F472878
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 654 | 396 | 1308 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300048921|Ga0496118_0043781|Ga0496118_0043781_1394_2662 |
| Length | 422 |
| Sequence | MTVRSEQSGPKHDPRDIPEAGHGTPRGLVGEPAHEVPGEPARPLLTLGVLGTSQKPDERRLPIHPAHLERIDVDLRERMIVESGYGQAFGMTDDRLAALVGKVLPRDELIERADVVLLPKPQAAELSGLRDGQVLWGWPHCVQDVDMTQQAIDRHLTLIAFEAMNHWSSDGRFALHVFHKNNEIAGYCSVLHALQLAGSTGDYGRRLNAIVIGFGATARGAVTALRAHGVHDVHVLTNRDVAAVGSPIHAARIVQLDHDDAAPHASHVLTEEGRVPLAPYLAEFDIVVNCTLQDTDAPQTYLHESDLGAFAPGSLVVDVSCDEGMGFSWARPTTFAEPTFEVGDHILYYAVDHSPSYLWNSATWEISDAVLPFLRSVMEGPDGWAADETVARAVEIREGVVQNPAITRFQHRAEEYPHAVAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 159 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 160 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 161 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 165 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 193 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 195 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 198 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 274 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 303 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 306 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 309 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 311 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 312 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 313 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 314 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 315 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 316 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 317 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 318 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 319 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 320 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 321 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 322 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 323 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 324 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 325 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 326 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 327 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 328 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 329 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 330 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 331 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 332 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 333 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 334 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 335 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 336 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 337 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 338 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 339 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 340 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 341 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 342 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 343 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 344 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 345 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 346 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 347 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 348 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 349 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 350 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 351 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 352 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 353 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 354 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 355 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 356 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 357 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 358 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 359 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 360 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 361 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 362 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 363 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 364 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 365 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 366 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 367 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 368 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 369 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 370 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 371 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 372 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 373 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 374 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 375 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 376 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 377 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 378 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 379 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 380 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 381 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 382 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 383 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 384 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 385 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 386 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 387 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 388 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 389 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 390 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 391 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 392 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 393 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 394 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 395 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 396 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.54 |
| Metatranscriptomes | 0 |
| Isolates | 13.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.82 |
| Nodule | 0.15 |
| Rhizoplane | 11.62 |
| Rhizosphere | 74.92 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496118_0043781 | 3300048921 | Bacteria | 3514 |
| 2 | JGI24737J22298_10029959 | 3300001990 | Bacteria | 1705 |
| 3 | JGI24744J21845_10004149 | 3300002077 | Bacteria | 2987 |
| 4 | JGI24744J21845_10009120 | 3300002077 | Bacteria | 2038 |
| 5 | JGI24034J26672_10004744 | 3300002239 | Bacteria | 1934 |
| 6 | JGI24742J22300_10003796 | 3300002244 | Bacteria | 2456 |
| 7 | JGI25164J39214_1000184 | 3300002772 | Bacteria | 55562 |
| 8 | JGI25165J46597_1000092 | 3300003214 | Bacteria | 165407 |
| 9 | Ga0055540_1009213 | 3300003792 | Bacteria | 3437 |
| 10 | Ga0055540_1011866 | 3300003792 | Bacteria | 2775 |
| 11 | Ga0070658_10014549 | 3300005327 | Bacteria | 6314 |
| 12 | Ga0070658_10020984 | 3300005327 | Bacteria | 5233 |
| 13 | Ga0070658_10044793 | 3300005327 | Bacteria | 3576 |
| 14 | Ga0070683_100004574 | 3300005329 | Bacteria | 11419 |
| 15 | Ga0070683_100054207 | 3300005329 | Bacteria | 3718 |
| 16 | Ga0070683_100173323 | 3300005329 | Bacteria | 2048 |
| 17 | Ga0070690_100034465 | 3300005330 | Bacteria | 3172 |
| 18 | Ga0070670_100246800 | 3300005331 | Bacteria | 1555 |
| 19 | Ga0070677_10005997 | 3300005333 | Bacteria | 4031 |
| 20 | Ga0068869_100036535 | 3300005334 | Bacteria | 3488 |
| 21 | Ga0068869_100096013 | 3300005334 | Bacteria | 2237 |
| 22 | Ga0070666_10003614 | 3300005335 | Bacteria | 9377 |
| 23 | Ga0070666_10081259 | 3300005335 | Bacteria | 2215 |
| 24 | Ga0070680_100045234 | 3300005336 | Bacteria | 3579 |
| 25 | Ga0070680_100222119 | 3300005336 | Bacteria | 1595 |
| 26 | Ga0070682_100023590 | 3300005337 | Bacteria | 3654 |
| 27 | Ga0070682_100061659 | 3300005337 | Bacteria | 2374 |
| 28 | Ga0070682_100193783 | 3300005337 | Bacteria | 1428 |
| 29 | Ga0068868_100092353 | 3300005338 | Bacteria | 2439 |
| 30 | Ga0070660_100019543 | 3300005339 | Bacteria | 4966 |
| 31 | Ga0070660_100179210 | 3300005339 | Bacteria | 1714 |
| 32 | Ga0070689_100013015 | 3300005340 | Bacteria | 6012 |
| 33 | Ga0070687_100096896 | 3300005343 | Bacteria | 1643 |
