 Bacteria 6227
330 Ga0316584_0000284 3300036712 Bacteria 26011
331 Ga0316584_0003768 3300036712 Bacteria 9934
332 Ga0316584_0009761 3300036712 Bacteria 6678
333 Ga0316584_0047280 3300036712 Bacteria 3214
334 Ga0373925_0000546 3300037068 Bacteria 37027
335 Ga0373925_0002151 3300037068 Bacteria 16104
336 Ga0395899_0000961 3300037312 Bacteria 26769
337 Ga0395899_0139776 3300037312 Bacteria 1724
338 Ga0395900_0035139 3300037418 Bacteria 5163
339 Ga0395900_0396630 3300037418 Bacteria 1345
340 Ga0395898_0018287 3300037466 Bacteria 7146
341 Ga0395898_0040972 3300037466 Bacteria 4576
342 Ga0395898_0076363 3300037466 Bacteria 3235
343 Ga0395905_0035449 3300037471 Bacteria 4685
344 Ga0395905_0086590 3300037471 Bacteria 2937
345 Ga0395901_0029361 3300038443 Bacteria 5661
346 Ga0395901_0034876 3300038443 Bacteria 5197
347 Ga0395901_0034950 3300038443 Bacteria 5192
348 Ga0395901_0062107 3300038443 Bacteria 3888
349 Ga0395901_0228988 3300038443 Bacteria 1941
350 Ga0439466_0011638 3300041411 Bacteria 3251
351 Ga0451793_0253740 3300041452 Bacteria 3976
352 Ga0451793_1456744 3300041452 Bacteria 1473
353 Ga0451797_0676945 3300041453 Bacteria 1655
354 Ga0439442_003791 3300042002 Bacteria 2994
355 Ga0439449_0005599 3300042007 Bacteria 4805
356 Ga0439449_0033975 3300042007 Bacteria 1899
357 Ga0439449_0050925 3300042007 Bacteria 1532
358 Ga0439451_011154 3300042009 Bacteria 1813
359 Ga0495617_050888 3300046452 Bacteria 1378
360 Ga0495592_0019908 3300046454 Bacteria 5102
361 Ga0495592_0021776 3300046454 Bacteria 4877
362 Ga0495603_0020100 3300046455 Bacteria 4047
363 Ga0495603_0042208 3300046455 Bacteria 2727
364 Ga0495603_0103719 3300046455 Bacteria 1660
365 Ga0495629_0024179 3300046459 Bacteria 4326
366 Ga0495629_0030665 3300046459 Bacteria 3811
367 Ga0495629_0043473 3300046459 Bacteria 3154
368 Ga0495651_0000947 3300046462 Bacteria 22465
369 Ga0495651_0024496 3300046462 Bacteria 4694
370 Ga0495653_0000468 3300046463 Bacteria 31243
371 Ga0495653_0002447 3300046463 Bacteria 14742
372 Ga0495653_0054252 3300046463 Bacteria 3063
373 Ga0495653_0176758 3300046463 Bacteria 1468
374 Ga0495650_0020985 3300046471 Bacteria 3171
375 Ga0495580_0009672 3300046472 Bacteria 7568
376 Ga0495580_0017933 3300046472 Bacteria 5280
377 Ga0495580_0018641 3300046472 Bacteria 5165
378 Ga0495639_0002895 3300046475 Bacteria 7472
379 Ga0495662_0004431 3300046476 Bacteria 7049
380 Ga0495662_0019872 3300046476 Bacteria 3249
381 Ga0495664_0003529 3300046477 Bacteria 8530
382 Ga0495664_0016800 3300046477 Bacteria 4176
383 Ga0495584_0094260 3300046491 Bacteria 1511
384 Ga0495584_0106019 3300046491 Bacteria 1421
385 Ga0495607_0088132 3300046501 Bacteria 1687
386 Ga0495608_0002580 3300046511 Bacteria 13006
387 Ga0495616_0053472 3300046513 Bacteria 2006
388 Ga0495618_0007082 3300046514 Bacteria 6782
389 Ga0495628_0009866 3300046516 Bacteria 8134
390 Ga0495628_0017078 3300046516 Bacteria 6046
391 Ga0495630_0032140 3300046517 Bacteria 3908
392 Ga0495631_0012263 3300046518 Bacteria 4194
393 Ga0495643_0103788 3300046522 Bacteria 1454
394 Ga0495644_0056673 3300046523 Bacteria 1472
395 Ga0495663_0057219 3300046525 Bacteria 1219
396 Ga0495652_0002737 3300046529 Bacteria 17848
397 Ga0495665_0005430 3300046531 Bacteria 6869
398 Ga0495640_0009777 3300046533 Bacteria 7451
399 Ga0495640_0094210 3300046533 Bacteria 1972
400 Ga0495640_0129799 3300046533 Bacteria 1632
401 Ga0495609_0012796 3300046538 Bacteria 3974
402 Ga0495645_0024011 3300046543 Bacteria 4419
403 Ga0495645_0029810 3300046543 Bacteria 3971
404 Ga0495633_0033659 3300046558 Bacteria 2470
405 Ga0495667_0002903 3300046559 Bacteria 11497
406 Ga0495667_0007901 3300046559 Bacteria 7210
407 Ga0495656_0029118 3300046615 Bacteria 2220
408 Ga0495668_0000352 3300046616 Bacteria 61322
409 Ga0495668_0050400 3300046616 Bacteria 2308
410 Ga0495668_0118468 3300046616 Bacteria 1448
411 Ga0495634_0025829 3300046642 Bacteria 4102
412 Ga0495635_0002053 3300046663 Bacteria 13648
