F472862

General Info

Members Datasets Scaffolds Average Seq Length
654 235 653 165

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0211250|Ga0395899_0211250_132_629
Length 153
Sequence MTNKLTTCLWFDRGEARKAAEFYASVFPDSHVGKAHNAPGVDFTVLGQSFVGLNGGDMFKPNEAVSFMIVTENQEETDRYWNAIVGNGGQESQCGWCKDKWGFSWQITPRVLLEAMDNPDRAAAKRAFEAMMSMQKIDVAKIEAALAGETADA

Samples

Sample ID Description Type Environment
1 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
172 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
230 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
231 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
232 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.15
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 3.21
Rhizosphere 94.19
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1020694 3300001915 Bacteria 1033
2 JGI24740J21852_10010064 3300001979 Bacteria 3663
3 JGI24740J21852_10014842 3300001979 Bacteria 2861
4 JGI24740J21852_10051691 3300001979 Bacteria 1174
5 JGI24739J22299_10001236 3300001989 Bacteria 9612
6 JGI24739J22299_10012130 3300001989 Bacteria 3165
7 JGI24737J22298_10001280 3300001990 Bacteria 8902
8 JGI24743J22301_10010710 3300001991 Bacteria 1640
9 JGI24735J21928_10022144 3300002067 Bacteria 1937
10 JGI24738J21930_10004676 3300002075 Bacteria 3334
11 JGI24738J21930_10009394 3300002075 Bacteria 2201
12 JGI24738J21930_10077866 3300002075 Bacteria 692
13 JGI24738J21930_10116179 3300002075 Bacteria 579
14 JGI24034J26672_10016617 3300002239 Bacteria 1134
15 JGI25406J46586_10153179 3300003203 Bacteria 673
16 Ga0065712_10068456 3300005290 Bacteria 10541
17 Ga0065712_10117367 3300005290 Bacteria 1721
18 Ga0070658_10001186 3300005327 Bacteria 22303
19 Ga0070658_10010418 3300005327 Bacteria 7455
20 Ga0070658_10078315 3300005327 Bacteria 2713
21 Ga0070658_10114206 3300005327 Bacteria 2239
22 Ga0070658_10164813 3300005327 Bacteria 1860
23 Ga0070658_10175405 3300005327 Bacteria 1802
24 Ga0070676_10029039 3300005328 Bacteria 3143
25 Ga0070676_10043507 3300005328 Bacteria 2611
26 Ga0070676_10231108 3300005328 Bacteria 1226
27 Ga0070676_10255021 3300005328 Bacteria 1172
28 Ga0070676_10386038 3300005328 Bacteria 971
29 Ga0070683_100004557 3300005329 Bacteria 11439
30 Ga0070683_100009073 3300005329 Bacteria 8487
31 Ga0070683_100092986 3300005329 Bacteria 2833
32 Ga0070683_100105954 3300005329 Bacteria 2650
33 Ga0070690_100236886 3300005330 Bacteria 1286
34 Ga0070670_100002608 3300005331 Bacteria 14900
35 Ga0070670_100021727 3300005331 Bacteria 5519
36 Ga0070670_100037531 3300005331 Bacteria 4168
37 Ga0070670_100050398 3300005331 Bacteria 3578
38 Ga0070670_100056034 3300005331 Bacteria 3383
39 Ga0070670_100122546 3300005331 Bacteria 2243
40 Ga0070670_100540607 3300005331 Bacteria 1039
41 Ga0070677_10030433 3300005333 Bacteria 2055
42 Ga0070677_10410202 3300005333 Bacteria 716
43 Ga0070677_10472442 3300005333 Bacteria 675
44 Ga0068869_100144463 3300005334 Bacteria 1840
45 Ga0070666_10011522 3300005335 Bacteria 5552
46 Ga0070666_10013233 3300005335 Bacteria 5230
47 Ga0070666_10024213 3300005335 Bacteria 3954
48 Ga0070666_10029514 3300005335 Bacteria 3606
49 Ga0070666_10083930 3300005335 Bacteria 2180
50 Ga0070666_10211058 3300005335 Bacteria 1367
51 Ga0070666_10400570 3300005335 Bacteria 987
52 Ga0070680_101024698 3300005336 Bacteria 713
53 Ga0070682_100347852 3300005337 Bacteria 1104
54 Ga0068868_100001432 3300005338 Bacteria 16459
55 Ga0068868_100121714 3300005338 Bacteria 2129
56 Ga0068868_100445123 3300005338 Bacteria 1126
57 Ga0068868_100903308 3300005338 Bacteria 803
58 Ga0070660_100000707 3300005339 Bacteria 22075
59 Ga0070660_100006342 3300005339 Bacteria 8193
60 Ga0070660_100028508 3300005339 Bacteria 4178
61 Ga0070660_100298811 3300005339 Bacteria 1320
62 Ga0070660_100340788 3300005339 Bacteria 1233
63 Ga0070687_100291325 3300005343 Bacteria 1032
64 Ga0070661_100000101 3300005344 Bacteria 70279
65 Ga0070661_100006080 3300005344 Bacteria 8307
66 Ga0070661_100011558 3300005344 Bacteria 6151
67 Ga0070661_100083601 3300005344 Bacteria 2358
68 Ga0070661_100170313 3300005344 Bacteria 1653
69 Ga0070661_100720474 3300005344 Bacteria 814
70 Ga0070661_100728373 3300005344 Bacteria 810
71 Ga0070692_10012745 3300005345 Bacteria 3902
72 Ga0070668_100000037 3300005347 Bacteria 80771
73 Ga0070668_100746386 3300005347 Bacteria 866
74 Ga0070669_100037548 3300005353 Bacteria 3514
75 Ga0070669_100159692 3300005353 Bacteria 1751
76 Ga0070669_100184210 3300005353 Bacteria 1635
77 Ga0070669_100307334 3300005353 Bacteria 1277
78 Ga0070669_100942922 3300005353 Bacteria 738
79 Ga0070669_101109158 3300005353 Bacteria 682