| 34 | Ga0070661_100030675 | 3300005344 | Bacteria | 3884 |
| 35 | Ga0070661_100031061 | 3300005344 | Bacteria | 3861 |
| 36 | Ga0070692_10007759 | 3300005345 | Bacteria | 4753 |
| 37 | Ga0070692_10037451 | 3300005345 | Bacteria | 2466 |
| 38 | Ga0070669_100009997 | 3300005353 | Bacteria | 6744 |
| 39 | Ga0070669_100083312 | 3300005353 | Bacteria | 2384 |
| 40 | Ga0070675_100002864 | 3300005354 | Bacteria | 12997 |
| 41 | Ga0070675_100111535 | 3300005354 | Bacteria | 2315 |
| 42 | Ga0070675_100202593 | 3300005354 | Bacteria | 1723 |
| 43 | Ga0070673_100051148 | 3300005364 | Bacteria | 3234 |
| 44 | Ga0070659_100029122 | 3300005366 | Bacteria | 4266 |
| 45 | Ga0070659_100077600 | 3300005366 | Bacteria | 2650 |
| 46 | Ga0070667_100174798 | 3300005367 | Bacteria | 1897 |
| 47 | Ga0070667_100383974 | 3300005367 | Bacteria | 1276 |
| 48 | Ga0070703_10024339 | 3300005406 | Bacteria | 1789 |
| 49 | Ga0070709_10071681 | 3300005434 | Bacteria | 2237 |
| 50 | Ga0070713_100304241 | 3300005436 | Bacteria | 1468 |
| 51 | Ga0070701_10015653 | 3300005438 | Bacteria | 3508 |
| 52 | Ga0070711_100127714 | 3300005439 | Bacteria | 1889 |
| 53 | Ga0070700_100016484 | 3300005441 | Bacteria | 4209 |
| 54 | Ga0070700_100025989 | 3300005441 | Bacteria | 3452 |
| 55 | Ga0070694_100072012 | 3300005444 | Bacteria | 2384 |
| 56 | Ga0070663_100040525 | 3300005455 | Bacteria | 3261 |
| 57 | Ga0070663_100163319 | 3300005455 | Bacteria | 1716 |
| 58 | Ga0070681_10035482 | 3300005458 | Bacteria | 5010 |
| 59 | Ga0070681_10250481 | 3300005458 | Bacteria | 1684 |
| 60 | Ga0070685_10082038 | 3300005466 | Bacteria | 1934 |
| 61 | Ga0070698_100176966 | 3300005471 | Bacteria | 2072 |
| 62 | Ga0070679_100001890 | 3300005530 | Bacteria | 18803 |
| 63 | Ga0070679_100050434 | 3300005530 | Bacteria | 4146 |
| 64 | Ga0070679_100130857 | 3300005530 | Bacteria | 2491 |
| 65 | Ga0070684_100010264 | 3300005535 | Bacteria | 7413 |
| 66 | Ga0070684_100054554 | 3300005535 | Bacteria | 3482 |
| 67 | Ga0068853_100022825 | 3300005539 | Bacteria | 5230 |
| 68 | Ga0068853_100106140 | 3300005539 | Bacteria | 2489 |
| 69 | Ga0068853_100281060 | 3300005539 | Bacteria | 1534 |
| 70 | Ga0070686_100165835 | 3300005544 | Bacteria | 1558 |
| 71 | Ga0070696_100033323 | 3300005546 | Bacteria | 3539 |
| 72 | Ga0070696_100249936 | 3300005546 | Bacteria | 1341 |
| 73 | Ga0070665_100029834 | 3300005548 | Bacteria | 5488 |
| 74 | Ga0070665_100234264 | 3300005548 | Bacteria | 1836 |
| 75 | Ga0068855_100144526 | 3300005563 | Bacteria | 2709 |
| 76 | Ga0070664_100079279 | 3300005564 | Bacteria | 2826 |
| 77 | Ga0070664_100138882 | 3300005564 | Bacteria | 2138 |
| 78 | Ga0068854_100029812 | 3300005578 | Bacteria | 3780 |
| 79 | Ga0068856_100071081 | 3300005614 | Bacteria | 3444 |
| 80 | Ga0070702_100000262 | 3300005615 | Bacteria | 17949 |
| 81 | Ga0068852_100141095 | 3300005616 | Bacteria | 2230 |
| 82 | Ga0068852_100338431 | 3300005616 | Bacteria | 1466 |
| 83 | Ga0068864_100024414 | 3300005618 | Bacteria | 5086 |
| 84 | Ga0068864_100261234 | 3300005618 | Bacteria | 1611 |
| 85 | Ga0068864_100276209 | 3300005618 | Bacteria | 1567 |
| 86 | Ga0068861_100041538 | 3300005719 | Bacteria | 3445 |
| 87 | Ga0068863_100238625 | 3300005841 | Bacteria | 1755 |
| 88 | Ga0068858_100063879 | 3300005842 | Bacteria | 3406 |
| 89 | Ga0068858_100351979 | 3300005842 | Bacteria | 1411 |
| 90 | Ga0075365_10083355 | 3300006038 | Bacteria | 2169 |
| 91 | Ga0075365_10117829 | 3300006038 | Bacteria | 1830 |
| 92 | Ga0075364_10010909 | 3300006051 | Bacteria | 5506 |
| 93 | Ga0075364_10027992 | 3300006051 | Bacteria | 3604 |
| 94 | Ga0075364_10196863 | 3300006051 | Bacteria | 1365 |
| 95 | Ga0075432_10000814 | 3300006058 | Bacteria | 9763 |
| 96 | Ga0070715_10047547 | 3300006163 | Bacteria | 1829 |
| 97 | Ga0070712_100019448 | 3300006175 | Bacteria | 4430 |
| 98 | Ga0075369_10001673 | 3300006186 | Bacteria | 7644 |
| 99 | Ga0075369_10027107 | 3300006186 | Bacteria | 2393 |
| 100 | Ga0097621_100075339 | 3300006237 | Bacteria | 2797 |
| 101 | Ga0068871_100177798 | 3300006358 | Bacteria | 1827 |
| 102 | Ga0075431_100000036 | 3300006847 | Bacteria | 68411 |
| 103 | Ga0075434_100012101 | 3300006871 | Bacteria | 8169 |
| 104 | Ga0068865_100008643 | 3300006881 | Bacteria | 6301 |
| 105 | Ga0099795_10027033 | 3300007788 | Bacteria | 1938 |
| 106 | Ga0105251_10024059 | 3300009011 | Bacteria | 3133 |
| 107 | Ga0105244_10004212 | 3300009036 | Bacteria | 9998 |
| 108 | Ga0105240_10357393 | 3300009093 | Bacteria | 1656 |
| 109 | Ga0111539_10247388 | 3300009094 | Bacteria | 2076 |
| 110 | Ga0111539_10274575 | 3300009094 | Bacteria | 1962 |
| 111 | Ga0105245_10287231 | 3300009098 | Bacteria | 1610 |
| 112 | Ga0105245_10323785 | 3300009098 | Bacteria | 1519 |
| 113 | Ga0105247_10019751 | 3300009101 | Bacteria | 4047 |
| 114 | Ga0114129_10202437 | 3300009147 | Bacteria | 2688 |
| 115 | Ga0114129_10351994 | 3300009147 | Bacteria | 1951 |
| 116 | Ga0105243_10002416 | 3300009148 | Bacteria | 15648 |
| 117 | Ga0105243_10027022 | 3300009148 | Bacteria | 4395 |
| 118 | Ga0105243_10062805 | 3300009148 | Bacteria | 2974 |
| 119 | Ga0105243_10086785 | 3300009148 | Bacteria | 2567 |
| 120 | Ga0105243_10144138 | 3300009148 | Bacteria | 2036 |
| 121 | Ga0105241_10030805 | 3300009174 | Bacteria | 4013 |
| 122 | Ga0105241_10036978 | 3300009174 | Bacteria | 3676 |
| 123 | Ga0105242_10145469 | 3300009176 | Bacteria | 2062 |
| 124 | Ga0105248_10149618 | 3300009177 | Bacteria | 2634 |
| 125 | Ga0105248_10160887 | 3300009177 | Bacteria | 2532 |
| 126 | Ga0105248_10190953 | 3300009177 | Bacteria | 2308 |
| 127 | Ga0105237_10235735 | 3300009545 | Bacteria | 1831 |
| 128 | Ga0105237_10388560 | 3300009545 | Bacteria | 1400 |
| 129 | Ga0105238_10140877 | 3300009551 | Bacteria | 2388 |
| 130 | Ga0105238_10320832 | 3300009551 | Bacteria | 1535 |
| 131 | Ga0105239_10111986 | 3300010375 | Bacteria | 3026 |
| 132 | Ga0105239_10383798 | 3300010375 | Bacteria | 1588 |
| 133 | Ga0105246_10004322 | 3300011119 | Bacteria | 8640 |
| 134 | Ga0105246_10162559 | 3300011119 | Bacteria | 1702 |
| 135 | Ga0105246_10268468 | 3300011119 | Bacteria | 1363 |
| 136 | Ga0157373_10179082 | 3300013100 | Bacteria | 1492 |
| 137 | Ga0157371_10087997 | 3300013102 | Bacteria | 2199 |
| 138 | Ga0157370_10002881 | 3300013104 | Bacteria | 20492 |
| 139 | Ga0157370_10076701 | 3300013104 | Bacteria | 3148 |
| 140 | Ga0157370_10357205 | 3300013104 | Bacteria | 1346 |
| 141 | Ga0157369_10006908 | 3300013105 | Bacteria | 13099 |
| 142 | Ga0157369_10011101 | 3300013105 | Bacteria | 10248 |
| 143 | Ga0157374_10071045 | 3300013296 | Bacteria | 3281 |
| 144 | Ga0157374_10111925 | 3300013296 | Bacteria | 2627 |
| 145 | Ga0157374_10155576 | 3300013296 | Bacteria | 2225 |
| 146 | Ga0157374_10334108 | 3300013296 | Bacteria | 1503 |
| 147 | Ga0157378_10099207 | 3300013297 | Bacteria | 2657 |
| 148 | Ga0157378_10346208 | 3300013297 | Bacteria | 1451 |
| 149 | Ga0163162_10113745 | 3300013306 | Bacteria | 2805 |
| 150 | Ga0163162_10263497 | 3300013306 | Bacteria | 1855 |
| 151 | Ga0157372_10132844 | 3300013307 | Bacteria | 2865 |
| 152 | Ga0157372_10162283 | 3300013307 | Bacteria | 2583 |
| 153 | Ga0157372_10412314 | 3300013307 | Bacteria | 1574 |
| 154 | Ga0157375_10241325 | 3300013308 | Bacteria | 1967 |
| 155 | Ga0157375_10388057 | 3300013308 | Bacteria | 1563 |
| 156 | Ga0163163_10329322 | 3300014325 | Bacteria | 1581 |
| 157 | Ga0157377_10048414 | 3300014745 | Bacteria | 2385 |
| 158 | Ga0157377_10165445 | 3300014745 | Bacteria | 1379 |
| 159 | Ga0157379_10052288 | 3300014968 | Bacteria | 3649 |
| 160 | Ga0157379_10148033 | 3300014968 | Bacteria | 2118 |
| 161 | Ga0157376_10145857 | 3300014969 | Bacteria | 2129 |
| 162 | Ga0157376_10345923 | 3300014969 | Bacteria | 1421 |
| 163 | Ga0163161_10060029 | 3300017792 | Bacteria | 2767 |
| 164 | Ga0163161_10111262 | 3300017792 | Bacteria | 2047 |
| 165 | Ga0207427_100041 | 3300025231 | Bacteria | 263659 |
| 166 | Ga0209437_100371 | 3300025233 | Bacteria | 46718 |
| 167 | Ga0209148_1003704 | 3300025254 | Bacteria | 4045 |
| 168 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 169 | Ga0209673_1028423 | 3300025273 | Bacteria | 1800 |
| 170 | Ga0209051_1001791 | 3300025303 | Bacteria | 17057 |
| 171 | Ga0209051_1006529 | 3300025303 | Bacteria | 6552 |
| 172 | Ga0209051_1010880 | 3300025303 | Bacteria | 4546 |
| 173 | Ga0207697_10000015 | 3300025315 | Bacteria | 59450 |
| 174 | Ga0207655_1002155 | 3300025728 | Bacteria | 16405 |
| 175 | Ga0207655_1003325 | 3300025728 | Bacteria | 12048 |