413 Ga0495635_0119429 3300046663 Bacteria 1799
414 Ga0495659_0055469 3300046664 Bacteria 1452
415 Ga0495588_0021029 3300046674 Bacteria 3212
416 Ga0495657_0005138 3300046675 Bacteria 10369
417 Ga0495657_0103694 3300046675 Bacteria 1809
418 Ga0495599_0000251 3300046678 Bacteria 33998
419 Ga0495599_0010264 3300046678 Bacteria 5731
420 Ga0495623_0048902 3300046679 Bacteria 2680
421 Ga0495646_0018513 3300046680 Bacteria 4410
422 Ga0495646_0035658 3300046680 Bacteria 3085
423 Ga0495669_0076302 3300046684 Bacteria 1534
424 Ga0495613_0003769 3300046689 Bacteria 11363
425 Ga0495670_0002814 3300046691 Bacteria 8607
426 Ga0495670_0139365 3300046691 Bacteria 1268
427 Ga0495649_0018286 3300046694 Bacteria 3945
428 Ga0495649_0122582 3300046694 Bacteria 1374
429 Ga0495589_0101712 3300046794 Bacteria 1390
430 Ga0495600_0032178 3300046809 Bacteria 3401
431 Ga0495581_0003348 3300047315 Bacteria 9203
432 Ga0495581_0013941 3300047315 Bacteria 4662
433 Ga0495604_0000511 3300047317 Bacteria 34056
434 Ga0495604_0001557 3300047317 Bacteria 18890
435 Ga0495636_0012871 3300047318 Bacteria 3316
436 Ga0495674_0009679 3300047319 Bacteria 9149
437 Ga0495674_0016223 3300047319 Bacteria 6948
438 Ga0495674_0116081 3300047319 Bacteria 2265
439 Ga0495680_0003326 3300047322 Bacteria 15903
440 Ga0495680_0157138 3300047322 Bacteria 1653
441 Ga0495685_007653 3300047447 Bacteria 3572
442 Ga0495681_0036311 3300047470 Bacteria 2438
443 Ga0495681_0046652 3300047470 Bacteria 2065
444 Ga0495684_0000544 3300047471 Bacteria 30546
445 Ga0495684_0009486 3300047471 Bacteria 7507
446 Ga0495686_0006550 3300047472 Bacteria 8888
447 Ga0495593_0091930 3300047673 Bacteria 1562
448 Ga0495602_0041879 3300048088 Bacteria 4177
449 Ga0496100_0015496 3300048903 Bacteria 4454
450 Ga0496100_0047462 3300048903 Bacteria 2767
451 Ga0496101_0010791 3300048904 Bacteria 6044
452 Ga0496101_0079335 3300048904 Bacteria 2423
453 Ga0496101_0131838 3300048904 Bacteria 1898
454 Ga0496102_0008212 3300048905 Bacteria 8937
455 Ga0496102_0012060 3300048905 Bacteria 7468
456 Ga0496102_0081701 3300048905 Bacteria 2979
457 Ga0496102_0093759 3300048905 Bacteria 2781
458 Ga0496102_0140191 3300048905 Bacteria 2267
459 Ga0496102_0249419 3300048905 Bacteria 1674
460 Ga0496103_0042143 3300048906 Bacteria 2807
461 Ga0496103_0063315 3300048906 Bacteria 2304
462 Ga0496104_0034492 3300048907 Bacteria 4719
463 Ga0496104_0046877 3300048907 Bacteria 4072
464 Ga0496104_0084583 3300048907 Bacteria 3027
465 Ga0496104_0091297 3300048907 Bacteria 2911
466 Ga0496104_0234167 3300048907 Bacteria 1748
467 Ga0496105_0005681 3300048908 Bacteria 9493
468 Ga0496105_0007824 3300048908 Bacteria 8295
469 Ga0496105_0011947 3300048908 Bacteria 6875
470 Ga0496105_0031739 3300048908 Bacteria 4331
471 Ga0496105_0034016 3300048908 Bacteria 4190
472 Ga0496105_0313606 3300048908 Bacteria 1258
473 Ga0496106_0003027 3300048909 Bacteria 12523
474 Ga0496106_0020822 3300048909 Bacteria 4866
475 Ga0496106_0037833 3300048909 Bacteria 3610
476 Ga0496106_0089753 3300048909 Bacteria 2370
477 Ga0496106_0102410 3300048909 Bacteria 2221
478 Ga0496106_0218094 3300048909 Bacteria 1521
479 Ga0496106_0248862 3300048909 Bacteria 1421
480 Ga0496107_0011534 3300048910 Bacteria 6157
481 Ga0496107_0077544 3300048910 Bacteria 2421
482 Ga0496107_0132489 3300048910 Bacteria 1840
483 Ga0496107_0210015 3300048910 Bacteria 1447
484 Ga0496108_0001527 3300048911 Bacteria 18318
485 Ga0496108_0009943 3300048911 Bacteria 7713
486 Ga0496108_0019430 3300048911 Bacteria 5580
487 Ga0496108_0063471 3300048911 Bacteria 3110
488 Ga0496108_0070293 3300048911 Bacteria 2954
489 Ga0496109_0004173 3300048912 Bacteria 12057
490 Ga0496109_0004800 3300048912 Bacteria 11285
491 Ga0496109_0048283 3300048912 Bacteria 3873
492 Ga0496110_0005816 3300048913 Bacteria 9691
493 Ga0496110_0052361 3300048913 Bacteria 3587
494 Ga0496110_0086889 3300048913 Bacteria 2792
495 Ga0496110_0087845 3300048913 Bacteria 2776