80 Ga0070675_100001714 3300005354 Bacteria 16191
81 Ga0070675_100031113 3300005354 Bacteria 4313
82 Ga0070675_100041860 3300005354 Bacteria 3742
83 Ga0070675_100152720 3300005354 Bacteria 1980
84 Ga0070675_100627348 3300005354 Bacteria 976
85 Ga0070671_100002144 3300005355 Bacteria 15240
86 Ga0070671_100002365 3300005355 Bacteria 14559
87 Ga0070671_100086364 3300005355 Bacteria 2625
88 Ga0070671_100202037 3300005355 Bacteria 1685
89 Ga0070671_100256109 3300005355 Bacteria 1487
90 Ga0070671_100309030 3300005355 Bacteria 1346
91 Ga0070671_101446392 3300005355 Bacteria 608
92 Ga0070674_100043232 3300005356 Bacteria 3064
93 Ga0070674_100049894 3300005356 Bacteria 2880
94 Ga0070674_100141964 3300005356 Bacteria 1803
95 Ga0070673_100000809 3300005364 Bacteria 17505
96 Ga0070673_100014339 3300005364 Bacteria 5515
97 Ga0070673_100026517 3300005364 Bacteria 4280
98 Ga0070673_100037408 3300005364 Bacteria 3697
99 Ga0070673_100050357 3300005364 Bacteria 3256
100 Ga0070673_100313351 3300005364 Bacteria 1384
101 Ga0070659_100000045 3300005366 Bacteria 101520
102 Ga0070659_100029842 3300005366 Bacteria 4216
103 Ga0070659_100080394 3300005366 Bacteria 2602
104 Ga0070659_100441628 3300005366 Bacteria 1102
105 Ga0070659_101234341 3300005366 Bacteria 662
106 Ga0070659_101480723 3300005366 Bacteria 604
107 Ga0070667_100021775 3300005367 Bacteria 5319
108 Ga0070667_100026727 3300005367 Bacteria 4802
109 Ga0070667_100111142 3300005367 Bacteria 2376
110 Ga0070667_100159980 3300005367 Bacteria 1983
111 Ga0070667_100877115 3300005367 Bacteria 835
112 Ga0070694_100825067 3300005444 Bacteria 762
113 Ga0070663_100001602 3300005455 Bacteria 12480
114 Ga0070663_100030502 3300005455 Bacteria 3696
115 Ga0070663_100447075 3300005455 Bacteria 1064
116 Ga0070663_100684069 3300005455 Bacteria 871
117 Ga0070663_100945439 3300005455 Bacteria 747
118 Ga0070678_100022589 3300005456 Bacteria 4173
119 Ga0070662_100000036 3300005457 Bacteria 77190
120 Ga0070662_100006879 3300005457 Bacteria 7359
121 Ga0070662_100028207 3300005457 Bacteria 3904
122 Ga0070662_100114215 3300005457 Bacteria 2061
123 Ga0070662_100268405 3300005457 Bacteria 1377
124 Ga0070662_100307970 3300005457 Bacteria 1289
125 Ga0070662_100366258 3300005457 Bacteria 1184
126 Ga0070662_100408978 3300005457 Bacteria 1121
127 Ga0070662_100462982 3300005457 Bacteria 1054
128 Ga0070662_101220646 3300005457 Bacteria 646
129 Ga0070681_10079481 3300005458 Bacteria 3236
130 Ga0070681_10807015 3300005458 Bacteria 856
131 Ga0070679_100117468 3300005530 Bacteria 2645
132 Ga0070679_100256058 3300005530 Bacteria 1706
133 Ga0070679_100442957 3300005530 Bacteria 1244
134 Ga0070679_100560894 3300005530 Bacteria 1086
135 Ga0070684_100141106 3300005535 Bacteria 2179
136 Ga0068853_100000059 3300005539 Bacteria 78301
137 Ga0068853_100063347 3300005539 Bacteria 3202
138 Ga0068853_100571222 3300005539 Bacteria 1072
139 Ga0070672_100000841 3300005543 Bacteria 18380
140 Ga0070672_100017944 3300005543 Bacteria 5104
141 Ga0070672_100116825 3300005543 Bacteria 2180
142 Ga0070672_100451389 3300005543 Bacteria 1107
143 Ga0070695_100304238 3300005545 Bacteria 1180
144 Ga0070696_100215402 3300005546 Bacteria 1439
145 Ga0070693_100002442 3300005547 Bacteria 8560
146 Ga0070665_100009353 3300005548 Bacteria 9917
147 Ga0070665_100016932 3300005548 Bacteria 7309
148 Ga0070665_100018026 3300005548 Bacteria 7085
149 Ga0070665_100022026 3300005548 Bacteria 6411
150 Ga0070665_100106194 3300005548 Bacteria 2810
151 Ga0070665_100145876 3300005548 Bacteria 2370
152 Ga0070665_100241751 3300005548 Bacteria 1806
153 Ga0068855_100003816 3300005563 Bacteria 18418
154 Ga0068855_100051577 3300005563 Bacteria 4846
155 Ga0068855_100325153 3300005563 Bacteria 1699
156 Ga0068855_100411460 3300005563 Bacteria 1480
157 Ga0070664_100000027 3300005564 Bacteria 90881
158 Ga0070664_100001887 3300005564 Bacteria 16827
159 Ga0070664_100023734 3300005564 Bacteria 5065
160 Ga0070664_100118968 3300005564 Bacteria 2311
161 Ga0070664_100430810 3300005564 Bacteria 1209
162 Ga0070664_100757234 3300005564 Bacteria 907
163 Ga0068857_100021317 3300005577 Bacteria 5704
164 Ga0068857_100035284 3300005577 Bacteria 4429
165 Ga0068857_101136371 3300005577 Bacteria 755
166 Ga0068854_100002620 3300005578 Bacteria 11153
167 Ga0068854_100006961 3300005578 Bacteria 7215
168 Ga0068854_100010386 3300005578 Bacteria 6036
169 Ga0068854_100589527 3300005578 Bacteria 948
170 Ga0068856_100000699 3300005614 Bacteria 36354
171 Ga0068856_100060969 3300005614 Bacteria 3726
172 Ga0068856_101249569 3300005614 Bacteria 758
173 Ga0068852_100000647 3300005616 Bacteria 22808
174 Ga0068852_100019017 3300005616 Bacteria 5426