| 176 | Ga0207682_10008880 | 3300025893 | Bacteria | 3975 |
| 177 | Ga0207642_10008581 | 3300025899 | Bacteria | 3514 |
| 178 | Ga0207688_10002220 | 3300025901 | Bacteria | 10459 |
| 179 | Ga0207680_10043144 | 3300025903 | Bacteria | 2643 |
| 180 | Ga0207685_10014083 | 3300025905 | Bacteria | 2494 |
| 181 | Ga0207645_10002039 | 3300025907 | Bacteria | 16218 |
| 182 | Ga0207645_10032519 | 3300025907 | Bacteria | 3353 |
| 183 | Ga0207643_10089321 | 3300025908 | Bacteria | 1794 |
| 184 | Ga0207705_10020037 | 3300025909 | Bacteria | 4782 |
| 185 | Ga0207705_10046090 | 3300025909 | Bacteria | 3132 |
| 186 | Ga0207654_10026985 | 3300025911 | Bacteria | 3117 |
| 187 | Ga0207707_10037498 | 3300025912 | Bacteria | 4236 |
| 188 | Ga0207693_10012464 | 3300025915 | Bacteria | 6868 |
| 189 | Ga0207663_10051214 | 3300025916 | Bacteria | 2570 |
| 190 | Ga0207660_10259941 | 3300025917 | Bacteria | 1373 |
| 191 | Ga0207662_10005556 | 3300025918 | Bacteria | 6735 |
| 192 | Ga0207657_10022118 | 3300025919 | Bacteria | 5966 |
| 193 | Ga0207657_10170195 | 3300025919 | Bacteria | 1765 |
| 194 | Ga0207649_10036555 | 3300025920 | Bacteria | 2959 |
| 195 | Ga0207652_10002331 | 3300025921 | Bacteria | 16081 |
| 196 | Ga0207652_10141661 | 3300025921 | Bacteria | 2150 |
| 197 | Ga0207681_10103436 | 3300025923 | Bacteria | 2058 |
| 198 | Ga0207681_10178505 | 3300025923 | Bacteria | 1615 |
| 199 | Ga0207694_10111874 | 3300025924 | Bacteria | 2173 |
| 200 | Ga0207650_10005566 | 3300025925 | Bacteria | 8599 |
| 201 | Ga0207687_10014898 | 3300025927 | Bacteria | 5093 |
| 202 | Ga0207687_10023526 | 3300025927 | Bacteria | 4108 |
| 203 | Ga0207687_10024839 | 3300025927 | Bacteria | 4006 |
| 204 | Ga0207644_10231967 | 3300025931 | Bacteria | 1467 |
| 205 | Ga0207690_10032441 | 3300025932 | Bacteria | 3351 |
| 206 | Ga0207706_10056755 | 3300025933 | Bacteria | 3452 |
| 207 | Ga0207686_10082337 | 3300025934 | Bacteria | 2103 |
| 208 | Ga0207686_10082479 | 3300025934 | Bacteria | 2102 |
| 209 | Ga0207686_10201995 | 3300025934 | Bacteria | 1424 |
| 210 | Ga0207709_10010585 | 3300025935 | Bacteria | 5081 |
| 211 | Ga0207709_10014858 | 3300025935 | Bacteria | 4307 |
| 212 | Ga0207709_10117828 | 3300025935 | Bacteria | 1788 |
| 213 | Ga0207670_10001198 | 3300025936 | Bacteria | 13719 |
| 214 | Ga0207669_10045222 | 3300025937 | Bacteria | 2592 |
| 215 | Ga0207704_10003999 | 3300025938 | Bacteria | 6711 |
| 216 | Ga0207704_10018401 | 3300025938 | Bacteria | 3646 |
| 217 | Ga0207665_10037187 | 3300025939 | Bacteria | 3240 |
| 218 | Ga0207665_10039867 | 3300025939 | Bacteria | 3132 |
| 219 | Ga0207691_10000240 | 3300025940 | Bacteria | 53770 |
| 220 | Ga0207689_10054876 | 3300025942 | Bacteria | 3280 |
| 221 | Ga0207661_10005846 | 3300025944 | Bacteria | 8679 |
| 222 | Ga0207661_10019363 | 3300025944 | Bacteria | 5073 |
| 223 | Ga0207661_10094913 | 3300025944 | Bacteria | 2492 |
| 224 | Ga0207661_10221192 | 3300025944 | Bacteria | 1673 |
| 225 | Ga0207679_10080753 | 3300025945 | Bacteria | 2484 |
| 226 | Ga0207667_10145849 | 3300025949 | Bacteria | 2437 |
| 227 | Ga0207640_10052317 | 3300025981 | Bacteria | 2659 |
| 228 | Ga0207658_10091963 | 3300025986 | Bacteria | 2355 |
| 229 | Ga0207677_10021987 | 3300026023 | Bacteria | 3911 |
| 230 | Ga0207677_10047229 | 3300026023 | Bacteria | 2889 |
| 231 | Ga0207677_10052857 | 3300026023 | Bacteria | 2762 |
| 232 | Ga0207639_10039349 | 3300026041 | Bacteria | 3523 |
| 233 | Ga0207678_10053617 | 3300026067 | Bacteria | 3475 |
| 234 | Ga0207708_10012736 | 3300026075 | Bacteria | 6272 |
| 235 | Ga0207708_10048753 | 3300026075 | Bacteria | 3225 |
| 236 | Ga0207702_10112179 | 3300026078 | Bacteria | 2426 |
| 237 | Ga0207641_10309730 | 3300026088 | Bacteria | 1494 |
| 238 | Ga0207641_10424595 | 3300026088 | Bacteria | 1281 |
| 239 | Ga0207648_10040858 | 3300026089 | Bacteria | 4074 |
| 240 | Ga0207648_10102360 | 3300026089 | Bacteria | 2510 |
| 241 | Ga0207676_10132687 | 3300026095 | Bacteria | 2120 |
| 242 | Ga0207676_10210877 | 3300026095 | Bacteria | 1723 |
| 243 | Ga0207674_10045551 | 3300026116 | Bacteria | 4511 |
| 244 | Ga0207675_100074528 | 3300026118 | Bacteria | 3176 |
| 245 | Ga0207683_10013671 | 3300026121 | Bacteria | 6923 |
| 246 | Ga0207683_10052127 | 3300026121 | Bacteria | 3585 |
| 247 | Ga0207683_10054230 | 3300026121 | Bacteria | 3515 |
| 248 | Ga0207698_10123561 | 3300026142 | Bacteria | 2196 |
| 249 | Ga0207698_10182174 | 3300026142 | Bacteria | 1862 |
| 250 | Ga0207428_10006626 | 3300027907 | Bacteria | 10650 |
| 251 | Ga0268266_10076974 | 3300028379 | Bacteria | 2900 |
| 252 | Ga0268266_10155009 | 3300028379 | Bacteria | 2068 |
| 253 | Ga0268265_10075776 | 3300028380 | Bacteria | 2636 |
| 254 | Ga0265338_10021640 | 3300028800 | Bacteria | 6695 |
| 255 | Ga0307512_10011601 | 3300030522 | Bacteria | 8343 |
| 256 | Ga0316177_1000403 | 3300030731 | Bacteria | 3088 |
| 257 | Ga0314311_1114875 | 3300030733 | Bacteria | 11645 |
| 258 | Ga0265327_10000018 | 3300031251 | Bacteria | 439197 |
| 259 | Ga0265327_10003464 | 3300031251 | Bacteria | 15020 |
| 260 | Ga0265316_10087215 | 3300031344 | Bacteria | 2385 |
| 261 | Ga0307408_100001088 | 3300031548 | Bacteria | 20782 |
| 262 | Ga0307408_100023078 | 3300031548 | Bacteria | 4234 |
| 263 | Ga0307408_100023675 | 3300031548 | Bacteria | 4186 |
| 264 | Ga0307408_100058454 | 3300031548 | Bacteria | 2803 |
| 265 | Ga0307408_100249367 | 3300031548 | Bacteria | 1463 |
| 266 | Ga0316575_10008468 | 3300031665 | Bacteria | 3748 |
| 267 | Ga0316579_10003003 | 3300031691 | Bacteria | 6484 |
| 268 | Ga0316576_10000437 | 3300031727 | Bacteria | 19400 |
| 269 | Ga0316576_10015278 | 3300031727 | Bacteria | 5149 |
| 270 | Ga0316576_10024649 | 3300031727 | Bacteria | 4201 |
| 271 | Ga0316578_10002858 | 3300031728 | Bacteria | 7725 |
| 272 | Ga0316578_10064850 | 3300031728 | Bacteria | 2156 |
| 273 | Ga0307405_10025293 | 3300031731 | Bacteria | 3405 |
| 274 | Ga0307405_10025357 | 3300031731 | Bacteria | 3402 |
| 275 | Ga0307405_10030495 | 3300031731 | Bacteria | 3162 |
| 276 | Ga0307405_10032420 | 3300031731 | Bacteria | 3088 |
| 277 | Ga0307405_10073512 | 3300031731 | Bacteria | 2207 |
| 278 | Ga0307405_10083008 | 3300031731 | Bacteria | 2099 |
| 279 | Ga0307405_10141661 | 3300031731 | Bacteria | 1677 |
| 280 | Ga0316577_10140192 | 3300031733 | Bacteria | 1362 |
| 281 | Ga0307413_10006151 | 3300031824 | Bacteria | 5449 |
| 282 | Ga0307413_10012845 | 3300031824 | Bacteria | 4183 |
| 283 | Ga0307518_10000341 | 3300031838 | Bacteria | 35232 |
| 284 | Ga0307518_10150399 | 3300031838 | Bacteria | 1611 |
| 285 | Ga0307410_10006495 | 3300031852 | Bacteria | 6314 |
| 286 | Ga0307410_10020051 | 3300031852 | Bacteria | 4081 |
| 287 | Ga0307410_10042055 | 3300031852 | Bacteria | 3018 |
| 288 | Ga0307410_10048407 | 3300031852 | Bacteria | 2847 |
| 289 | Ga0307410_10057820 | 3300031852 | Bacteria | 2642 |
| 290 | Ga0307410_10064891 | 3300031852 | Bacteria | 2510 |
| 291 | Ga0307410_10131465 | 3300031852 | Bacteria | 1839 |
| 292 | Ga0307406_10006959 | 3300031901 | Bacteria | 6267 |
| 293 | Ga0307406_10080352 | 3300031901 | Bacteria | 2165 |
| 294 | Ga0307407_10011064 | 3300031903 | Bacteria | 4280 |
| 295 | Ga0307407_10030894 | 3300031903 | Bacteria | 2895 |
| 296 | Ga0307407_10173160 | 3300031903 | Bacteria | 1424 |
| 297 | Ga0307412_10013526 | 3300031911 | Bacteria | 4787 |
| 298 | Ga0307412_10045554 | 3300031911 | Bacteria | 2868 |
| 299 | Ga0307412_10052859 | 3300031911 | Bacteria | 2691 |
| 300 | Ga0307412_10054605 | 3300031911 | Bacteria | 2652 |
| 301 | Ga0307412_10066898 | 3300031911 | Bacteria | 2437 |
| 302 | Ga0307412_10118261 | 3300031911 | Bacteria | 1903 |
| 303 | Ga0307412_10123356 | 3300031911 | Bacteria | 1869 |
| 304 | Ga0307409_100000781 | 3300031995 | Bacteria | 14433 |
| 305 | Ga0307409_100055427 | 3300031995 | Bacteria | 3060 |
| 306 | Ga0307409_100075834 | 3300031995 | Bacteria | 2694 |
| 307 | Ga0307409_100239630 | 3300031995 | Bacteria | 1650 |
| 308 | Ga0307409_100354295 | 3300031995 | Bacteria | 1386 |
| 309 | Ga0307416_100000543 | 3300032002 | Bacteria | 19195 |
| 310 | Ga0307416_100017917 | 3300032002 | Bacteria | 4973 |
| 311 | Ga0307416_100043615 | 3300032002 | Bacteria | 3513 |
| 312 | Ga0307416_100110740 | 3300032002 | Bacteria | 2418 |
| 313 | Ga0307416_100142516 | 3300032002 | Bacteria | 2181 |
| 314 | Ga0307416_100185952 | 3300032002 | Bacteria | 1953 |
| 315 | Ga0307416_100196778 | 3300032002 | Bacteria | 1907 |
| 316 | Ga0307416_100249312 | 3300032002 | Bacteria | 1727 |
| 317 | Ga0307414_10021779 | 3300032004 | Bacteria | 4032 |