496 Ga0496110_0355166 3300048913 Bacteria 1335
497 Ga0496111_0002373 3300048914 Bacteria 11345
498 Ga0496111_0009602 3300048914 Bacteria 6463
499 Ga0496111_0048145 3300048914 Bacteria 3071
500 Ga0496111_0147165 3300048914 Bacteria 1746
501 Ga0496111_0218028 3300048914 Bacteria 1417
502 Ga0496112_0050780 3300048915 Bacteria 4067
503 Ga0496112_0095169 3300048915 Bacteria 2949
504 Ga0496112_0278100 3300048915 Bacteria 1622
505 Ga0496112_0278295 3300048915 Bacteria 1621
506 Ga0496112_0314579 3300048915 Bacteria 1511
507 Ga0496113_0014888 3300048916 Bacteria 5323
508 Ga0496113_0016751 3300048916 Bacteria 5069
509 Ga0496113_0096766 3300048916 Bacteria 2283
510 Ga0496113_0256966 3300048916 Bacteria 1395
511 Ga0496114_0005796 3300048917 Bacteria 9701
512 Ga0496114_0022378 3300048917 Bacteria 5151
513 Ga0496114_0048353 3300048917 Bacteria 3538
514 Ga0496114_0145351 3300048917 Bacteria 2055
515 Ga0496114_0196345 3300048917 Bacteria 1766
516 Ga0496114_0198062 3300048917 Bacteria 1758
517 Ga0496114_0202853 3300048917 Bacteria 1737
518 Ga0496115_0011698 3300048918 Bacteria 6588
519 Ga0496115_0020885 3300048918 Bacteria 5054
520 Ga0496115_0037729 3300048918 Bacteria 3830
521 Ga0496115_0191308 3300048918 Bacteria 1691
522 Ga0496119_0028888 3300048922 Bacteria 3774
523 Ga0496120_0112654 3300048923 Bacteria 1419
524 Ga0496121_0000641 3300048924 Bacteria 65258
525 Ga0496122_0072644 3300048925 Bacteria 2445
526 Ga0496122_0151965 3300048925 Bacteria 1428
527 Ga0496123_0026625 3300048926 Bacteria 4327
528 Ga0496125_0022398 3300048928 Bacteria 5867
529 Ga0496126_0003501 3300048929 Bacteria 19807
530 Ga0496126_0074594 3300048929 Bacteria 3012
531 Ga0496126_0083778 3300048929 Bacteria 2814
532 Ga0501032_0161038 3300049569 Bacteria 1474
533 Ga0501033_0040303 3300049570 Bacteria 3487
534 Ga0501036_0009713 3300049572 Bacteria 7921
535 Ga0501037_0017637 3300049573 Bacteria 5256
536 Ga0501038_0006814 3300049574 Bacteria 10555
537 Ga0501039_0002106 3300049575 Bacteria 14735
538 Ga0501040_0000143 3300049576 Bacteria 38640
539 Ga0501041_0011718 3300049577 Bacteria 5189
540 Ga0501048_0017693 3300049582 Bacteria 5246
541 Ga0501068_0092182 3300049584 Bacteria 1870
542 Ga0501069_0087729 3300049585 Bacteria 1758
543 Ga0501071_0006645 3300049587 Bacteria 7514
544 Ga0501072_0002351 3300049588 Bacteria 14188
545 Ga0501075_0001968 3300049591 Bacteria 13554
546 Ga0501076_0000559 3300049592 Bacteria 23721
547 Ga0501077_0000359 3300049593 Bacteria 27065
548 Ga0501079_0004519 3300049741 Bacteria 10318
549 Ga0501081_0035781 3300049743 Bacteria 3381
550 Ga0501035_0034311 3300049822 Bacteria 4611
551 Ga0501045_0001083 3300049824 Bacteria 17991
552 nmdc:mga00v17_21049_c1 3300050491 Bacteria 3745
553 nmdc:mga00v17_8579_c1 3300050491 Bacteria 5503
554 nmdc:mga06r32_8071_c1 3300050510 Bacteria 9472
555 nmdc:mga0n895_26535_c1 3300050512 Bacteria 5488
556 nmdc:mga0sz30_5596_c1 3300050516 Bacteria 4616
557 Ga0495601_0027993 3300053077 Bacteria 3488
558 Ga0500635_0000132 3300053080 Bacteria 43287
559 Ga0495655_0001566 3300053083 Bacteria 3523
560 Ga0495595_0003064 3300053084 Bacteria 6612
561 Ga0500573_0100002 3300053140 Bacteria 1633
562 Ga0500645_000640 3300053730 Bacteria 22258
563 Ga0501084_0004988 3300054114 Bacteria 10859
564 Ga0590075_016071 3300059424 Bacteria 1840
565 Ga0501082_0009793 3300060353 Bacteria 8257
566 Ga0530510_0000107 3300061734 Bacteria 45987
567 2566991353 2565956761 Bacteria 6601618
568 2586063039 2585427649 Bacteria 9053857
569 2643785142 2643221553 Bacteria 3544260
570 2643876532 2643221572 Bacteria 3614809
571 2644113610 2643221619 Bacteria 4158469
572 2644178340 2643221631 Bacteria 8168043
573 2644229272 2643221641 Bacteria 4490190
574 2644383587 2643221669 Bacteria 3611286
575 2644487121 2643221687 Bacteria 6500351
576 2644523828 2643221694 Bacteria 4392972
577 2644609021 2643221711 Bacteria 4865335
578 2644667930 2643221722 Bacteria 4247614
579 2644679467 2643221724 Bacteria 3593515