175 Ga0068852_100054625 3300005616 Bacteria 3444
176 Ga0068852_100229253 3300005616 Bacteria 1770
177 Ga0068852_100297209 3300005616 Bacteria 1562
178 Ga0068852_100675250 3300005616 Bacteria 1042
179 Ga0068859_100031175 3300005617 Bacteria 5352
180 Ga0068859_100034991 3300005617 Bacteria 5039
181 Ga0068859_100116695 3300005617 Bacteria 2734
182 Ga0068859_100173035 3300005617 Bacteria 2241
183 Ga0068859_100620673 3300005617 Bacteria 1174
184 Ga0068864_100013694 3300005618 Bacteria 6726
185 Ga0068864_100018649 3300005618 Bacteria 5799
186 Ga0068864_100033988 3300005618 Bacteria 4335
187 Ga0068851_10015145 3300005834 Bacteria 3671
188 Ga0068851_10146083 3300005834 Bacteria 1289
189 Ga0068851_10146969 3300005834 Bacteria 1286
190 Ga0068863_100000017 3300005841 Bacteria 207950
191 Ga0068863_100013325 3300005841 Bacteria 7930
192 Ga0068863_100293959 3300005841 Bacteria 1575
193 Ga0068863_100371305 3300005841 Bacteria 1396
194 Ga0068863_100452671 3300005841 Bacteria 1260
195 Ga0068858_100001436 3300005842 Bacteria 24507
196 Ga0068858_100011909 3300005842 Bacteria 8197
197 Ga0068858_100105083 3300005842 Bacteria 2635
198 Ga0068860_100022422 3300005843 Bacteria 6107
199 Ga0068860_100280367 3300005843 Bacteria 1628
200 Ga0068860_100396393 3300005843 Bacteria 1365
201 Ga0068860_101109410 3300005843 Bacteria 811
202 Ga0068862_100072920 3300005844 Bacteria 2967
203 Ga0081539_10281172 3300005985 Bacteria 724
204 Ga0075432_10260207 3300006058 Bacteria 707
205 Ga0097621_100738190 3300006237 Bacteria 909
206 Ga0097621_101962914 3300006237 Bacteria 559
207 Ga0068871_100019088 3300006358 Bacteria 5228
208 Ga0068871_100607748 3300006358 Bacteria 995
209 Ga0075430_100158655 3300006846 Bacteria 1883
210 Ga0075429_100478694 3300006880 Bacteria 1091
211 Ga0068865_100060644 3300006881 Bacteria 2649
212 Ga0068865_100061757 3300006881 Bacteria 2628
213 Ga0097620_100031175 3300006931 Bacteria 5352
214 Ga0097620_100034990 3300006931 Bacteria 5039
215 Ga0097620_100116698 3300006931 Bacteria 2734
216 Ga0097620_100173036 3300006931 Bacteria 2241
217 Ga0097620_100620630 3300006931 Bacteria 1174
218 Ga0105240_10010384 3300009093 Bacteria 13094
219 Ga0105240_11068412 3300009093 Bacteria 860
220 Ga0111539_11322747 3300009094 Bacteria 836
221 Ga0105245_10025575 3300009098 Bacteria 5192
222 Ga0105247_10170224 3300009101 Bacteria 1448
223 Ga0105243_10093452 3300009148 Bacteria 2482
224 Ga0105241_10524818 3300009174 Bacteria 1059
225 Ga0105241_10622026 3300009174 Bacteria 978
226 Ga0105248_10001529 3300009177 Bacteria 25755
227 Ga0105248_10007926 3300009177 Bacteria 11673
228 Ga0105248_10577592 3300009177 Bacteria 1268
229 Ga0105248_10748816 3300009177 Bacteria 1102
230 Ga0105248_12350139 3300009177 Bacteria 607
231 Ga0105238_10053894 3300009551 Bacteria 4041
232 Ga0105238_10108048 3300009551 Bacteria 2763
233 Ga0105238_10129953 3300009551 Bacteria 2497
234 Ga0105238_10438848 3300009551 Bacteria 1302
235 Ga0105238_10849902 3300009551 Bacteria 930
236 Ga0105249_10008965 3300009553 Bacteria 8738
237 Ga0105249_10773075 3300009553 Bacteria 1023
238 Ga0105239_10980578 3300010375 Bacteria 971
239 Ga0157373_10189860 3300013100 Bacteria 1448
240 Ga0157373_10684424 3300013100 Bacteria 751
241 Ga0157371_10004543 3300013102 Bacteria 12085
242 Ga0157371_10029097 3300013102 Bacteria 3999
243 Ga0157371_10032397 3300013102 Bacteria 3761
244 Ga0157371_10489506 3300013102 Bacteria 907
245 Ga0157371_10523646 3300013102 Bacteria 877
246 Ga0157370_10008454 3300013104 Bacteria 11102
247 Ga0157370_10465274 3300013104 Bacteria 1162
248 Ga0157369_10099482 3300013105 Bacteria 3100
249 Ga0157369_10361778 3300013105 Bacteria 1506
250 Ga0157369_10511676 3300013105 Bacteria 1242
251 Ga0157369_12183949 3300013105 Bacteria 561
252 Ga0157374_10010355 3300013296 Bacteria 8021
253 Ga0157374_10040864 3300013296 Bacteria 4272
254 Ga0157374_10434808 3300013296 Bacteria 1312
255 Ga0157374_10735054 3300013296 Bacteria 1001
256 Ga0157378_10840045 3300013297 Bacteria 946
257 Ga0163162_10012953 3300013306 Bacteria 8140
258 Ga0163162_10721395 3300013306 Bacteria 1117
259 Ga0157372_10009481 3300013307 Bacteria 10352
260 Ga0157372_10209612 3300013307 Bacteria 2258
261 Ga0157372_11054279 3300013307 Bacteria 941
262 Ga0157375_10050138 3300013308 Bacteria 4094
263 Ga0157375_10704767 3300013308 Bacteria 1163
264 Ga0157375_10763645 3300013308 Bacteria 1117
265 Ga0157375_10781847 3300013308 Bacteria 1104
266 Ga0163163_10000187 3300014325 Bacteria 63661
267 Ga0157380_11915642 3300014326 Bacteria 653
268 Ga0182008_10442835 3300014497 Bacteria 705
269 Ga0157379_10095031 3300014968 Bacteria 2674
270 Ga0163161_10041659 3300017792 Bacteria 3300