| 318 | Ga0307414_10080265 | 3300032004 | Bacteria | 2385 |
| 319 | Ga0307414_10094826 | 3300032004 | Bacteria | 2228 |
| 320 | Ga0307411_10022376 | 3300032005 | Bacteria | 3720 |
| 321 | Ga0307411_10051145 | 3300032005 | Bacteria | 2694 |
| 322 | Ga0307415_100023738 | 3300032126 | Bacteria | 3815 |
| 323 | Ga0316583_10018696 | 3300032133 | Bacteria | 2489 |
| 324 | Ga0316574_0004264 | 3300035398 | Bacteria | 7471 |
| 325 | Ga0316574_0009948 | 3300035398 | Bacteria | 5350 |
| 326 | Ga0316574_0129401 | 3300035398 | Bacteria | 1624 |
| 327 | Ga0373927_0034118 | 3300035695 | Bacteria | 3311 |
| 328 | Ga0316582_0002622 | 3300036647 | Bacteria | 8521 |
| 329 | Ga0316582_0006271 | 3300036647 | Bacteria | 6227 |
| 330 | Ga0316584_0000284 | 3300036712 | Bacteria | 26011 |
| 331 | Ga0316584_0003768 | 3300036712 | Bacteria | 9934 |
| 332 | Ga0316584_0009761 | 3300036712 | Bacteria | 6678 |
| 333 | Ga0316584_0047280 | 3300036712 | Bacteria | 3214 |
| 334 | Ga0373925_0000546 | 3300037068 | Bacteria | 37027 |
| 335 | Ga0373925_0002151 | 3300037068 | Bacteria | 16104 |
| 336 | Ga0395899_0000961 | 3300037312 | Bacteria | 26769 |
| 337 | Ga0395899_0139776 | 3300037312 | Bacteria | 1724 |
| 338 | Ga0395900_0035139 | 3300037418 | Bacteria | 5163 |
| 339 | Ga0395900_0396630 | 3300037418 | Bacteria | 1345 |
| 340 | Ga0395898_0018287 | 3300037466 | Bacteria | 7146 |
| 341 | Ga0395898_0040972 | 3300037466 | Bacteria | 4576 |
| 342 | Ga0395898_0076363 | 3300037466 | Bacteria | 3235 |
| 343 | Ga0395905_0035449 | 3300037471 | Bacteria | 4685 |
| 344 | Ga0395905_0086590 | 3300037471 | Bacteria | 2937 |
| 345 | Ga0395901_0029361 | 3300038443 | Bacteria | 5661 |
| 346 | Ga0395901_0034876 | 3300038443 | Bacteria | 5197 |
| 347 | Ga0395901_0034950 | 3300038443 | Bacteria | 5192 |
| 348 | Ga0395901_0062107 | 3300038443 | Bacteria | 3888 |
| 349 | Ga0395901_0228988 | 3300038443 | Bacteria | 1941 |
| 350 | Ga0439466_0011638 | 3300041411 | Bacteria | 3251 |
| 351 | Ga0451793_0253740 | 3300041452 | Bacteria | 3976 |
| 352 | Ga0451793_1456744 | 3300041452 | Bacteria | 1473 |
| 353 | Ga0451797_0676945 | 3300041453 | Bacteria | 1655 |
| 354 | Ga0439442_003791 | 3300042002 | Bacteria | 2994 |
| 355 | Ga0439449_0005599 | 3300042007 | Bacteria | 4805 |
| 356 | Ga0439449_0033975 | 3300042007 | Bacteria | 1899 |
| 357 | Ga0439449_0050925 | 3300042007 | Bacteria | 1532 |
| 358 | Ga0439451_011154 | 3300042009 | Bacteria | 1813 |
| 359 | Ga0495617_050888 | 3300046452 | Bacteria | 1378 |
| 360 | Ga0495592_0019908 | 3300046454 | Bacteria | 5102 |
| 361 | Ga0495592_0021776 | 3300046454 | Bacteria | 4877 |
| 362 | Ga0495603_0020100 | 3300046455 | Bacteria | 4047 |
| 363 | Ga0495603_0042208 | 3300046455 | Bacteria | 2727 |
| 364 | Ga0495603_0103719 | 3300046455 | Bacteria | 1660 |
| 365 | Ga0495629_0024179 | 3300046459 | Bacteria | 4326 |
| 366 | Ga0495629_0030665 | 3300046459 | Bacteria | 3811 |
| 367 | Ga0495629_0043473 | 3300046459 | Bacteria | 3154 |
| 368 | Ga0495651_0000947 | 3300046462 | Bacteria | 22465 |
| 369 | Ga0495651_0024496 | 3300046462 | Bacteria | 4694 |
| 370 | Ga0495653_0000468 | 3300046463 | Bacteria | 31243 |
| 371 | Ga0495653_0002447 | 3300046463 | Bacteria | 14742 |
| 372 | Ga0495653_0054252 | 3300046463 | Bacteria | 3063 |
| 373 | Ga0495653_0176758 | 3300046463 | Bacteria | 1468 |
| 374 | Ga0495650_0020985 | 3300046471 | Bacteria | 3171 |
| 375 | Ga0495580_0009672 | 3300046472 | Bacteria | 7568 |
| 376 | Ga0495580_0017933 | 3300046472 | Bacteria | 5280 |
| 377 | Ga0495580_0018641 | 3300046472 | Bacteria | 5165 |
| 378 | Ga0495639_0002895 | 3300046475 | Bacteria | 7472 |
| 379 | Ga0495662_0004431 | 3300046476 | Bacteria | 7049 |
| 380 | Ga0495662_0019872 | 3300046476 | Bacteria | 3249 |
| 381 | Ga0495664_0003529 | 3300046477 | Bacteria | 8530 |
| 382 | Ga0495664_0016800 | 3300046477 | Bacteria | 4176 |
| 383 | Ga0495584_0094260 | 3300046491 | Bacteria | 1511 |
| 384 | Ga0495584_0106019 | 3300046491 | Bacteria | 1421 |
| 385 | Ga0495607_0088132 | 3300046501 | Bacteria | 1687 |
| 386 | Ga0495608_0002580 | 3300046511 | Bacteria | 13006 |
| 387 | Ga0495616_0053472 | 3300046513 | Bacteria | 2006 |
| 388 | Ga0495618_0007082 | 3300046514 | Bacteria | 6782 |
| 389 | Ga0495628_0009866 | 3300046516 | Bacteria | 8134 |
| 390 | Ga0495628_0017078 | 3300046516 | Bacteria | 6046 |
| 391 | Ga0495630_0032140 | 3300046517 | Bacteria | 3908 |
| 392 | Ga0495631_0012263 | 3300046518 | Bacteria | 4194 |
| 393 | Ga0495643_0103788 | 3300046522 | Bacteria | 1454 |
| 394 | Ga0495644_0056673 | 3300046523 | Bacteria | 1472 |
| 395 | Ga0495663_0057219 | 3300046525 | Bacteria | 1219 |
| 396 | Ga0495652_0002737 | 3300046529 | Bacteria | 17848 |
| 397 | Ga0495665_0005430 | 3300046531 | Bacteria | 6869 |
| 398 | Ga0495640_0009777 | 3300046533 | Bacteria | 7451 |
| 399 | Ga0495640_0094210 | 3300046533 | Bacteria | 1972 |
| 400 | Ga0495640_0129799 | 3300046533 | Bacteria | 1632 |
| 401 | Ga0495609_0012796 | 3300046538 | Bacteria | 3974 |
| 402 | Ga0495645_0024011 | 3300046543 | Bacteria | 4419 |
| 403 | Ga0495645_0029810 | 3300046543 | Bacteria | 3971 |
| 404 | Ga0495633_0033659 | 3300046558 | Bacteria | 2470 |
| 405 | Ga0495667_0002903 | 3300046559 | Bacteria | 11497 |
| 406 | Ga0495667_0007901 | 3300046559 | Bacteria | 7210 |
| 407 | Ga0495656_0029118 | 3300046615 | Bacteria | 2220 |
| 408 | Ga0495668_0000352 | 3300046616 | Bacteria | 61322 |
| 409 | Ga0495668_0050400 | 3300046616 | Bacteria | 2308 |
| 410 | Ga0495668_0118468 | 3300046616 | Bacteria | 1448 |
| 411 | Ga0495634_0025829 | 3300046642 | Bacteria | 4102 |
| 412 | Ga0495635_0002053 | 3300046663 | Bacteria | 13648 |
| 413 | Ga0495635_0119429 | 3300046663 | Bacteria | 1799 |
| 414 | Ga0495659_0055469 | 3300046664 | Bacteria | 1452 |
| 415 | Ga0495588_0021029 | 3300046674 | Bacteria | 3212 |
| 416 | Ga0495657_0005138 | 3300046675 | Bacteria | 10369 |
| 417 | Ga0495657_0103694 | 3300046675 | Bacteria | 1809 |
| 418 | Ga0495599_0000251 | 3300046678 | Bacteria | 33998 |
| 419 | Ga0495599_0010264 | 3300046678 | Bacteria | 5731 |
| 420 | Ga0495623_0048902 | 3300046679 | Bacteria | 2680 |
| 421 | Ga0495646_0018513 | 3300046680 | Bacteria | 4410 |
| 422 | Ga0495646_0035658 | 3300046680 | Bacteria | 3085 |
| 423 | Ga0495669_0076302 | 3300046684 | Bacteria | 1534 |
| 424 | Ga0495613_0003769 | 3300046689 | Bacteria | 11363 |
| 425 | Ga0495670_0002814 | 3300046691 | Bacteria | 8607 |
| 426 | Ga0495670_0139365 | 3300046691 | Bacteria | 1268 |
| 427 | Ga0495649_0018286 | 3300046694 | Bacteria | 3945 |
| 428 | Ga0495649_0122582 | 3300046694 | Bacteria | 1374 |
| 429 | Ga0495589_0101712 | 3300046794 | Bacteria | 1390 |
| 430 | Ga0495600_0032178 | 3300046809 | Bacteria | 3401 |
| 431 | Ga0495581_0003348 | 3300047315 | Bacteria | 9203 |
| 432 | Ga0495581_0013941 | 3300047315 | Bacteria | 4662 |
| 433 | Ga0495604_0000511 | 3300047317 | Bacteria | 34056 |
| 434 | Ga0495604_0001557 | 3300047317 | Bacteria | 18890 |
| 435 | Ga0495636_0012871 | 3300047318 | Bacteria | 3316 |
| 436 | Ga0495674_0009679 | 3300047319 | Bacteria | 9149 |
| 437 | Ga0495674_0016223 | 3300047319 | Bacteria | 6948 |
| 438 | Ga0495674_0116081 | 3300047319 | Bacteria | 2265 |
| 439 | Ga0495680_0003326 | 3300047322 | Bacteria | 15903 |
| 440 | Ga0495680_0157138 | 3300047322 | Bacteria | 1653 |
| 441 | Ga0495685_007653 | 3300047447 | Bacteria | 3572 |
| 442 | Ga0495681_0036311 | 3300047470 | Bacteria | 2438 |
| 443 | Ga0495681_0046652 | 3300047470 | Bacteria | 2065 |
| 444 | Ga0495684_0000544 | 3300047471 | Bacteria | 30546 |
| 445 | Ga0495684_0009486 | 3300047471 | Bacteria | 7507 |
| 446 | Ga0495686_0006550 | 3300047472 | Bacteria | 8888 |
| 447 | Ga0495593_0091930 | 3300047673 | Bacteria | 1562 |
| 448 | Ga0495602_0041879 | 3300048088 | Bacteria | 4177 |
| 449 | Ga0496100_0015496 | 3300048903 | Bacteria | 4454 |
| 450 | Ga0496100_0047462 | 3300048903 | Bacteria | 2767 |
| 451 | Ga0496101_0010791 | 3300048904 | Bacteria | 6044 |
| 452 | Ga0496101_0079335 | 3300048904 | Bacteria | 2423 |
| 453 | Ga0496101_0131838 | 3300048904 | Bacteria | 1898 |
| 454 | Ga0496102_0008212 | 3300048905 | Bacteria | 8937 |
| 455 | Ga0496102_0012060 | 3300048905 | Bacteria | 7468 |
| 456 | Ga0496102_0081701 | 3300048905 | Bacteria | 2979 |
| 457 | Ga0496102_0093759 | 3300048905 | Bacteria | 2781 |
| 458 | Ga0496102_0140191 | 3300048905 | Bacteria | 2267 |
| 459 | Ga0496102_0249419 | 3300048905 | Bacteria | 1674 |
| 460 | Ga0496103_0042143 | 3300048906 | Bacteria | 2807 |
| 461 | Ga0496103_0063315 | 3300048906 | Bacteria | 2304 |