580 2691515759 2690315906 Bacteria 4517044
581 2723640965 2721755702 Bacteria 4373124
582 2730228975 2728369380 Bacteria 3620317
583 2738693190 2738541272 Bacteria 6848551
584 2738705284 2738541274 Bacteria 6909446
585 2738892034 2738541308 Bacteria 7020677
586 2739237370 2738543011 Bacteria 5731169
587 2739323235 2738543027 Bacteria 6409078
588 2739334611 2738543028 Bacteria 6917070
589 2739367317 2738543034 Bacteria 6084756
590 2753037362 2751185725 Bacteria 5740550
591 2753325231 2751185792 Bacteria 5739090
592 2760622247 2758568621 Bacteria 5967089
593 2775657358 2775506735 Bacteria 4556596
594 2808828899 2808606357 Bacteria 4466944
595 2808850130 2808606360 Bacteria 4404006
596 2808874067 2808606365 Bacteria 4301966
597 2808893136 2808606370 Bacteria 4942454
598 2808896298 2808606371 Bacteria 4251511
599 2809194498 2808606439 Bacteria 5952208
600 2809587844 2808606522 Bacteria 9488490
601 2812319401 2811994871 Bacteria 4497550
602 2812349997 2811994878 Bacteria 5992952
603 2819426869 2818991318 Bacteria 5266538
604 2819692621 2818991462 Bacteria 4320267
605 2819728864 2818991469 Bacteria 4644110
606 2857742801 2857740372 Bacteria 4782044
607 2884764238 2884763398 Bacteria 4091164
608 2887447763 2887443736 Bacteria 4426037
609 2889302511 2889300758 Bacteria 5690814
610 2895660740 2895660088 Bacteria 3782833
611 2902842049 2902837492 Bacteria 6697721
612 2904501200 2904497146 Bacteria 4731781
613 2904541686 2904535858 Bacteria 6308016
614 2904769618 2904765812 Bacteria 5369154
615 2904773184 2904770941 Bacteria 5580202
616 2904779014 2904776348 Bacteria 4658726
617 2908813984 2908811453 Bacteria 5478616
618 2915770117 2915768154 Bacteria 8424322
619 2919037136 2919034639 Bacteria 4763403
620 2919394218 2919391150 Bacteria 4884741
621 2919395178 2919391150 Bacteria 4884741
622 2919422453 2919420072 Bacteria 5390363
623 2919435294 2919432681 Bacteria 5390474
624 2919446705 2919443155 Bacteria 4072969
625 2919526706 2919523602 Bacteria 3788128
626 2919543008 2919538618 Bacteria 4677069
627 2922556234 2922554459 Bacteria 6683962
628 2932430794 2932426870 Bacteria 4547726
629 2933419488 2933418574 Bacteria 4476724
630 2935410417 2935409751 Bacteria 4179611
631 2939602191 2939598168 Bacteria 4687164
632 2939675642 2939674588 Bacteria 4844420
633 2939748392 2939743619 Bacteria 5762299
634 2945917153 2945916053 Bacteria 4555517
635 2945922595 2945920336 Bacteria 4501603
636 2945941240 2945941187 Bacteria 4682474
637 2945960823 2945956166 Bacteria 5110334
638 2946037115 2946037020 Bacteria 4900426
639 2946060953 2946059875 Bacteria 4386623
640 2953998368 2953998280 Bacteria 4812144
641 2954711717 2954711539 Bacteria 10867210
642 2954740547 2954740390 Bacteria 10229294
643 2954759015 2954749733 Bacteria 10366972
644 2954759559 2954759201 Bacteria 9358192
645 2956941342 2956939328 Bacteria 3474458
646 2974305099 2974302888 Bacteria 4369871
647 3001120229 3001119090 Bacteria 3449530
648 8003316760 8003314358 Bacteria 10575343
649 8003321010 8003314358 Bacteria 10575343
650 8004022118 8004021418 Bacteria 4313954
651 8004025837 8004025490 Bacteria 4327753
652 8054108678 8054107350 Bacteria 5022511
653 8054612803 8054609563 Bacteria 5170090
654 8056580283 8056579771 Bacteria 5840325
655 Ga0496118_0043781
656 JGI24737J22298_10029959
657 JGI24744J21845_10004149
658 JGI24744J21845_10009120
659 JGI24034J26672_10004744
660 JGI24742J22300_10003796
661 JGI25164J39214_1000184
662 JGI25165J46597_1000092
663 Ga0055540_1009213
664 Ga0055540_1011866
665 Ga0070658_10014549
666 Ga0070658_10020984
667 Ga0070658_10044793
668 Ga0070683_100004574
669 Ga0070683_100054207
670 Ga0070683_100173323
671 Ga0070690_100034465
672 Ga0070670_100246800
673 Ga0070677_10005997
674 Ga0068869_100036535
675 Ga0068869_100096013
676 Ga0070666_10003614
677 Ga0070666_10081259
678 Ga0070680_100045234
679 Ga0070680_100222119
680 Ga0070682_100023590
681 Ga0070682_100061659
682 Ga0070682_100193783