271 Ga0206352_10340437 3300020078 Bacteria 2225
272 Ga0209026_1030492 3300025250 Bacteria 800
273 Ga0207697_10028036 3300025315 Bacteria 2302
274 Ga0207697_10222505 3300025315 Bacteria 833
275 Ga0207656_10016002 3300025321 Bacteria 2911
276 Ga0207656_10024806 3300025321 Bacteria 2429
277 Ga0207682_10328123 3300025893 Bacteria 719
278 Ga0207682_10360451 3300025893 Bacteria 685
279 Ga0207688_10583593 3300025901 Bacteria 704
280 Ga0207680_10000896 3300025903 Bacteria 14078
281 Ga0207680_10001103 3300025903 Bacteria 12733
282 Ga0207680_10022675 3300025903 Bacteria 3418
283 Ga0207680_10319440 3300025903 Bacteria 1085
284 Ga0207680_10452914 3300025903 Bacteria 911
285 Ga0207647_10016771 3300025904 Bacteria 4990
286 Ga0207647_10027617 3300025904 Bacteria 3698
287 Ga0207647_10046780 3300025904 Bacteria 2694
288 Ga0207647_10097430 3300025904 Bacteria 1749
289 Ga0207645_10047302 3300025907 Bacteria 2747
290 Ga0207645_10224690 3300025907 Bacteria 1238
291 Ga0207645_10327103 3300025907 Bacteria 1023
292 Ga0207645_10623905 3300025907 Bacteria 732
293 Ga0207705_10000912 3300025909 Bacteria 24200
294 Ga0207705_10042473 3300025909 Bacteria 3264
295 Ga0207705_10090003 3300025909 Bacteria 2246
296 Ga0207705_10098604 3300025909 Bacteria 2147
297 Ga0207705_10160813 3300025909 Bacteria 1687
298 Ga0207705_10209519 3300025909 Bacteria 1478
299 Ga0207705_10304205 3300025909 Bacteria 1223
300 Ga0207705_10372357 3300025909 Bacteria 1103
301 Ga0207705_10474475 3300025909 Bacteria 971
302 Ga0207654_10293372 3300025911 Bacteria 1103
303 Ga0207707_10233209 3300025912 Bacteria 1601
304 Ga0207707_10239796 3300025912 Bacteria 1576
305 Ga0207695_10004614 3300025913 Bacteria 18683
306 Ga0207695_10217131 3300025913 Bacteria 1821
307 Ga0207660_10094066 3300025917 Bacteria 2227
308 Ga0207657_10000133 3300025919 Bacteria 75282
309 Ga0207657_10003883 3300025919 Bacteria 15855
310 Ga0207657_10005051 3300025919 Bacteria 13844
311 Ga0207657_10068704 3300025919 Bacteria 3009
312 Ga0207657_10169942 3300025919 Bacteria 1767
313 Ga0207657_10261527 3300025919 Bacteria 1377
314 Ga0207657_10875150 3300025919 Bacteria 693
315 Ga0207649_10000680 3300025920 Bacteria 22565
316 Ga0207649_10014355 3300025920 Bacteria 4433
317 Ga0207649_10043625 3300025920 Bacteria 2743
318 Ga0207649_10075399 3300025920 Bacteria 2167
319 Ga0207649_10096230 3300025920 Bacteria 1950
320 Ga0207649_10243205 3300025920 Bacteria 1293
321 Ga0207649_10503584 3300025920 Bacteria 921
322 Ga0207649_10577621 3300025920 Bacteria 863
323 Ga0207652_10004117 3300025921 Bacteria 11871
324 Ga0207652_10411259 3300025921 Bacteria 1220
325 Ga0207652_10700728 3300025921 Bacteria 903
326 Ga0207681_10061772 3300025923 Bacteria 2577
327 Ga0207681_10110624 3300025923 Bacteria 1998
328 Ga0207681_10155828 3300025923 Bacteria 1717
329 Ga0207681_10182466 3300025923 Bacteria 1600
330 Ga0207681_10254900 3300025923 Bacteria 1371
331 Ga0207681_10301952 3300025923 Bacteria 1267
332 Ga0207681_10389530 3300025923 Bacteria 1123
333 Ga0207681_11045414 3300025923 Bacteria 685
334 Ga0207694_10031714 3300025924 Bacteria 4040
335 Ga0207694_10353013 3300025924 Bacteria 1217
336 Ga0207650_10004757 3300025925 Bacteria 9275
337 Ga0207650_10048011 3300025925 Bacteria 3147
338 Ga0207650_10088564 3300025925 Bacteria 2361
339 Ga0207650_10163718 3300025925 Bacteria 1764
340 Ga0207650_10492157 3300025925 Bacteria 1024
341 Ga0207650_11012034 3300025925 Bacteria 707
342 Ga0207659_10001712 3300025926 Bacteria 13017
343 Ga0207659_10013351 3300025926 Bacteria 5256
344 Ga0207659_10070747 3300025926 Bacteria 2545
345 Ga0207659_10131259 3300025926 Bacteria 1934
346 Ga0207659_10255685 3300025926 Bacteria 1423
347 Ga0207659_10563406 3300025926 Bacteria 969
348 Ga0207687_10159059 3300025927 Bacteria 1732
349 Ga0207687_10244056 3300025927 Bacteria 1425
350 Ga0207644_10000145 3300025931 Bacteria 50586
351 Ga0207644_10028004 3300025931 Bacteria 3896
352 Ga0207644_10039094 3300025931 Bacteria 3347
353 Ga0207644_10048420 3300025931 Bacteria 3039
354 Ga0207644_10252557 3300025931 Bacteria 1407
355 Ga0207690_10000080 3300025932 Bacteria 82082
356 Ga0207690_10122599 3300025932 Bacteria 1890
357 Ga0207690_10162139 3300025932 Bacteria 1668
358 Ga0207690_10191170 3300025932 Bacteria 1548
359 Ga0207706_10000159 3300025933 Bacteria 75284
360 Ga0207706_10005845 3300025933 Bacteria 11439
361 Ga0207706_10007351 3300025933 Bacteria 10184
362 Ga0207706_10012188 3300025933 Bacteria 7833
363 Ga0207706_10016374 3300025933 Bacteria 6694
364 Ga0207706_10022333 3300025933 Bacteria 5678
365 Ga0207706_10052604 3300025933 Bacteria 3595
366 Ga0207706_10065216 3300025933 Bacteria 3206