| 462 | Ga0496104_0034492 | 3300048907 | Bacteria | 4719 |
| 463 | Ga0496104_0046877 | 3300048907 | Bacteria | 4072 |
| 464 | Ga0496104_0084583 | 3300048907 | Bacteria | 3027 |
| 465 | Ga0496104_0091297 | 3300048907 | Bacteria | 2911 |
| 466 | Ga0496104_0234167 | 3300048907 | Bacteria | 1748 |
| 467 | Ga0496105_0005681 | 3300048908 | Bacteria | 9493 |
| 468 | Ga0496105_0007824 | 3300048908 | Bacteria | 8295 |
| 469 | Ga0496105_0011947 | 3300048908 | Bacteria | 6875 |
| 470 | Ga0496105_0031739 | 3300048908 | Bacteria | 4331 |
| 471 | Ga0496105_0034016 | 3300048908 | Bacteria | 4190 |
| 472 | Ga0496105_0313606 | 3300048908 | Bacteria | 1258 |
| 473 | Ga0496106_0003027 | 3300048909 | Bacteria | 12523 |
| 474 | Ga0496106_0020822 | 3300048909 | Bacteria | 4866 |
| 475 | Ga0496106_0037833 | 3300048909 | Bacteria | 3610 |
| 476 | Ga0496106_0089753 | 3300048909 | Bacteria | 2370 |
| 477 | Ga0496106_0102410 | 3300048909 | Bacteria | 2221 |
| 478 | Ga0496106_0218094 | 3300048909 | Bacteria | 1521 |
| 479 | Ga0496106_0248862 | 3300048909 | Bacteria | 1421 |
| 480 | Ga0496107_0011534 | 3300048910 | Bacteria | 6157 |
| 481 | Ga0496107_0077544 | 3300048910 | Bacteria | 2421 |
| 482 | Ga0496107_0132489 | 3300048910 | Bacteria | 1840 |
| 483 | Ga0496107_0210015 | 3300048910 | Bacteria | 1447 |
| 484 | Ga0496108_0001527 | 3300048911 | Bacteria | 18318 |
| 485 | Ga0496108_0009943 | 3300048911 | Bacteria | 7713 |
| 486 | Ga0496108_0019430 | 3300048911 | Bacteria | 5580 |
| 487 | Ga0496108_0063471 | 3300048911 | Bacteria | 3110 |
| 488 | Ga0496108_0070293 | 3300048911 | Bacteria | 2954 |
| 489 | Ga0496109_0004173 | 3300048912 | Bacteria | 12057 |
| 490 | Ga0496109_0004800 | 3300048912 | Bacteria | 11285 |
| 491 | Ga0496109_0048283 | 3300048912 | Bacteria | 3873 |
| 492 | Ga0496110_0005816 | 3300048913 | Bacteria | 9691 |
| 493 | Ga0496110_0052361 | 3300048913 | Bacteria | 3587 |
| 494 | Ga0496110_0086889 | 3300048913 | Bacteria | 2792 |
| 495 | Ga0496110_0087845 | 3300048913 | Bacteria | 2776 |
| 496 | Ga0496110_0355166 | 3300048913 | Bacteria | 1335 |
| 497 | Ga0496111_0002373 | 3300048914 | Bacteria | 11345 |
| 498 | Ga0496111_0009602 | 3300048914 | Bacteria | 6463 |
| 499 | Ga0496111_0048145 | 3300048914 | Bacteria | 3071 |
| 500 | Ga0496111_0147165 | 3300048914 | Bacteria | 1746 |
| 501 | Ga0496111_0218028 | 3300048914 | Bacteria | 1417 |
| 502 | Ga0496112_0050780 | 3300048915 | Bacteria | 4067 |
| 503 | Ga0496112_0095169 | 3300048915 | Bacteria | 2949 |
| 504 | Ga0496112_0278100 | 3300048915 | Bacteria | 1622 |
| 505 | Ga0496112_0278295 | 3300048915 | Bacteria | 1621 |
| 506 | Ga0496112_0314579 | 3300048915 | Bacteria | 1511 |
| 507 | Ga0496113_0014888 | 3300048916 | Bacteria | 5323 |
| 508 | Ga0496113_0016751 | 3300048916 | Bacteria | 5069 |
| 509 | Ga0496113_0096766 | 3300048916 | Bacteria | 2283 |
| 510 | Ga0496113_0256966 | 3300048916 | Bacteria | 1395 |
| 511 | Ga0496114_0005796 | 3300048917 | Bacteria | 9701 |
| 512 | Ga0496114_0022378 | 3300048917 | Bacteria | 5151 |
| 513 | Ga0496114_0048353 | 3300048917 | Bacteria | 3538 |
| 514 | Ga0496114_0145351 | 3300048917 | Bacteria | 2055 |
| 515 | Ga0496114_0196345 | 3300048917 | Bacteria | 1766 |
| 516 | Ga0496114_0198062 | 3300048917 | Bacteria | 1758 |
| 517 | Ga0496114_0202853 | 3300048917 | Bacteria | 1737 |
| 518 | Ga0496115_0011698 | 3300048918 | Bacteria | 6588 |
| 519 | Ga0496115_0020885 | 3300048918 | Bacteria | 5054 |
| 520 | Ga0496115_0037729 | 3300048918 | Bacteria | 3830 |
| 521 | Ga0496115_0191308 | 3300048918 | Bacteria | 1691 |
| 522 | Ga0496119_0028888 | 3300048922 | Bacteria | 3774 |
| 523 | Ga0496120_0112654 | 3300048923 | Bacteria | 1419 |
| 524 | Ga0496121_0000641 | 3300048924 | Bacteria | 65258 |
| 525 | Ga0496122_0072644 | 3300048925 | Bacteria | 2445 |
| 526 | Ga0496122_0151965 | 3300048925 | Bacteria | 1428 |
| 527 | Ga0496123_0026625 | 3300048926 | Bacteria | 4327 |
| 528 | Ga0496125_0022398 | 3300048928 | Bacteria | 5867 |
| 529 | Ga0496126_0003501 | 3300048929 | Bacteria | 19807 |
| 530 | Ga0496126_0074594 | 3300048929 | Bacteria | 3012 |
| 531 | Ga0496126_0083778 | 3300048929 | Bacteria | 2814 |
| 532 | Ga0501032_0161038 | 3300049569 | Bacteria | 1474 |
| 533 | Ga0501033_0040303 | 3300049570 | Bacteria | 3487 |
| 534 | Ga0501036_0009713 | 3300049572 | Bacteria | 7921 |
| 535 | Ga0501037_0017637 | 3300049573 | Bacteria | 5256 |
| 536 | Ga0501038_0006814 | 3300049574 | Bacteria | 10555 |
| 537 | Ga0501039_0002106 | 3300049575 | Bacteria | 14735 |
| 538 | Ga0501040_0000143 | 3300049576 | Bacteria | 38640 |
| 539 | Ga0501041_0011718 | 3300049577 | Bacteria | 5189 |
| 540 | Ga0501048_0017693 | 3300049582 | Bacteria | 5246 |
| 541 | Ga0501068_0092182 | 3300049584 | Bacteria | 1870 |
| 542 | Ga0501069_0087729 | 3300049585 | Bacteria | 1758 |
| 543 | Ga0501071_0006645 | 3300049587 | Bacteria | 7514 |
| 544 | Ga0501072_0002351 | 3300049588 | Bacteria | 14188 |
| 545 | Ga0501075_0001968 | 3300049591 | Bacteria | 13554 |
| 546 | Ga0501076_0000559 | 3300049592 | Bacteria | 23721 |
| 547 | Ga0501077_0000359 | 3300049593 | Bacteria | 27065 |
| 548 | Ga0501079_0004519 | 3300049741 | Bacteria | 10318 |
| 549 | Ga0501081_0035781 | 3300049743 | Bacteria | 3381 |
| 550 | Ga0501035_0034311 | 3300049822 | Bacteria | 4611 |
| 551 | Ga0501045_0001083 | 3300049824 | Bacteria | 17991 |
| 552 | nmdc:mga00v17_21049_c1 | 3300050491 | Bacteria | 3745 |
| 553 | nmdc:mga00v17_8579_c1 | 3300050491 | Bacteria | 5503 |
| 554 | nmdc:mga06r32_8071_c1 | 3300050510 | Bacteria | 9472 |
| 555 | nmdc:mga0n895_26535_c1 | 3300050512 | Bacteria | 5488 |
| 556 | nmdc:mga0sz30_5596_c1 | 3300050516 | Bacteria | 4616 |
| 557 | Ga0495601_0027993 | 3300053077 | Bacteria | 3488 |
| 558 | Ga0500635_0000132 | 3300053080 | Bacteria | 43287 |
| 559 | Ga0495655_0001566 | 3300053083 | Bacteria | 3523 |
| 560 | Ga0495595_0003064 | 3300053084 | Bacteria | 6612 |
| 561 | Ga0500573_0100002 | 3300053140 | Bacteria | 1633 |
| 562 | Ga0500645_000640 | 3300053730 | Bacteria | 22258 |
| 563 | Ga0501084_0004988 | 3300054114 | Bacteria | 10859 |
| 564 | Ga0590075_016071 | 3300059424 | Bacteria | 1840 |
| 565 | Ga0501082_0009793 | 3300060353 | Bacteria | 8257 |
| 566 | Ga0530510_0000107 | 3300061734 | Bacteria | 45987 |
| 567 | 2566991353 | 2565956761 | Bacteria | 6601618 |
| 568 | 2586063039 | 2585427649 | Bacteria | 9053857 |
| 569 | 2643785142 | 2643221553 | Bacteria | 3544260 |
| 570 | 2643876532 | 2643221572 | Bacteria | 3614809 |
| 571 | 2644113610 | 2643221619 | Bacteria | 4158469 |
| 572 | 2644178340 | 2643221631 | Bacteria | 8168043 |
| 573 | 2644229272 | 2643221641 | Bacteria | 4490190 |
| 574 | 2644383587 | 2643221669 | Bacteria | 3611286 |
| 575 | 2644487121 | 2643221687 | Bacteria | 6500351 |
| 576 | 2644523828 | 2643221694 | Bacteria | 4392972 |
| 577 | 2644609021 | 2643221711 | Bacteria | 4865335 |
| 578 | 2644667930 | 2643221722 | Bacteria | 4247614 |
| 579 | 2644679467 | 2643221724 | Bacteria | 3593515 |
| 580 | 2691515759 | 2690315906 | Bacteria | 4517044 |
| 581 | 2723640965 | 2721755702 | Bacteria | 4373124 |
| 582 | 2730228975 | 2728369380 | Bacteria | 3620317 |
| 583 | 2738693190 | 2738541272 | Bacteria | 6848551 |
| 584 | 2738705284 | 2738541274 | Bacteria | 6909446 |
| 585 | 2738892034 | 2738541308 | Bacteria | 7020677 |
| 586 | 2739237370 | 2738543011 | Bacteria | 5731169 |
| 587 | 2739323235 | 2738543027 | Bacteria | 6409078 |
| 588 | 2739334611 | 2738543028 | Bacteria | 6917070 |
| 589 | 2739367317 | 2738543034 | Bacteria | 6084756 |
| 590 | 2753037362 | 2751185725 | Bacteria | 5740550 |
| 591 | 2753325231 | 2751185792 | Bacteria | 5739090 |
| 592 | 2760622247 | 2758568621 | Bacteria | 5967089 |
| 593 | 2775657358 | 2775506735 | Bacteria | 4556596 |
| 594 | 2808828899 | 2808606357 | Bacteria | 4466944 |
| 595 | 2808850130 | 2808606360 | Bacteria | 4404006 |
| 596 | 2808874067 | 2808606365 | Bacteria | 4301966 |
| 597 | 2808893136 | 2808606370 | Bacteria | 4942454 |
| 598 | 2808896298 | 2808606371 | Bacteria | 4251511 |
| 599 | 2809194498 | 2808606439 | Bacteria | 5952208 |
| 600 | 2809587844 | 2808606522 | Bacteria | 9488490 |
| 601 | 2812319401 | 2811994871 | Bacteria | 4497550 |
| 602 | 2812349997 | 2811994878 | Bacteria | 5992952 |
| 603 | 2819426869 | 2818991318 | Bacteria | 5266538 |
| 604 | 2819692621 | 2818991462 | Bacteria | 4320267 |
| 605 | 2819728864 | 2818991469 | Bacteria | 4644110 |
| 606 | 2857742801 | 2857740372 | Bacteria | 4782044 |
| 607 | 2884764238 | 2884763398 | Bacteria | 4091164 |
| 608 | 2887447763 | 2887443736 | Bacteria | 4426037 |