683 Ga0068868_100092353
684 Ga0070660_100019543
685 Ga0070660_100179210
686 Ga0070689_100013015
687 Ga0070687_100096896
688 Ga0070661_100030675
689 Ga0070661_100031061
690 Ga0070692_10007759
691 Ga0070692_10037451
692 Ga0070669_100009997
693 Ga0070669_100083312
694 Ga0070675_100002864
695 Ga0070675_100111535
696 Ga0070675_100202593
697 Ga0070673_100051148
698 Ga0070659_100029122
699 Ga0070659_100077600
700 Ga0070667_100174798
701 Ga0070667_100383974
702 Ga0070703_10024339
703 Ga0070709_10071681
704 Ga0070713_100304241
705 Ga0070701_10015653
706 Ga0070711_100127714
707 Ga0070700_100016484
708 Ga0070700_100025989
709 Ga0070694_100072012
710 Ga0070663_100040525
711 Ga0070663_100163319
712 Ga0070681_10035482
713 Ga0070681_10250481
714 Ga0070685_10082038
715 Ga0070698_100176966
716 Ga0070679_100001890
717 Ga0070679_100050434
718 Ga0070679_100130857
719 Ga0070684_100010264
720 Ga0070684_100054554
721 Ga0068853_100022825
722 Ga0068853_100106140
723 Ga0068853_100281060
724 Ga0070686_100165835
725 Ga0070696_100033323
726 Ga0070696_100249936
727 Ga0070665_100029834
728 Ga0070665_100234264
729 Ga0068855_100144526
730 Ga0070664_100079279
731 Ga0070664_100138882
732 Ga0068854_100029812
733 Ga0068856_100071081
734 Ga0070702_100000262
735 Ga0068852_100141095
736 Ga0068852_100338431
737 Ga0068864_100024414
738 Ga0068864_100261234
739 Ga0068864_100276209
740 Ga0068861_100041538
741 Ga0068863_100238625
742 Ga0068858_100063879
743 Ga0068858_100351979
744 Ga0075365_10083355
745 Ga0075365_10117829
746 Ga0075364_10010909
747 Ga0075364_10027992
748 Ga0075364_10196863
749 Ga0075432_10000814
750 Ga0070715_10047547
751 Ga0070712_100019448
752 Ga0075369_10001673
753 Ga0075369_10027107
754 Ga0097621_100075339
755 Ga0068871_100177798
756 Ga0075431_100000036
757 Ga0075434_100012101
758 Ga0068865_100008643
759 Ga0099795_10027033
760 Ga0105251_10024059
761 Ga0105244_10004212
762 Ga0105240_10357393
763 Ga0111539_10247388
764 Ga0111539_10274575
765 Ga0105245_10287231
766 Ga0105245_10323785
767 Ga0105247_10019751
768 Ga0114129_10202437
769 Ga0114129_10351994
770 Ga0105243_10002416
771 Ga0105243_10027022
772 Ga0105243_10062805
773 Ga0105243_10086785
774 Ga0105243_10144138
775 Ga0105241_10030805
776 Ga0105241_10036978
777 Ga0105242_10145469
778 Ga0105248_10149618
779 Ga0105248_10160887
780 Ga0105248_10190953
781 Ga0105237_10235735
782 Ga0105237_10388560
783 Ga0105238_10140877
784 Ga0105238_10320832
785 Ga0105239_10111986
786 Ga0105239_10383798
787 Ga0105246_10004322
788 Ga0105246_10162559
789 Ga0105246_10268468
790 Ga0157373_10179082
791 Ga0157371_10087997
792 Ga0157370_10002881
793 Ga0157370_10076701
794 Ga0157370_10357205
795 Ga0157369_10006908
796 Ga0157369_10011101
797 Ga0157374_10071045
798 Ga0157374_10111925
799 Ga0157374_10155576
800 Ga0157374_10334108
801 Ga0157378_10099207
802 Ga0157378_10346208
803 Ga0163162_10113745
804 Ga0163162_10263497
805 Ga0157372_10132844
806 Ga0157372_10162283
807 Ga0157372_10412314
808 Ga0157375_10241325
809 Ga0157375_10388057
810 Ga0163163_10329322
811 Ga0157377_10048414
812 Ga0157377_10165445
813 Ga0157379_10052288
814 Ga0157379_10148033
815 Ga0157376_10145857
816 Ga0157376_10345923
817 Ga0163161_10060029
818 Ga0163161_10111262
819 Ga0207427_100041
820 Ga0209437_100371
821 Ga0209148_1003704
822 Ga0209233_1000014
823 Ga0209673_1028423
824 Ga0209051_1001791
825 Ga0209051_1006529
826 Ga0209051_1010880
827 Ga0207697_10000015
828 Ga0207655_1002155
829 Ga0207655_1003325
830 Ga0207682_10008880
831 Ga0207642_10008581
832 Ga0207688_10002220
833 Ga0207680_10043144
834 Ga0207685_10014083
835 Ga0207645_10002039
836 Ga0207645_10032519
837 Ga0207643_10089321
838 Ga0207705_10020037
839 Ga0207705_10046090
840 Ga0207654_10026985
841 Ga0207707_10037498
842 Ga0207693_10012464
843 Ga0207663_10051214
844 Ga0207660_10259941
845 Ga0207662_10005556
846 Ga0207657_10022118
847 Ga0207657_10170195
848 Ga0207649_10036555
849 Ga0207652_10002331
850 Ga0207652_10141661