367 Ga0207706_10126577 3300025933 Bacteria 2247
368 Ga0207706_10823916 3300025933 Bacteria 787
369 Ga0207686_10158382 3300025934 Bacteria 1584
370 Ga0207670_10251706 3300025936 Bacteria 1366
371 Ga0207670_10397142 3300025936 Bacteria 1102
372 Ga0207669_10013884 3300025937 Bacteria 4020
373 Ga0207669_10086594 3300025937 Bacteria 2026
374 Ga0207669_10149697 3300025937 Bacteria 1633
375 Ga0207691_10002529 3300025940 Bacteria 17863
376 Ga0207691_10248236 3300025940 Bacteria 1537
377 Ga0207691_10288558 3300025940 Bacteria 1411
378 Ga0207691_11069788 3300025940 Bacteria 672
379 Ga0207691_11215090 3300025940 Bacteria 625
380 Ga0207711_10007466 3300025941 Bacteria 9146
381 Ga0207711_10019049 3300025941 Bacteria 5711
382 Ga0207711_10029794 3300025941 Bacteria 4604
383 Ga0207711_10277038 3300025941 Bacteria 1544
384 Ga0207711_10455616 3300025941 Bacteria 1191
385 Ga0207661_10038601 3300025944 Bacteria 3744
386 Ga0207661_10051516 3300025944 Bacteria 3285
387 Ga0207661_10102387 3300025944 Bacteria 2407
388 Ga0207661_10164037 3300025944 Bacteria 1929
389 Ga0207679_10001226 3300025945 Bacteria 16305
390 Ga0207679_10008147 3300025945 Bacteria 6667
391 Ga0207679_10368489 3300025945 Bacteria 1257
392 Ga0207679_10657260 3300025945 Bacteria 948
393 Ga0207679_10791595 3300025945 Bacteria 864
394 Ga0207679_11125821 3300025945 Bacteria 720
395 Ga0207667_10005833 3300025949 Bacteria 15008
396 Ga0207667_10007031 3300025949 Bacteria 13597
397 Ga0207667_10170460 3300025949 Bacteria 2237
398 Ga0207667_11275056 3300025949 Bacteria 712
399 Ga0207651_10029148 3300025960 Bacteria 3493
400 Ga0207651_10253837 3300025960 Bacteria 1440
401 Ga0207651_10423125 3300025960 Bacteria 1138
402 Ga0207712_10089823 3300025961 Bacteria 2259
403 Ga0207712_10118774 3300025961 Bacteria 1997
404 Ga0207668_10000029 3300025972 Bacteria 123784
405 Ga0207668_10148409 3300025972 Bacteria 1812
406 Ga0207668_10585121 3300025972 Bacteria 971
407 Ga0207668_10607998 3300025972 Bacteria 953
408 Ga0207640_10001181 3300025981 Bacteria 14279
409 Ga0207640_10155332 3300025981 Bacteria 1686
410 Ga0207640_10288210 3300025981 Bacteria 1293
411 Ga0207640_10687074 3300025981 Bacteria 876
412 Ga0207658_10044959 3300025986 Bacteria 3217
413 Ga0207658_10058789 3300025986 Bacteria 2862
414 Ga0207658_10075335 3300025986 Bacteria 2567
415 Ga0207658_10080928 3300025986 Bacteria 2489
416 Ga0207677_10016567 3300026023 Bacteria 4370
417 Ga0207677_10134660 3300026023 Bacteria 1882
418 Ga0207703_10004976 3300026035 Bacteria 10784
419 Ga0207703_10012033 3300026035 Bacteria 6738
420 Ga0207703_10014199 3300026035 Bacteria 6212
421 Ga0207639_10001590 3300026041 Bacteria 15258
422 Ga0207639_10609663 3300026041 Bacteria 1007
423 Ga0207639_10635847 3300026041 Bacteria 986
424 Ga0207639_11467371 3300026041 Bacteria 640
425 Ga0207678_10003713 3300026067 Bacteria 13727
426 Ga0207678_10017778 3300026067 Bacteria 6243
427 Ga0207678_10026918 3300026067 Bacteria 5016
428 Ga0207678_10126739 3300026067 Bacteria 2178
429 Ga0207678_10131551 3300026067 Bacteria 2135
430 Ga0207678_10254631 3300026067 Bacteria 1504
431 Ga0207702_10000246 3300026078 Bacteria 63201
432 Ga0207702_10104404 3300026078 Bacteria 2508
433 Ga0207702_10297875 3300026078 Bacteria 1530
434 Ga0207702_10363223 3300026078 Bacteria 1388
435 Ga0207641_10000036 3300026088 Bacteria 213165
436 Ga0207641_10040156 3300026088 Bacteria 3916
437 Ga0207641_10406726 3300026088 Bacteria 1308
438 Ga0207641_10430237 3300026088 Bacteria 1272
439 Ga0207648_10506200 3300026089 Bacteria 1105
440 Ga0207676_10186455 3300026095 Bacteria 1821
441 Ga0207676_10460221 3300026095 Bacteria 1201
442 Ga0207674_10009817 3300026116 Bacteria 10900
443 Ga0207674_10048018 3300026116 Bacteria 4372
444 Ga0207674_10971113 3300026116 Bacteria 818
445 Ga0207683_10012478 3300026121 Bacteria 7250
446 Ga0207683_10027998 3300026121 Bacteria 4871
447 Ga0207683_10282213 3300026121 Bacteria 1518
448 Ga0207698_10000759 3300026142 Bacteria 18757
449 Ga0207698_10024082 3300026142 Bacteria 4266
450 Ga0207698_10070313 3300026142 Bacteria 2773
451 Ga0207698_10234705 3300026142 Bacteria 1667
452 Ga0207698_10394762 3300026142 Bacteria 1320
453 Ga0207698_10494010 3300026142 Bacteria 1190
454 Ga0207698_11475287 3300026142 Bacteria 695
455 Ga0209974_10056674 3300027876 Bacteria 1323
456 Ga0207428_10874123 3300027907 Bacteria 636
457 Ga0268266_10012378 3300028379 Bacteria 7375
458 Ga0268266_10019539 3300028379 Bacteria 5774
459 Ga0268266_10029745 3300028379 Bacteria 4641
460 Ga0268266_10038097 3300028379 Bacteria 4094
461 Ga0268266_10065905 3300028379 Bacteria 3131
462 Ga0268266_10407987 3300028379 Bacteria 1286
463 Ga0268265_10246843 3300028380 Bacteria 1579