| 609 | 2889302511 | 2889300758 | Bacteria | 5690814 |
| 610 | 2895660740 | 2895660088 | Bacteria | 3782833 |
| 611 | 2902842049 | 2902837492 | Bacteria | 6697721 |
| 612 | 2904501200 | 2904497146 | Bacteria | 4731781 |
| 613 | 2904541686 | 2904535858 | Bacteria | 6308016 |
| 614 | 2904769618 | 2904765812 | Bacteria | 5369154 |
| 615 | 2904773184 | 2904770941 | Bacteria | 5580202 |
| 616 | 2904779014 | 2904776348 | Bacteria | 4658726 |
| 617 | 2908813984 | 2908811453 | Bacteria | 5478616 |
| 618 | 2915770117 | 2915768154 | Bacteria | 8424322 |
| 619 | 2919037136 | 2919034639 | Bacteria | 4763403 |
| 620 | 2919394218 | 2919391150 | Bacteria | 4884741 |
| 621 | 2919395178 | 2919391150 | Bacteria | 4884741 |
| 622 | 2919422453 | 2919420072 | Bacteria | 5390363 |
| 623 | 2919435294 | 2919432681 | Bacteria | 5390474 |
| 624 | 2919446705 | 2919443155 | Bacteria | 4072969 |
| 625 | 2919526706 | 2919523602 | Bacteria | 3788128 |
| 626 | 2919543008 | 2919538618 | Bacteria | 4677069 |
| 627 | 2922556234 | 2922554459 | Bacteria | 6683962 |
| 628 | 2932430794 | 2932426870 | Bacteria | 4547726 |
| 629 | 2933419488 | 2933418574 | Bacteria | 4476724 |
| 630 | 2935410417 | 2935409751 | Bacteria | 4179611 |
| 631 | 2939602191 | 2939598168 | Bacteria | 4687164 |
| 632 | 2939675642 | 2939674588 | Bacteria | 4844420 |
| 633 | 2939748392 | 2939743619 | Bacteria | 5762299 |
| 634 | 2945917153 | 2945916053 | Bacteria | 4555517 |
| 635 | 2945922595 | 2945920336 | Bacteria | 4501603 |
| 636 | 2945941240 | 2945941187 | Bacteria | 4682474 |
| 637 | 2945960823 | 2945956166 | Bacteria | 5110334 |
| 638 | 2946037115 | 2946037020 | Bacteria | 4900426 |
| 639 | 2946060953 | 2946059875 | Bacteria | 4386623 |
| 640 | 2953998368 | 2953998280 | Bacteria | 4812144 |
| 641 | 2954711717 | 2954711539 | Bacteria | 10867210 |
| 642 | 2954740547 | 2954740390 | Bacteria | 10229294 |
| 643 | 2954759015 | 2954749733 | Bacteria | 10366972 |
| 644 | 2954759559 | 2954759201 | Bacteria | 9358192 |
| 645 | 2956941342 | 2956939328 | Bacteria | 3474458 |
| 646 | 2974305099 | 2974302888 | Bacteria | 4369871 |
| 647 | 3001120229 | 3001119090 | Bacteria | 3449530 |
| 648 | 8003316760 | 8003314358 | Bacteria | 10575343 |
| 649 | 8003321010 | 8003314358 | Bacteria | 10575343 |
| 650 | 8004022118 | 8004021418 | Bacteria | 4313954 |
| 651 | 8004025837 | 8004025490 | Bacteria | 4327753 |
| 652 | 8054108678 | 8054107350 | Bacteria | 5022511 |
| 653 | 8054612803 | 8054609563 | Bacteria | 5170090 |
| 654 | 8056580283 | 8056579771 | Bacteria | 5840325 |
| 655 | Ga0496118_0043781 | |||
| 656 | JGI24737J22298_10029959 | |||
| 657 | JGI24744J21845_10004149 | |||
| 658 | JGI24744J21845_10009120 | |||
| 659 | JGI24034J26672_10004744 | |||
| 660 | JGI24742J22300_10003796 | |||
| 661 | JGI25164J39214_1000184 | |||
| 662 | JGI25165J46597_1000092 | |||
| 663 | Ga0055540_1009213 | |||
| 664 | Ga0055540_1011866 | |||
| 665 | Ga0070658_10014549 | |||
| 666 | Ga0070658_10020984 | |||
| 667 | Ga0070658_10044793 | |||
| 668 | Ga0070683_100004574 | |||
| 669 | Ga0070683_100054207 | |||
| 670 | Ga0070683_100173323 | |||
| 671 | Ga0070690_100034465 | |||
| 672 | Ga0070670_100246800 | |||
| 673 | Ga0070677_10005997 | |||
| 674 | Ga0068869_100036535 | |||
| 675 | Ga0068869_100096013 | |||
| 676 | Ga0070666_10003614 | |||
| 677 | Ga0070666_10081259 | |||
| 678 | Ga0070680_100045234 | |||
| 679 | Ga0070680_100222119 | |||
| 680 | Ga0070682_100023590 | |||
| 681 | Ga0070682_100061659 | |||
| 682 | Ga0070682_100193783 | |||
| 683 | Ga0068868_100092353 | |||
| 684 | Ga0070660_100019543 | |||
| 685 | Ga0070660_100179210 | |||
| 686 | Ga0070689_100013015 | |||
| 687 | Ga0070687_100096896 | |||
| 688 | Ga0070661_100030675 | |||
| 689 | Ga0070661_100031061 | |||
| 690 | Ga0070692_10007759 | |||
| 691 | Ga0070692_10037451 | |||
| 692 | Ga0070669_100009997 | |||
| 693 | Ga0070669_100083312 | |||
| 694 | Ga0070675_100002864 | |||
| 695 | Ga0070675_100111535 | |||
| 696 | Ga0070675_100202593 | |||
| 697 | Ga0070673_100051148 | |||
| 698 | Ga0070659_100029122 | |||
| 699 | Ga0070659_100077600 | |||
| 700 | Ga0070667_100174798 | |||
| 701 | Ga0070667_100383974 | |||
| 702 | Ga0070703_10024339 | |||
| 703 | Ga0070709_10071681 | |||
| 704 | Ga0070713_100304241 | |||
| 705 | Ga0070701_10015653 | |||
| 706 | Ga0070711_100127714 | |||
| 707 | Ga0070700_100016484 | |||
| 708 | Ga0070700_100025989 | |||
| 709 | Ga0070694_100072012 | |||
| 710 | Ga0070663_100040525 | |||
| 711 | Ga0070663_100163319 | |||
| 712 | Ga0070681_10035482 | |||
| 713 | Ga0070681_10250481 | |||
| 714 | Ga0070685_10082038 | |||
| 715 | Ga0070698_100176966 | |||
| 716 | Ga0070679_100001890 | |||
| 717 | Ga0070679_100050434 | |||
| 718 | Ga0070679_100130857 | |||
| 719 | Ga0070684_100010264 | |||
| 720 | Ga0070684_100054554 | |||
| 721 | Ga0068853_100022825 | |||
| 722 | Ga0068853_100106140 | |||
| 723 | Ga0068853_100281060 | |||
| 724 | Ga0070686_100165835 | |||
| 725 | Ga0070696_100033323 | |||
| 726 | Ga0070696_100249936 | |||
| 727 | Ga0070665_100029834 | |||
| 728 | Ga0070665_100234264 | |||
| 729 | Ga0068855_100144526 | |||
| 730 | Ga0070664_100079279 | |||
| 731 | Ga0070664_100138882 | |||
| 732 | Ga0068854_100029812 | |||
| 733 | Ga0068856_100071081 | |||
| 734 | Ga0070702_100000262 | |||
| 735 | Ga0068852_100141095 | |||
| 736 | Ga0068852_100338431 | |||
| 737 | Ga0068864_100024414 | |||
| 738 | Ga0068864_100261234 | |||
| 739 | Ga0068864_100276209 | |||
| 740 | Ga0068861_100041538 | |||
| 741 | Ga0068863_100238625 | |||
| 742 | Ga0068858_100063879 | |||
| 743 | Ga0068858_100351979 | |||
| 744 | Ga0075365_10083355 | |||
| 745 | Ga0075365_10117829 | |||
| 746 | Ga0075364_10010909 | |||
| 747 | Ga0075364_10027992 | |||
| 748 | Ga0075364_10196863 | |||
| 749 | Ga0075432_10000814 | |||
| 750 | Ga0070715_10047547 | |||
| 751 | Ga0070712_100019448 | |||
| 752 | Ga0075369_10001673 | |||
| 753 | Ga0075369_10027107 | |||
| 754 | Ga0097621_100075339 | |||
| 755 | Ga0068871_100177798 | |||
| 756 | Ga0075431_100000036 | |||
| 757 | Ga0075434_100012101 | |||
| 758 | Ga0068865_100008643 | |||
| 759 | Ga0099795_10027033 | |||
| 760 | Ga0105251_10024059 | |||
| 761 | Ga0105244_10004212 | |||
| 762 | Ga0105240_10357393 | |||
| 763 | Ga0111539_10247388 | |||
| 764 | Ga0111539_10274575 | |||
| 765 | Ga0105245_10287231 | |||
| 766 | Ga0105245_10323785 | |||
| 767 | Ga0105247_10019751 | |||
| 768 | Ga0114129_10202437 | |||
| 769 | Ga0114129_10351994 | |||
| 770 | Ga0105243_10002416 | |||
| 771 | Ga0105243_10027022 | |||
| 772 | Ga0105243_10062805 | |||
| 773 | Ga0105243_10086785 | |||
| 774 | Ga0105243_10144138 | |||
| 775 | Ga0105241_10030805 | |||
| 776 | Ga0105241_10036978 | |||
| 777 | Ga0105242_10145469 | |||
| 778 | Ga0105248_10149618 | |||
| 779 | Ga0105248_10160887 | |||
| 780 | Ga0105248_10190953 | |||
| 781 | Ga0105237_10235735 | |||
| 782 | Ga0105237_10388560 | |||
| 783 | Ga0105238_10140877 | |||
| 784 | Ga0105238_10320832 | |||
| 785 | Ga0105239_10111986 | |||
| 786 | Ga0105239_10383798 | |||
| 787 | Ga0105246_10004322 | |||
| 788 | Ga0105246_10162559 | |||
| 789 | Ga0105246_10268468 | |||
| 790 | Ga0157373_10179082 | |||
| 791 | Ga0157371_10087997 | |||
| 792 | Ga0157370_10002881 | |||
| 793 | Ga0157370_10076701 | |||
| 794 | Ga0157370_10357205 | |||
| 795 | Ga0157369_10006908 | |||
| 796 | Ga0157369_10011101 | |||
| 797 | Ga0157374_10071045 | |||
| 798 | Ga0157374_10111925 | |||
| 799 | Ga0157374_10155576 | |||
| 800 | Ga0157374_10334108 | |||
| 801 | Ga0157378_10099207 | |||
| 802 | Ga0157378_10346208 | |||
| 803 | Ga0163162_10113745 | |||
| 804 | Ga0163162_10263497 | |||
| 805 | Ga0157372_10132844 | |||
| 806 | Ga0157372_10162283 | |||
| 807 | Ga0157372_10412314 | |||
| 808 | Ga0157375_10241325 | |||
| 809 | Ga0157375_10388057 | |||
| 810 | Ga0163163_10329322 | |||
| 811 | Ga0157377_10048414 | |||
| 812 | Ga0157377_10165445 | |||
| 813 | Ga0157379_10052288 | |||
| 814 | Ga0157379_10148033 | |||
| 815 | Ga0157376_10145857 | |||
| 816 | Ga0157376_10345923 | |||
| 817 | Ga0163161_10060029 | |||
| 818 | Ga0163161_10111262 | |||
| 819 | Ga0207427_100041 | |||
| 820 | Ga0209437_100371 | |||
| 821 | Ga0209148_1003704 | |||
| 822 | Ga0209233_1000014 | |||
| 823 | Ga0209673_1028423 | |||
| 824 | Ga0209051_1001791 | |||
| 825 | Ga0209051_1006529 | |||
| 826 | Ga0209051_1010880 | |||
| 827 | Ga0207697_10000015 | |||
| 828 | Ga0207655_1002155 | |||
| 829 | Ga0207655_1003325 | |||
| 830 | Ga0207682_10008880 | |||
| 831 | Ga0207642_10008581 | |||
| 832 | Ga0207688_10002220 | |||