851 Ga0207681_10103436
852 Ga0207681_10178505
853 Ga0207694_10111874
854 Ga0207650_10005566
855 Ga0207687_10014898
856 Ga0207687_10023526
857 Ga0207687_10024839
858 Ga0207644_10231967
859 Ga0207690_10032441
860 Ga0207706_10056755
861 Ga0207686_10082337
862 Ga0207686_10082479
863 Ga0207686_10201995
864 Ga0207709_10010585
865 Ga0207709_10014858
866 Ga0207709_10117828
867 Ga0207670_10001198
868 Ga0207669_10045222
869 Ga0207704_10003999
870 Ga0207704_10018401
871 Ga0207665_10037187
872 Ga0207665_10039867
873 Ga0207691_10000240
874 Ga0207689_10054876
875 Ga0207661_10005846
876 Ga0207661_10019363
877 Ga0207661_10094913
878 Ga0207661_10221192
879 Ga0207679_10080753
880 Ga0207667_10145849
881 Ga0207640_10052317
882 Ga0207658_10091963
883 Ga0207677_10021987
884 Ga0207677_10047229
885 Ga0207677_10052857
886 Ga0207639_10039349
887 Ga0207678_10053617
888 Ga0207708_10012736
889 Ga0207708_10048753
890 Ga0207702_10112179
891 Ga0207641_10309730
892 Ga0207641_10424595
893 Ga0207648_10040858
894 Ga0207648_10102360
895 Ga0207676_10132687
896 Ga0207676_10210877
897 Ga0207674_10045551
898 Ga0207675_100074528
899 Ga0207683_10013671
900 Ga0207683_10052127
901 Ga0207683_10054230
902 Ga0207698_10123561
903 Ga0207698_10182174
904 Ga0207428_10006626
905 Ga0268266_10076974
906 Ga0268266_10155009
907 Ga0268265_10075776
908 Ga0265338_10021640
909 Ga0307512_10011601
910 Ga0316177_1000403
911 Ga0314311_1114875
912 Ga0265327_10000018
913 Ga0265327_10003464
914 Ga0265316_10087215
915 Ga0307408_100001088
916 Ga0307408_100023078
917 Ga0307408_100023675
918 Ga0307408_100058454
919 Ga0307408_100249367
920 Ga0316575_10008468
921 Ga0316579_10003003
922 Ga0316576_10000437
923 Ga0316576_10015278
924 Ga0316576_10024649
925 Ga0316578_10002858
926 Ga0316578_10064850
927 Ga0307405_10025293
928 Ga0307405_10025357
929 Ga0307405_10030495
930 Ga0307405_10032420
931 Ga0307405_10073512
932 Ga0307405_10083008
933 Ga0307405_10141661
934 Ga0316577_10140192
935 Ga0307413_10006151
936 Ga0307413_10012845
937 Ga0307518_10000341
938 Ga0307518_10150399
939 Ga0307410_10006495
940 Ga0307410_10020051
941 Ga0307410_10042055
942 Ga0307410_10048407
943 Ga0307410_10057820
944 Ga0307410_10064891
945 Ga0307410_10131465
946 Ga0307406_10006959
947 Ga0307406_10080352
948 Ga0307407_10011064
949 Ga0307407_10030894
950 Ga0307407_10173160
951 Ga0307412_10013526
952 Ga0307412_10045554
953 Ga0307412_10052859
954 Ga0307412_10054605
955 Ga0307412_10066898
956 Ga0307412_10118261
957 Ga0307412_10123356
958 Ga0307409_100000781
959 Ga0307409_100055427
960 Ga0307409_100075834
961 Ga0307409_100239630
962 Ga0307409_100354295
963 Ga0307416_100000543
964 Ga0307416_100017917
965 Ga0307416_100043615
966 Ga0307416_100110740
967 Ga0307416_100142516
968 Ga0307416_100185952
969 Ga0307416_100196778
970 Ga0307416_100249312
971 Ga0307414_10021779
972 Ga0307414_10080265
973 Ga0307414_10094826
974 Ga0307411_10022376
975 Ga0307411_10051145
976 Ga0307415_100023738
977 Ga0316583_10018696
978 Ga0316574_0004264
979 Ga0316574_0009948
980 Ga0316574_0129401
981 Ga0373927_0034118
982 Ga0316582_0002622
983 Ga0316582_0006271
984 Ga0316584_0000284
985 Ga0316584_0003768
986 Ga0316584_0009761
987 Ga0316584_0047280
988 Ga0373925_0000546
989 Ga0373925_0002151
990 Ga0395899_0000961
991 Ga0395899_0139776
992 Ga0395900_0035139
993 Ga0395900_0396630
994 Ga0395898_0018287
995 Ga0395898_0040972
996 Ga0395898_0076363
997 Ga0395905_0035449
998 Ga0395905_0086590
999 Ga0395901_0029361
1000 Ga0395901_0034876
1001 Ga0395901_0034950
1002 Ga0395901_0062107
1003 Ga0395901_0228988
1004 Ga0439466_0011638
1005 Ga0451793_0253740
1006 Ga0451793_1456744
1007 Ga0451797_0676945
1008 Ga0439442_003791
1009 Ga0439449_0005599
1010 Ga0439449_0033975
1011 Ga0439449_0050925
1012 Ga0439451_011154
1013 Ga0495617_050888
1014 Ga0495592_0019908
1015 Ga0495592_0021776
1016 Ga0495603_0020100
1017 Ga0495603_0042208
1018 Ga0495603_0103719
1019 Ga0495629_0024179
1020 Ga0495629_0030665
1021 Ga0495629_0043473