464 Ga0268265_10688882 3300028380 Bacteria 986
465 Ga0268264_10007570 3300028381 Bacteria 9056
466 Ga0268264_10026990 3300028381 Bacteria 4691
467 Ga0268264_10120588 3300028381 Bacteria 2311
468 Ga0268264_10132890 3300028381 Bacteria 2209
469 Ga0268264_12320602 3300028381 Bacteria 543
470 Ga0316178_1019046 3300030735 Bacteria 576
471 Ga0265327_10026289 3300031251 Bacteria 3374
472 Ga0307408_100019242 3300031548 Bacteria 4595
473 Ga0307408_100078786 3300031548 Bacteria 2457
474 Ga0307405_10173335 3300031731 Bacteria 1541
475 Ga0307405_10790121 3300031731 Bacteria 794
476 Ga0307413_10037496 3300031824 Bacteria 2800
477 Ga0307413_10142862 3300031824 Bacteria 1656
478 Ga0307413_10254331 3300031824 Bacteria 1305
479 Ga0307413_10425741 3300031824 Bacteria 1047
480 Ga0307413_10935868 3300031824 Bacteria 738
481 Ga0307410_10000318 3300031852 Bacteria 18700
482 Ga0307410_10033090 3300031852 Bacteria 3335
483 Ga0307410_10038729 3300031852 Bacteria 3125
484 Ga0307410_10184712 3300031852 Bacteria 1581
485 Ga0307410_10242133 3300031852 Bacteria 1398
486 Ga0307410_11257112 3300031852 Bacteria 646
487 Ga0307406_10117751 3300031901 Bacteria 1841
488 Ga0307406_10120499 3300031901 Bacteria 1823
489 Ga0307406_10203884 3300031901 Bacteria 1458
490 Ga0307412_10036091 3300031911 Bacteria 3164
491 Ga0307412_10143732 3300031911 Bacteria 1751
492 Ga0307412_10315175 3300031911 Bacteria 1242
493 Ga0307412_10600551 3300031911 Bacteria 932
494 Ga0307412_10683428 3300031911 Bacteria 879
495 Ga0307409_100016988 3300031995 Bacteria 4835
496 Ga0307409_100137087 3300031995 Bacteria 2102
497 Ga0307409_100195101 3300031995 Bacteria 1806
498 Ga0307409_100561639 3300031995 Bacteria 1122
499 Ga0307409_100689919 3300031995 Bacteria 1019
500 Ga0307416_100031399 3300032002 Bacteria 3999
501 Ga0307416_100031584 3300032002 Bacteria 3989
502 Ga0307416_100276263 3300032002 Bacteria 1653
503 Ga0307416_100619393 3300032002 Bacteria 1164
504 Ga0307416_101083653 3300032002 Bacteria 905
505 Ga0307416_101119731 3300032002 Bacteria 892
506 Ga0307414_10002184 3300032004 Bacteria 10204
507 Ga0307414_10003044 3300032004 Bacteria 8894
508 Ga0307414_10074760 3300032004 Bacteria 2456
509 Ga0307414_10196687 3300032004 Bacteria 1636
510 Ga0307411_10021174 3300032005 Bacteria 3798
511 Ga0307411_10052358 3300032005 Bacteria 2668
512 Ga0307411_10204897 3300032005 Bacteria 1518
513 Ga0307415_100007926 3300032126 Bacteria 5846
514 Ga0307415_100190779 3300032126 Bacteria 1617
515 Ga0307415_101185178 3300032126 Bacteria 719
516 Ga0373959_0098206 3300034820 Bacteria 694
517 Ga0373938_0076778 3300034957 Bacteria 808
518 Ga0373929_0083490 3300035085 Bacteria 782
519 Ga0373960_0082981 3300035121 Bacteria 1013
520 Ga0373931_0345537 3300035691 Bacteria 930
521 Ga0395899_0010088 3300037312 Bacteria 7242
522 Ga0395899_0013975 3300037312 Bacteria 6131
523 Ga0395899_0014720 3300037312 Bacteria 5970
524 Ga0395899_0031251 3300037312 Bacteria 4002
525 Ga0395899_0128790 3300037312 Bacteria 1809
526 Ga0395899_0211250 3300037312 Bacteria 1348
527 Ga0395899_0450918 3300037312 Bacteria 842
528 Ga0395900_0006695 3300037418 Bacteria 11971
529 Ga0395900_0011778 3300037418 Bacteria 8943
530 Ga0395900_0018717 3300037418 Bacteria 7062
531 Ga0395900_0027416 3300037418 Bacteria 5834
532 Ga0395900_0030421 3300037418 Bacteria 5545
533 Ga0395900_0037001 3300037418 Bacteria 5031
534 Ga0395900_0091833 3300037418 Bacteria 3119
535 Ga0395900_0091851 3300037418 Bacteria 3119
536 Ga0395900_0144007 3300037418 Bacteria 2438
537 Ga0395900_0145621 3300037418 Bacteria 2422
538 Ga0395900_0168774 3300037418 Bacteria 2229
539 Ga0395900_0238708 3300037418 Bacteria 1824
540 Ga0395900_0302554 3300037418 Bacteria 1585
541 Ga0395898_0035058 3300037466 Bacteria 4994
542 Ga0395898_0064763 3300037466 Bacteria 3544
543 Ga0395898_0089245 3300037466 Bacteria 2967
544 Ga0395898_0161649 3300037466 Bacteria 2142
545 Ga0395898_0398552 3300037466 Bacteria 1312
546 Ga0395905_0000187 3300037471 Bacteria 98895
547 Ga0395905_0000215 3300037471 Bacteria 89274
548 Ga0395905_0008278 3300037471 Bacteria 10266
549 Ga0395905_0017175 3300037471 Bacteria 6873
550 Ga0395905_0034610 3300037471 Bacteria 4744
551 Ga0395905_0122444 3300037471 Bacteria 2445
552 Ga0395905_0266814 3300037471 Bacteria 1597
553 Ga0395905_0300883 3300037471 Bacteria 1491
554 Ga0395905_0341959 3300037471 Bacteria 1387
555 Ga0395905_0347625 3300037471 Bacteria 1374
556 Ga0395905_0367575 3300037471 Bacteria 1331
557 Ga0395905_0586353 3300037471 Bacteria 1016
558 Ga0395905_0628439 3300037471 Bacteria 976
559 Ga0436364_0166654 3300037853 Bacteria 736
560 Ga0395901_0000876 3300038443 Bacteria 33203