| 833 | Ga0207680_10043144 | |||
| 834 | Ga0207685_10014083 | |||
| 835 | Ga0207645_10002039 | |||
| 836 | Ga0207645_10032519 | |||
| 837 | Ga0207643_10089321 | |||
| 838 | Ga0207705_10020037 | |||
| 839 | Ga0207705_10046090 | |||
| 840 | Ga0207654_10026985 | |||
| 841 | Ga0207707_10037498 | |||
| 842 | Ga0207693_10012464 | |||
| 843 | Ga0207663_10051214 | |||
| 844 | Ga0207660_10259941 | |||
| 845 | Ga0207662_10005556 | |||
| 846 | Ga0207657_10022118 | |||
| 847 | Ga0207657_10170195 | |||
| 848 | Ga0207649_10036555 | |||
| 849 | Ga0207652_10002331 | |||
| 850 | Ga0207652_10141661 | |||
| 851 | Ga0207681_10103436 | |||
| 852 | Ga0207681_10178505 | |||
| 853 | Ga0207694_10111874 | |||
| 854 | Ga0207650_10005566 | |||
| 855 | Ga0207687_10014898 | |||
| 856 | Ga0207687_10023526 | |||
| 857 | Ga0207687_10024839 | |||
| 858 | Ga0207644_10231967 | |||
| 859 | Ga0207690_10032441 | |||
| 860 | Ga0207706_10056755 | |||
| 861 | Ga0207686_10082337 | |||
| 862 | Ga0207686_10082479 | |||
| 863 | Ga0207686_10201995 | |||
| 864 | Ga0207709_10010585 | |||
| 865 | Ga0207709_10014858 | |||
| 866 | Ga0207709_10117828 | |||
| 867 | Ga0207670_10001198 | |||
| 868 | Ga0207669_10045222 | |||
| 869 | Ga0207704_10003999 | |||
| 870 | Ga0207704_10018401 | |||
| 871 | Ga0207665_10037187 | |||
| 872 | Ga0207665_10039867 | |||
| 873 | Ga0207691_10000240 | |||
| 874 | Ga0207689_10054876 | |||
| 875 | Ga0207661_10005846 | |||
| 876 | Ga0207661_10019363 | |||
| 877 | Ga0207661_10094913 | |||
| 878 | Ga0207661_10221192 | |||
| 879 | Ga0207679_10080753 | |||
| 880 | Ga0207667_10145849 | |||
| 881 | Ga0207640_10052317 | |||
| 882 | Ga0207658_10091963 | |||
| 883 | Ga0207677_10021987 | |||
| 884 | Ga0207677_10047229 | |||
| 885 | Ga0207677_10052857 | |||
| 886 | Ga0207639_10039349 | |||
| 887 | Ga0207678_10053617 | |||
| 888 | Ga0207708_10012736 | |||
| 889 | Ga0207708_10048753 | |||
| 890 | Ga0207702_10112179 | |||
| 891 | Ga0207641_10309730 | |||
| 892 | Ga0207641_10424595 | |||
| 893 | Ga0207648_10040858 | |||
| 894 | Ga0207648_10102360 | |||
| 895 | Ga0207676_10132687 | |||
| 896 | Ga0207676_10210877 | |||
| 897 | Ga0207674_10045551 | |||
| 898 | Ga0207675_100074528 | |||
| 899 | Ga0207683_10013671 | |||
| 900 | Ga0207683_10052127 | |||
| 901 | Ga0207683_10054230 | |||
| 902 | Ga0207698_10123561 | |||
| 903 | Ga0207698_10182174 | |||
| 904 | Ga0207428_10006626 | |||
| 905 | Ga0268266_10076974 | |||
| 906 | Ga0268266_10155009 | |||
| 907 | Ga0268265_10075776 | |||
| 908 | Ga0265338_10021640 | |||
| 909 | Ga0307512_10011601 | |||
| 910 | Ga0316177_1000403 | |||
| 911 | Ga0314311_1114875 | |||
| 912 | Ga0265327_10000018 | |||
| 913 | Ga0265327_10003464 | |||
| 914 | Ga0265316_10087215 | |||
| 915 | Ga0307408_100001088 | |||
| 916 | Ga0307408_100023078 | |||
| 917 | Ga0307408_100023675 | |||
| 918 | Ga0307408_100058454 | |||
| 919 | Ga0307408_100249367 | |||
| 920 | Ga0316575_10008468 | |||
| 921 | Ga0316579_10003003 | |||
| 922 | Ga0316576_10000437 | |||
| 923 | Ga0316576_10015278 | |||
| 924 | Ga0316576_10024649 | |||
| 925 | Ga0316578_10002858 | |||
| 926 | Ga0316578_10064850 | |||
| 927 | Ga0307405_10025293 | |||
| 928 | Ga0307405_10025357 | |||
| 929 | Ga0307405_10030495 | |||
| 930 | Ga0307405_10032420 | |||
| 931 | Ga0307405_10073512 | |||
| 932 | Ga0307405_10083008 | |||
| 933 | Ga0307405_10141661 | |||
| 934 | Ga0316577_10140192 | |||
| 935 | Ga0307413_10006151 | |||
| 936 | Ga0307413_10012845 | |||
| 937 | Ga0307518_10000341 | |||
| 938 | Ga0307518_10150399 | |||
| 939 | Ga0307410_10006495 | |||
| 940 | Ga0307410_10020051 | |||
| 941 | Ga0307410_10042055 | |||
| 942 | Ga0307410_10048407 | |||
| 943 | Ga0307410_10057820 | |||
| 944 | Ga0307410_10064891 | |||
| 945 | Ga0307410_10131465 | |||
| 946 | Ga0307406_10006959 | |||
| 947 | Ga0307406_10080352 | |||
| 948 | Ga0307407_10011064 | |||
| 949 | Ga0307407_10030894 | |||
| 950 | Ga0307407_10173160 | |||
| 951 | Ga0307412_10013526 | |||
| 952 | Ga0307412_10045554 | |||
| 953 | Ga0307412_10052859 | |||
| 954 | Ga0307412_10054605 | |||
| 955 | Ga0307412_10066898 | |||
| 956 | Ga0307412_10118261 | |||
| 957 | Ga0307412_10123356 | |||
| 958 | Ga0307409_100000781 | |||
| 959 | Ga0307409_100055427 | |||
| 960 | Ga0307409_100075834 | |||
| 961 | Ga0307409_100239630 | |||
| 962 | Ga0307409_100354295 | |||
| 963 | Ga0307416_100000543 | |||
| 964 | Ga0307416_100017917 | |||
| 965 | Ga0307416_100043615 | |||
| 966 | Ga0307416_100110740 | |||
| 967 | Ga0307416_100142516 | |||
| 968 | Ga0307416_100185952 | |||
| 969 | Ga0307416_100196778 | |||
| 970 | Ga0307416_100249312 | |||
| 971 | Ga0307414_10021779 | |||
| 972 | Ga0307414_10080265 | |||
| 973 | Ga0307414_10094826 | |||
| 974 | Ga0307411_10022376 | |||
| 975 | Ga0307411_10051145 | |||
| 976 | Ga0307415_100023738 | |||
| 977 | Ga0316583_10018696 | |||
| 978 | Ga0316574_0004264 | |||
| 979 | Ga0316574_0009948 | |||
| 980 | Ga0316574_0129401 | |||
| 981 | Ga0373927_0034118 | |||
| 982 | Ga0316582_0002622 | |||
| 983 | Ga0316582_0006271 | |||
| 984 | Ga0316584_0000284 | |||
| 985 | Ga0316584_0003768 | |||
| 986 | Ga0316584_0009761 | |||
| 987 | Ga0316584_0047280 | |||
| 988 | Ga0373925_0000546 | |||
| 989 | Ga0373925_0002151 | |||
| 990 | Ga0395899_0000961 | |||
| 991 | Ga0395899_0139776 | |||
| 992 | Ga0395900_0035139 | |||
| 993 | Ga0395900_0396630 | |||
| 994 | Ga0395898_0018287 | |||
| 995 | Ga0395898_0040972 | |||
| 996 | Ga0395898_0076363 | |||
| 997 | Ga0395905_0035449 | |||
| 998 | Ga0395905_0086590 | |||
| 999 | Ga0395901_0029361 | |||
| 1000 | Ga0395901_0034876 | |||
| 1001 | Ga0395901_0034950 | |||
| 1002 | Ga0395901_0062107 | |||
| 1003 | Ga0395901_0228988 | |||
| 1004 | Ga0439466_0011638 | |||
| 1005 | Ga0451793_0253740 | |||
| 1006 | Ga0451793_1456744 | |||
| 1007 | Ga0451797_0676945 | |||
| 1008 | Ga0439442_003791 | |||
| 1009 | Ga0439449_0005599 | |||
| 1010 | Ga0439449_0033975 | |||
| 1011 | Ga0439449_0050925 | |||
| 1012 | Ga0439451_011154 | |||
| 1013 | Ga0495617_050888 | |||
| 1014 | Ga0495592_0019908 | |||
| 1015 | Ga0495592_0021776 | |||
| 1016 | Ga0495603_0020100 | |||
| 1017 | Ga0495603_0042208 | |||
| 1018 | Ga0495603_0103719 | |||
| 1019 | Ga0495629_0024179 | |||
| 1020 | Ga0495629_0030665 | |||
| 1021 | Ga0495629_0043473 | |||
| 1022 | Ga0495651_0000947 | |||
| 1023 | Ga0495651_0024496 | |||
| 1024 | Ga0495653_0000468 | |||
| 1025 | Ga0495653_0002447 | |||
| 1026 | Ga0495653_0054252 | |||
| 1027 | Ga0495653_0176758 | |||
| 1028 | Ga0495650_0020985 | |||
| 1029 | Ga0495580_0009672 | |||
| 1030 | Ga0495580_0017933 | |||
| 1031 | Ga0495580_0018641 | |||
| 1032 | Ga0495639_0002895 | |||
| 1033 | Ga0495662_0004431 | |||
| 1034 | Ga0495662_0019872 | |||
| 1035 | Ga0495664_0003529 | |||
| 1036 | Ga0495664_0016800 | |||
| 1037 | Ga0495584_0094260 | |||
| 1038 | Ga0495584_0106019 | |||
| 1039 | Ga0495607_0088132 | |||
| 1040 | Ga0495608_0002580 | |||
| 1041 | Ga0495616_0053472 | |||
| 1042 | Ga0495618_0007082 | |||
| 1043 | Ga0495628_0009866 | |||
| 1044 | Ga0495628_0017078 | |||
| 1045 | Ga0495630_0032140 | |||
| 1046 | Ga0495631_0012263 | |||
| 1047 | Ga0495643_0103788 | |||
| 1048 | Ga0495644_0056673 | |||
| 1049 | Ga0495663_0057219 | |||
| 1050 | Ga0495652_0002737 | |||
| 1051 | Ga0495665_0005430 | |||
| 1052 | Ga0495640_0009777 | |||
| 1053 | Ga0495640_0094210 | |||
| 1054 | Ga0495640_0129799 | |||
| 1055 | Ga0495609_0012796 | |||
| 1056 | Ga0495645_0024011 | |||
| 1057 | Ga0495645_0029810 | |||
| 1058 | Ga0495633_0033659 | |||
| 1059 | Ga0495667_0002903 | |||
| 1060 | Ga0495667_0007901 | |||
| 1061 | Ga0495656_0029118 | |||
| 1062 | Ga0495668_0000352 | |||
| 1063 | Ga0495668_0050400 | |||
| 1064 | Ga0495668_0118468 | |||
| 1065 | Ga0495634_0025829 | |||
| 1066 | Ga0495635_0002053 | |||
| 1067 | Ga0495635_0119429 | |||
| 1068 | Ga0495659_0055469 | |||
| 1069 | Ga0495588_0021029 | |||
| 1070 | Ga0495657_0005138 | |||
| 1071 | Ga0495657_0103694 | |||
| 1072 | Ga0495599_0000251 | |||
| 1073 | Ga0495599_0010264 | |||
| 1074 | Ga0495623_0048902 | |||
| 1075 | Ga0495646_0018513 | |||
| 1076 | Ga0495646_0035658 | |||
| 1077 | Ga0495669_0076302 | |||
| 1078 | Ga0495613_0003769 | |||
| 1079 | Ga0495670_0002814 | |||
| 1080 | Ga0495670_0139365 | |||
| 1081 | Ga0495649_0018286 | |||
| 1082 | Ga0495649_0122582 | |||
| 1083 | Ga0495589_0101712 | |||
| 1084 | Ga0495600_0032178 | |||
| 1085 | Ga0495581_0003348 | |||
| 1086 | Ga0495581_0013941 | |||
| 1087 | Ga0495604_0000511 | |||
| 1088 | Ga0495604_0001557 | |||
| 1089 | Ga0495636_0012871 | |||
| 1090 | Ga0495674_0009679 | |||
| 1091 | Ga0495674_0016223 | |||