1022 Ga0495651_0000947
1023 Ga0495651_0024496
1024 Ga0495653_0000468
1025 Ga0495653_0002447
1026 Ga0495653_0054252
1027 Ga0495653_0176758
1028 Ga0495650_0020985
1029 Ga0495580_0009672
1030 Ga0495580_0017933
1031 Ga0495580_0018641
1032 Ga0495639_0002895
1033 Ga0495662_0004431
1034 Ga0495662_0019872
1035 Ga0495664_0003529
1036 Ga0495664_0016800
1037 Ga0495584_0094260
1038 Ga0495584_0106019
1039 Ga0495607_0088132
1040 Ga0495608_0002580
1041 Ga0495616_0053472
1042 Ga0495618_0007082
1043 Ga0495628_0009866
1044 Ga0495628_0017078
1045 Ga0495630_0032140
1046 Ga0495631_0012263
1047 Ga0495643_0103788
1048 Ga0495644_0056673
1049 Ga0495663_0057219
1050 Ga0495652_0002737
1051 Ga0495665_0005430
1052 Ga0495640_0009777
1053 Ga0495640_0094210
1054 Ga0495640_0129799
1055 Ga0495609_0012796
1056 Ga0495645_0024011
1057 Ga0495645_0029810
1058 Ga0495633_0033659
1059 Ga0495667_0002903
1060 Ga0495667_0007901
1061 Ga0495656_0029118
1062 Ga0495668_0000352
1063 Ga0495668_0050400
1064 Ga0495668_0118468
1065 Ga0495634_0025829
1066 Ga0495635_0002053
1067 Ga0495635_0119429
1068 Ga0495659_0055469
1069 Ga0495588_0021029
1070 Ga0495657_0005138
1071 Ga0495657_0103694
1072 Ga0495599_0000251
1073 Ga0495599_0010264
1074 Ga0495623_0048902
1075 Ga0495646_0018513
1076 Ga0495646_0035658
1077 Ga0495669_0076302
1078 Ga0495613_0003769
1079 Ga0495670_0002814
1080 Ga0495670_0139365
1081 Ga0495649_0018286
1082 Ga0495649_0122582
1083 Ga0495589_0101712
1084 Ga0495600_0032178
1085 Ga0495581_0003348
1086 Ga0495581_0013941
1087 Ga0495604_0000511
1088 Ga0495604_0001557
1089 Ga0495636_0012871
1090 Ga0495674_0009679
1091 Ga0495674_0016223
1092 Ga0495674_0116081
1093 Ga0495680_0003326
1094 Ga0495680_0157138
1095 Ga0495685_007653
1096 Ga0495681_0036311
1097 Ga0495681_0046652
1098 Ga0495684_0000544
1099 Ga0495684_0009486
1100 Ga0495686_0006550
1101 Ga0495593_0091930
1102 Ga0495602_0041879
1103 Ga0496100_0015496
1104 Ga0496100_0047462
1105 Ga0496101_0010791
1106 Ga0496101_0079335
1107 Ga0496101_0131838
1108 Ga0496102_0008212
1109 Ga0496102_0012060
1110 Ga0496102_0081701
1111 Ga0496102_0093759
1112 Ga0496102_0140191
1113 Ga0496102_0249419
1114 Ga0496103_0042143
1115 Ga0496103_0063315
1116 Ga0496104_0034492
1117 Ga0496104_0046877
1118 Ga0496104_0084583
1119 Ga0496104_0091297
1120 Ga0496104_0234167
1121 Ga0496105_0005681
1122 Ga0496105_0007824
1123 Ga0496105_0011947
1124 Ga0496105_0031739
1125 Ga0496105_0034016
1126 Ga0496105_0313606
1127 Ga0496106_0003027
1128 Ga0496106_0020822
1129 Ga0496106_0037833
1130 Ga0496106_0089753
1131 Ga0496106_0102410
1132 Ga0496106_0218094
1133 Ga0496106_0248862
1134 Ga0496107_0011534
1135 Ga0496107_0077544
1136 Ga0496107_0132489
1137 Ga0496107_0210015
1138 Ga0496108_0001527
1139 Ga0496108_0009943
1140 Ga0496108_0019430
1141 Ga0496108_0063471
1142 Ga0496108_0070293
1143 Ga0496109_0004173
1144 Ga0496109_0004800
1145 Ga0496109_0048283
1146 Ga0496110_0005816
1147 Ga0496110_0052361
1148 Ga0496110_0086889
1149 Ga0496110_0087845
1150 Ga0496110_0355166
1151 Ga0496111_0002373
1152 Ga0496111_0009602
1153 Ga0496111_0048145
1154 Ga0496111_0147165
1155 Ga0496111_0218028
1156 Ga0496112_0050780
1157 Ga0496112_0095169
1158 Ga0496112_0278100
1159 Ga0496112_0278295
1160 Ga0496112_0314579
1161 Ga0496113_0014888
1162 Ga0496113_0016751
1163 Ga0496113_0096766
1164 Ga0496113_0256966
1165 Ga0496114_0005796
1166 Ga0496114_0022378
1167 Ga0496114_0048353
1168 Ga0496114_0145351
1169 Ga0496114_0196345
1170 Ga0496114_0198062
1171 Ga0496114_0202853
1172 Ga0496115_0011698
1173 Ga0496115_0020885
1174 Ga0496115_0037729
1175 Ga0496115_0191308
1176 Ga0496119_0028888
1177 Ga0496120_0112654
1178 Ga0496121_0000641
1179 Ga0496122_0072644
1180 Ga0496122_0151965
1181 Ga0496123_0026625
1182 Ga0496125_0022398
1183 Ga0496126_0003501
1184 Ga0496126_0074594
1185 Ga0496126_0083778
1186 Ga0501032_0161038
1187 Ga0501033_0040303
1188 Ga0501036_0009713
1189 Ga0501037_0017637
1190 Ga0501038_0006814
1191 Ga0501039_0002106
1192 Ga0501040_0000143