561 Ga0395901_0001382 3300038443 Bacteria 25390
562 Ga0395901_0104829 3300038443 Bacteria 2967
563 Ga0395901_0129726 3300038443 Bacteria 2649
564 Ga0395901_0188467 3300038443 Bacteria 2163
565 Ga0395901_0240981 3300038443 Bacteria 1886
566 Ga0395901_0317882 3300038443 Bacteria 1611
567 Ga0395901_0436348 3300038443 Bacteria 1341
568 Ga0395901_0465587 3300038443 Bacteria 1291
569 Ga0395901_0795543 3300038443 Bacteria 935
570 Ga0450909_056652 3300042185 Bacteria 616
571 Ga0439464_0003664 3300042439 Bacteria 3897
572 Ga0451577_0275756 3300042876 Bacteria 1523
573 Ga0466961_0127827 3300044693 Bacteria 1593
574 Ga0466963_0078624 3300044694 Bacteria 2230
575 Ga0466964_0049526 3300044706 Bacteria 1720
576 Ga0466971_0033232 3300044719 Bacteria 2311
577 Ga0466970_0190225 3300044765 Bacteria 1140
578 Ga0466957_0255467 3300044842 Bacteria 1166
579 Ga0466959_0596947 3300045049 Bacteria 743
580 Ga0466958_0258943 3300045836 Bacteria 1113
581 Ga0466958_0336100 3300045836 Bacteria 971
582 Ga0495620_0042146 3300046515 Bacteria 1996
583 Ga0495643_0096292 3300046522 Bacteria 1521
584 Ga0495663_0059024 3300046525 Bacteria 1203
585 Ga0495663_0182087 3300046525 Bacteria 728
586 Ga0495598_0001145 3300046537 Bacteria 5100
587 Ga0495621_0044704 3300046539 Bacteria 1566
588 Ga0495597_0019195 3300046542 Bacteria 3201
589 Ga0495622_0001177 3300046557 Bacteria 13536
590 Ga0495633_0015973 3300046558 Bacteria 3884
591 Ga0495668_0020247 3300046616 Bacteria 3828
592 Ga0495668_0038691 3300046616 Bacteria 2664
593 Ga0495659_0002607 3300046664 Bacteria 5814
594 Ga0495659_0065611 3300046664 Bacteria 1350
595 Ga0495661_0334067 3300046665 Bacteria 750
596 Ga0495588_0064987 3300046674 Bacteria 1893
597 Ga0495669_0011541 3300046684 Bacteria 3753
598 Ga0495669_0011559 3300046684 Bacteria 3751
599 Ga0495669_0013564 3300046684 Bacteria 3475
600 Ga0495669_0020477 3300046684 Bacteria 2864
601 Ga0495669_0036507 3300046684 Bacteria 2172
602 Ga0495669_0062378 3300046684 Bacteria 1689
603 Ga0495670_0039869 3300046691 Bacteria 2343
604 Ga0495670_0188136 3300046691 Bacteria 1091
605 Ga0495636_0053983 3300047318 Bacteria 1688
606 Ga0495683_0039357 3300047323 Bacteria 2390
607 Ga0495593_0043396 3300047673 Bacteria 2410
608 Ga0495602_0227309 3300048088 Bacteria 1404
609 Ga0496101_0251701 3300048904 Bacteria 1376
610 Ga0496102_0351826 3300048905 Bacteria 1387
611 Ga0496103_0016288 3300048906 Bacteria 4437
612 Ga0496105_0103044 3300048908 Bacteria 2357
613 Ga0496106_0347103 3300048909 Bacteria 1192
614 Ga0496107_0011923 3300048910 Bacteria 6070
615 Ga0496108_0734008 3300048911 Bacteria 855
616 Ga0496108_1179051 3300048911 Bacteria 648
617 Ga0496108_1336756 3300048911 Bacteria 601
618 Ga0496109_0040809 3300048912 Bacteria 4204
619 Ga0496109_0346772 3300048912 Bacteria 1402
620 Ga0496109_0451309 3300048912 Bacteria 1214
621 Ga0496109_0697105 3300048912 Bacteria 953
622 Ga0496110_0007383 3300048913 Bacteria 8773
623 Ga0496110_0017892 3300048913 Bacteria 5933
624 Ga0496111_0141209 3300048914 Bacteria 1784
625 Ga0496111_0532492 3300048914 Bacteria 863
626 Ga0496112_0247979 3300048915 Bacteria 1732
627 Ga0496113_0138100 3300048916 Bacteria 1916
628 Ga0496114_0566546 3300048917 Bacteria 1003
629 Ga0496114_0680298 3300048917 Bacteria 903
630 Ga0495682_0041995 3300049460 Bacteria 1676
631 Ga0501036_0569406 3300049572 Bacteria 941
632 Ga0501041_0115290 3300049577 Bacteria 1668
633 Ga0501068_0091796 3300049584 Bacteria 1874
634 Ga0501072_0115968 3300049588 Bacteria 2133
635 Ga0501075_0132269 3300049591 Bacteria 1900
636 Ga0501080_0262972 3300049742 Bacteria 1572
637 Ga0495655_0075872 3300053083 Bacteria 950
638 Ga0495655_0083155 3300053083 Bacteria 919
639 Ga0500583_0130386 3300053092 Bacteria 1247
640 Ga0500651_0057607 3300053093 Bacteria 2431
641 Ga0500566_0013148 3300053094 Bacteria 4876
642 Ga0500572_008898 3300053111 Bacteria 2360
643 Ga0500595_047659 3300053119 Bacteria 1341
644 Ga0500608_002496 3300053122 Bacteria 6705
645 Ga0500614_009590 3300053123 Bacteria 2066
646 Ga0500559_0014120 3300053136 Bacteria 3376
647 Ga0500564_087854 3300053138 Bacteria 1387
648 Ga0500590_078945 3300053148 Bacteria 1620
649 Ga0500619_005334 3300053154 Bacteria 2857
650 Ga0500636_0076147 3300053177 Bacteria 1940
651 Ga0500637_0012520 3300053178 Bacteria 4422
652 Ga0500596_012411 3300053735 Bacteria 1292
653 Ga0466962_0067512 3300061719 Bacteria 1707

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_101136371 Ga0068857_1011363712 151
2 3300025907 Ga0207645_10623905 Ga0207645_106239051 151
3 3300026116 Ga0207674_10971113 Ga0207674_109711132 152
4 3300037312 Ga0395899_0211250 Ga0395899_0211250_132_629 153