| 1092 | Ga0495674_0116081 | |||
| 1093 | Ga0495680_0003326 | |||
| 1094 | Ga0495680_0157138 | |||
| 1095 | Ga0495685_007653 | |||
| 1096 | Ga0495681_0036311 | |||
| 1097 | Ga0495681_0046652 | |||
| 1098 | Ga0495684_0000544 | |||
| 1099 | Ga0495684_0009486 | |||
| 1100 | Ga0495686_0006550 | |||
| 1101 | Ga0495593_0091930 | |||
| 1102 | Ga0495602_0041879 | |||
| 1103 | Ga0496100_0015496 | |||
| 1104 | Ga0496100_0047462 | |||
| 1105 | Ga0496101_0010791 | |||
| 1106 | Ga0496101_0079335 | |||
| 1107 | Ga0496101_0131838 | |||
| 1108 | Ga0496102_0008212 | |||
| 1109 | Ga0496102_0012060 | |||
| 1110 | Ga0496102_0081701 | |||
| 1111 | Ga0496102_0093759 | |||
| 1112 | Ga0496102_0140191 | |||
| 1113 | Ga0496102_0249419 | |||
| 1114 | Ga0496103_0042143 | |||
| 1115 | Ga0496103_0063315 | |||
| 1116 | Ga0496104_0034492 | |||
| 1117 | Ga0496104_0046877 | |||
| 1118 | Ga0496104_0084583 | |||
| 1119 | Ga0496104_0091297 | |||
| 1120 | Ga0496104_0234167 | |||
| 1121 | Ga0496105_0005681 | |||
| 1122 | Ga0496105_0007824 | |||
| 1123 | Ga0496105_0011947 | |||
| 1124 | Ga0496105_0031739 | |||
| 1125 | Ga0496105_0034016 | |||
| 1126 | Ga0496105_0313606 | |||
| 1127 | Ga0496106_0003027 | |||
| 1128 | Ga0496106_0020822 | |||
| 1129 | Ga0496106_0037833 | |||
| 1130 | Ga0496106_0089753 | |||
| 1131 | Ga0496106_0102410 | |||
| 1132 | Ga0496106_0218094 | |||
| 1133 | Ga0496106_0248862 | |||
| 1134 | Ga0496107_0011534 | |||
| 1135 | Ga0496107_0077544 | |||
| 1136 | Ga0496107_0132489 | |||
| 1137 | Ga0496107_0210015 | |||
| 1138 | Ga0496108_0001527 | |||
| 1139 | Ga0496108_0009943 | |||
| 1140 | Ga0496108_0019430 | |||
| 1141 | Ga0496108_0063471 | |||
| 1142 | Ga0496108_0070293 | |||
| 1143 | Ga0496109_0004173 | |||
| 1144 | Ga0496109_0004800 | |||
| 1145 | Ga0496109_0048283 | |||
| 1146 | Ga0496110_0005816 | |||
| 1147 | Ga0496110_0052361 | |||
| 1148 | Ga0496110_0086889 | |||
| 1149 | Ga0496110_0087845 | |||
| 1150 | Ga0496110_0355166 | |||
| 1151 | Ga0496111_0002373 | |||
| 1152 | Ga0496111_0009602 | |||
| 1153 | Ga0496111_0048145 | |||
| 1154 | Ga0496111_0147165 | |||
| 1155 | Ga0496111_0218028 | |||
| 1156 | Ga0496112_0050780 | |||
| 1157 | Ga0496112_0095169 | |||
| 1158 | Ga0496112_0278100 | |||
| 1159 | Ga0496112_0278295 | |||
| 1160 | Ga0496112_0314579 | |||
| 1161 | Ga0496113_0014888 | |||
| 1162 | Ga0496113_0016751 | |||
| 1163 | Ga0496113_0096766 | |||
| 1164 | Ga0496113_0256966 | |||
| 1165 | Ga0496114_0005796 | |||
| 1166 | Ga0496114_0022378 | |||
| 1167 | Ga0496114_0048353 | |||
| 1168 | Ga0496114_0145351 | |||
| 1169 | Ga0496114_0196345 | |||
| 1170 | Ga0496114_0198062 | |||
| 1171 | Ga0496114_0202853 | |||
| 1172 | Ga0496115_0011698 | |||
| 1173 | Ga0496115_0020885 | |||
| 1174 | Ga0496115_0037729 | |||
| 1175 | Ga0496115_0191308 | |||
| 1176 | Ga0496119_0028888 | |||
| 1177 | Ga0496120_0112654 | |||
| 1178 | Ga0496121_0000641 | |||
| 1179 | Ga0496122_0072644 | |||
| 1180 | Ga0496122_0151965 | |||
| 1181 | Ga0496123_0026625 | |||
| 1182 | Ga0496125_0022398 | |||
| 1183 | Ga0496126_0003501 | |||
| 1184 | Ga0496126_0074594 | |||
| 1185 | Ga0496126_0083778 | |||
| 1186 | Ga0501032_0161038 | |||
| 1187 | Ga0501033_0040303 | |||
| 1188 | Ga0501036_0009713 | |||
| 1189 | Ga0501037_0017637 | |||
| 1190 | Ga0501038_0006814 | |||
| 1191 | Ga0501039_0002106 | |||
| 1192 | Ga0501040_0000143 | |||
| 1193 | Ga0501041_0011718 | |||
| 1194 | Ga0501048_0017693 | |||
| 1195 | Ga0501068_0092182 | |||
| 1196 | Ga0501069_0087729 | |||
| 1197 | Ga0501071_0006645 | |||
| 1198 | Ga0501072_0002351 | |||
| 1199 | Ga0501075_0001968 | |||
| 1200 | Ga0501076_0000559 | |||
| 1201 | Ga0501077_0000359 | |||
| 1202 | Ga0501079_0004519 | |||
| 1203 | Ga0501081_0035781 | |||
| 1204 | Ga0501035_0034311 | |||
| 1205 | Ga0501045_0001083 | |||
| 1206 | nmdc:mga00v17_21049_c1 | |||
| 1207 | nmdc:mga00v17_8579_c1 | |||
| 1208 | nmdc:mga06r32_8071_c1 | |||
| 1209 | nmdc:mga0n895_26535_c1 | |||
| 1210 | nmdc:mga0sz30_5596_c1 | |||
| 1211 | Ga0495601_0027993 | |||
| 1212 | Ga0500635_0000132 | |||
| 1213 | Ga0495655_0001566 | |||
| 1214 | Ga0495595_0003064 | |||
| 1215 | Ga0500573_0100002 | |||
| 1216 | Ga0500645_000640 | |||
| 1217 | Ga0501084_0004988 | |||
| 1218 | Ga0590075_016071 | |||
| 1219 | Ga0501082_0009793 | |||
| 1220 | Ga0530510_0000107 | |||
| 1221 | 2566991353 | |||
| 1222 | 2586063039 | |||
| 1223 | 2643785142 | |||
| 1224 | 2643876532 | |||
| 1225 | 2644113610 | |||
| 1226 | 2644178340 | |||
| 1227 | 2644229272 | |||
| 1228 | 2644383587 | |||
| 1229 | 2644487121 | |||
| 1230 | 2644523828 | |||
| 1231 | 2644609021 | |||
| 1232 | 2644667930 | |||
| 1233 | 2644679467 | |||
| 1234 | 2691515759 | |||
| 1235 | 2723640965 | |||
| 1236 | 2730228975 | |||
| 1237 | 2738693190 | |||
| 1238 | 2738705284 | |||
| 1239 | 2738892034 | |||
| 1240 | 2739237370 | |||
| 1241 | 2739323235 | |||
| 1242 | 2739334611 | |||
| 1243 | 2739367317 | |||
| 1244 | 2753037362 | |||
| 1245 | 2753325231 | |||
| 1246 | 2760622247 | |||
| 1247 | 2775657358 | |||
| 1248 | 2808828899 | |||
| 1249 | 2808850130 | |||
| 1250 | 2808874067 | |||
| 1251 | 2808893136 | |||
| 1252 | 2808896298 | |||
| 1253 | 2809194498 | |||
| 1254 | 2809587844 | |||
| 1255 | 2812319401 | |||
| 1256 | 2812349997 | |||
| 1257 | 2819426869 | |||
| 1258 | 2819692621 | |||
| 1259 | 2819728864 | |||
| 1260 | 2857742801 | |||
| 1261 | 2884764238 | |||
| 1262 | 2887447763 | |||
| 1263 | 2889302511 | |||
| 1264 | 2895660740 | |||
| 1265 | 2902842049 | |||
| 1266 | 2904501200 | |||
| 1267 | 2904541686 | |||
| 1268 | 2904769618 | |||
| 1269 | 2904773184 | |||
| 1270 | 2904779014 | |||
| 1271 | 2908813984 | |||
| 1272 | 2915770117 | |||
| 1273 | 2919037136 | |||
| 1274 | 2919394218 | |||
| 1275 | 2919395178 | |||
| 1276 | 2919422453 | |||
| 1277 | 2919435294 | |||
| 1278 | 2919446705 | |||
| 1279 | 2919526706 | |||
| 1280 | 2919543008 | |||
| 1281 | 2922556234 | |||
| 1282 | 2932430794 | |||
| 1283 | 2933419488 | |||
| 1284 | 2935410417 | |||
| 1285 | 2939602191 | |||
| 1286 | 2939675642 | |||
| 1287 | 2939748392 | |||
| 1288 | 2945917153 | |||
| 1289 | 2945922595 | |||
| 1290 | 2945941240 | |||
| 1291 | 2945960823 | |||
| 1292 | 2946037115 | |||
| 1293 | 2946060953 | |||
| 1294 | 2953998368 | |||
| 1295 | 2954711717 | |||
| 1296 | 2954740547 | |||
| 1297 | 2954759015 | |||
| 1298 | 2954759559 | |||
| 1299 | 2956941342 | |||
| 1300 | 2974305099 | |||
| 1301 | 3001120229 | |||
| 1302 | 8003316760 | |||
| 1303 | 8003321010 | |||
| 1304 | 8004022118 | |||
| 1305 | 8004025837 | |||
| 1306 | 8054108678 | |||
| 1307 | 8054612803 | |||
| 1308 | 8056580283 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vhw-assembly1.cif.gz_F | crystal structure of holo l-alanine dehydrogenase from mycobacterium tuberculosis in the open and closed conformation | 0.8484 | 11 | 375 |
| 2vhx-assembly1.cif.gz_A | crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate | 0.8352 | 11 | 375 |
| 2vhx-assembly1.cif.gz_D | crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate | 0.8341 | 11 | 375 |
| 2vhv-assembly1.cif.gz_A | crystal structure of the d270a mutant of l-alanine dehydrogenase from mycobacterium tuberculosis in complex with nadh. | 0.8317 | 11 | 375 |
| 2eez-assembly1.cif.gz_F | crystal structure of alanine dehydrogenase from themus thermophilus | 0.8211 | 12 | 375 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6II59_3_109_3.50.50.80 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;Ubiquitin-activating enzyme E1, inactive adenylation domain, subdomain 1 | 0.8413 | 173 | 207 | 3.50.50.80 |
| af_Q2FYJ2_1_126_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8344 | 11 | 132 | 3.40.50.720 |
| af_P9WQB1_2_113_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8294 | 13 | 123 | 3.40.50.720 |
| af_P9WQB1_2_113_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8161 | 13 | 123 | 3.40.50.720 |
| af_Q2FYJ2_1_126_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7927 | 11 | 132 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D5A6B5-F1-model_v4 | deleted | 0.9906 | 9 | 387 |
|
| AF-A0A7V9UCZ4-F1-model_v4 | Alanine dehydrogenase | 0.99 | 9 | 344 |
GO:0000286
GO:0005886 GO:0006524 GO:0047126 |
| AF-A0A1P8YPW9-F1-model_v4 | Alanine dehydrogenase/PNT, N-terminal domain protein | 0.9894 | 11 | 387 |
GO:0000286
GO:0005886 GO:0006524 GO:0047126 |
| AF-A0A2R7YUR5-F1-model_v4 | Alanine dehydrogenase | 0.9866 | 3 | 387 |
GO:0000286
GO:0005886 GO:0006524 GO:0047126 |
| AF-A0A6G3QEC0-F1-model_v4 | Alanine dehydrogenase | 0.9861 | 10 | 386 |
GO:0000286
GO:0005886 GO:0006524 GO:0047126 |