1193 Ga0501041_0011718
1194 Ga0501048_0017693
1195 Ga0501068_0092182
1196 Ga0501069_0087729
1197 Ga0501071_0006645
1198 Ga0501072_0002351
1199 Ga0501075_0001968
1200 Ga0501076_0000559
1201 Ga0501077_0000359
1202 Ga0501079_0004519
1203 Ga0501081_0035781
1204 Ga0501035_0034311
1205 Ga0501045_0001083
1206 nmdc:mga00v17_21049_c1
1207 nmdc:mga00v17_8579_c1
1208 nmdc:mga06r32_8071_c1
1209 nmdc:mga0n895_26535_c1
1210 nmdc:mga0sz30_5596_c1
1211 Ga0495601_0027993
1212 Ga0500635_0000132
1213 Ga0495655_0001566
1214 Ga0495595_0003064
1215 Ga0500573_0100002
1216 Ga0500645_000640
1217 Ga0501084_0004988
1218 Ga0590075_016071
1219 Ga0501082_0009793
1220 Ga0530510_0000107
1221 2566991353
1222 2586063039
1223 2643785142
1224 2643876532
1225 2644113610
1226 2644178340
1227 2644229272
1228 2644383587
1229 2644487121
1230 2644523828
1231 2644609021
1232 2644667930
1233 2644679467
1234 2691515759
1235 2723640965
1236 2730228975
1237 2738693190
1238 2738705284
1239 2738892034
1240 2739237370
1241 2739323235
1242 2739334611
1243 2739367317
1244 2753037362
1245 2753325231
1246 2760622247
1247 2775657358
1248 2808828899
1249 2808850130
1250 2808874067
1251 2808893136
1252 2808896298
1253 2809194498
1254 2809587844
1255 2812319401
1256 2812349997
1257 2819426869
1258 2819692621
1259 2819728864
1260 2857742801
1261 2884764238
1262 2887447763
1263 2889302511
1264 2895660740
1265 2902842049
1266 2904501200
1267 2904541686
1268 2904769618
1269 2904773184
1270 2904779014
1271 2908813984
1272 2915770117
1273 2919037136
1274 2919394218
1275 2919395178
1276 2919422453
1277 2919435294
1278 2919446705
1279 2919526706
1280 2919543008
1281 2922556234
1282 2932430794
1283 2933419488
1284 2935410417
1285 2939602191
1286 2939675642
1287 2939748392
1288 2945917153
1289 2945922595
1290 2945941240
1291 2945960823
1292 2946037115
1293 2946060953
1294 2953998368
1295 2954711717
1296 2954740547
1297 2954759015
1298 2954759559
1299 2956941342
1300 2974305099
1301 3001120229
1302 8003316760
1303 8003321010
1304 8004022118
1305 8004025837
1306 8054108678
1307 8054612803
1308 8056580283

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

50

185

0.89

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

201

404

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vhw-assembly1.cif.gz_F crystal structure of holo l-alanine dehydrogenase from mycobacterium tuberculosis in the open and closed conformation 0.8484 11 375
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.8352 11 375
2vhx-assembly1.cif.gz_D crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.8341 11 375
2vhv-assembly1.cif.gz_A crystal structure of the d270a mutant of l-alanine dehydrogenase from mycobacterium tuberculosis in complex with nadh. 0.8317 11 375
2eez-assembly1.cif.gz_F crystal structure of alanine dehydrogenase from themus thermophilus 0.8211 12 375
ID Description Score Start End Superfamily
af_A0A1D6II59_3_109_3.50.50.80 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;Ubiquitin-activating enzyme E1, inactive adenylation domain, subdomain 1 0.8413 173 207 3.50.50.80
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8344 11 132 3.40.50.720
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8294 13 123 3.40.50.720
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8161 13 123 3.40.50.720
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7927 11 132 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0D5A6B5-F1-model_v4 deleted 0.9906 9 387
AF-A0A7V9UCZ4-F1-model_v4 Alanine dehydrogenase 0.99 9 344 GO:0000286
GO:0005886
GO:0006524
GO:0047126
AF-A0A1P8YPW9-F1-model_v4 Alanine dehydrogenase/PNT, N-terminal domain protein 0.9894 11 387 GO:0000286
GO:0005886
GO:0006524
GO:0047126
AF-A0A2R7YUR5-F1-model_v4 Alanine dehydrogenase 0.9866 3 387 GO:0000286
GO:0005886
GO:0006524
GO:0047126
AF-A0A6G3QEC0-F1-model_v4 Alanine dehydrogenase 0.9861 10 386 GO:0000286
GO:0005886
GO:0006524
GO:0047126

Map