5 3300037418 Ga0395900_0144007 Ga0395900_0144007_469_966 153
6 3300037466 Ga0395898_0161649 Ga0395898_0161649_478_975 153
7 3300037471 Ga0395905_0347625 Ga0395905_0347625_791_1288 153
8 3300037471 Ga0395905_0367575 Ga0395905_0367575_44_541 153
9 3300038443 Ga0395901_0317882 Ga0395901_0317882_658_1155 153
10 3300042876 Ga0451577_0275756 Ga0451577_0275756_277_750 157
11 iso_pu_bacteria 2687453257 2688065957 158
12 3300020078 Ga0206352_10340437 Ga0206352_103404373 160
13 3300030735 Ga0316178_1019046 Ga0316178_10190461 160
14 3300013105 Ga0157369_10511676 Ga0157369_105116762 161
15 3300042185 Ga0450909_056652 Ga0450909_056652_71_556 161
16 3300002239 JGI24034J26672_10016617 JGI24034J26672_100166172 162
17 3300005327 Ga0070658_10114206 Ga0070658_101142063 162
18 3300005331 Ga0070670_100050398 Ga0070670_1000503981 162
19 3300005336 Ga0070680_101024698 Ga0070680_1010246981 162
20 3300005339 Ga0070660_100340788 Ga0070660_1003407882 162
21 3300005347 Ga0070668_100000037 Ga0070668_10000003774 162
22 3300005355 Ga0070671_100002365 Ga0070671_10000236514 162
23 3300005530 Ga0070679_100117468 Ga0070679_1001174683 162
24 3300005548 Ga0070665_100016932 Ga0070665_1000169326 162
25 3300005616 Ga0068852_100675250 Ga0068852_1006752501 162
26 3300005617 Ga0068859_100173035 Ga0068859_1001730354 162
27 3300005841 Ga0068863_100000017 Ga0068863_100000017251 162
28 3300005843 Ga0068860_100022422 Ga0068860_10002242211 162
29 3300005844 Ga0068862_100072920 Ga0068862_1000729204 162
30 3300006931 Ga0097620_100173036 Ga0097620_1001730364 162
31 3300009174 Ga0105241_10524818 Ga0105241_105248182 162
32 3300009551 Ga0105238_10438848 Ga0105238_104388481 162
33 3300009553 Ga0105249_10008965 Ga0105249_1000896510 162
34 3300013102 Ga0157371_10523646 Ga0157371_105236462 162
35 3300014497 Ga0182008_10442835 Ga0182008_104428351 162
36 3300025909 Ga0207705_10098604 Ga0207705_100986042 162
37 3300025911 Ga0207654_10293372 Ga0207654_102933722 162
38 3300025913 Ga0207695_10217131 Ga0207695_102171312 162
39 3300025919 Ga0207657_10068704 Ga0207657_100687042 162
40 3300025921 Ga0207652_10411259 Ga0207652_104112592 162
41 3300025925 Ga0207650_11012034 Ga0207650_110120341 162
42 3300025931 Ga0207644_10000145 Ga0207644_1000014571 162
43 3300025949 Ga0207667_10170460 Ga0207667_101704602 162
44 3300025961 Ga0207712_10118774 Ga0207712_101187744 162
45 3300025972 Ga0207668_10000029 Ga0207668_1000002998 162
46 3300025981 Ga0207640_10288210 Ga0207640_102882102 162
47 3300026067 Ga0207678_10026918 Ga0207678_100269185 162
48 3300026088 Ga0207641_10000036 Ga0207641_10000036245 162
49 3300028379 Ga0268266_10019539 Ga0268266_100195399 162
50 3300028380 Ga0268265_10688882 Ga0268265_106888821 162
51 3300028381 Ga0268264_10007570 Ga0268264_1000757010 162
52 3300037853 Ga0436364_0166654 Ga0436364_0166654_207_695 162
53 3300046515 Ga0495620_0042146 Ga0495620_0042146_535_1023 162
54 3300046522 Ga0495643_0096292 Ga0495643_0096292_323_811 162
55 3300046542 Ga0495597_0019195 Ga0495597_0019195_1111_1599 162
56 3300046557 Ga0495622_0001177 Ga0495622_0001177_11691_12179 162
57 3300046616 Ga0495668_0020247 Ga0495668_0020247_792_1280 162
58 3300047673 Ga0495593_0043396 Ga0495593_0043396_261_749 162
59 3300048088 Ga0495602_0227309 Ga0495602_0227309_320_808 162
60 3300049460 Ga0495682_0041995 Ga0495682_0041995_677_1165 162
61 3300053092 Ga0500583_0130386 Ga0500583_0130386_591_1079 162
62 3300053093 Ga0500651_0057607 Ga0500651_0057607_1900_2388 162
63 3300053094 Ga0500566_0013148 Ga0500566_0013148_3807_4295 162
64 3300053111 Ga0500572_008898 Ga0500572_008898_1488_1976 162
65 3300053119 Ga0500595_047659 Ga0500595_047659_664_1152 162
66 3300053122 Ga0500608_002496 Ga0500608_002496_2534_3022 162
67 3300053123 Ga0500614_009590 Ga0500614_009590_582_1070 162
68 3300053136 Ga0500559_0014120 Ga0500559_0014120_382_870 162
69 3300053138 Ga0500564_087854 Ga0500564_087854_52_540 162
70 3300053148 Ga0500590_078945 Ga0500590_078945_102_590 162
71 3300053154 Ga0500619_005334 Ga0500619_005334_1331_1819 162
72 3300053177 Ga0500636_0076147 Ga0500636_0076147_1128_1616 162
73 3300053178 Ga0500637_0012520 Ga0500637_0012520_3025_3513 162
74 3300053735 Ga0500596_012411 Ga0500596_012411_161_649 162
75 3300009551 Ga0105238_10849902 Ga0105238_108499021 163
76 3300013308 Ga0157375_10704767 Ga0157375_107047672 163
77 3300025940 Ga0207691_11069788 Ga0207691_110697881 163
78 3300028381 Ga0268264_10026990 Ga0268264_100269902 163
79 3300002075 JGI24738J21930_10116179 JGI24738J21930_101161791 164
80 3300005327 Ga0070658_10175405 Ga0070658_101754052 164
81 3300005328 Ga0070676_10029039 Ga0070676_100290394 164
82 3300005328 Ga0070676_10043507 Ga0070676_100435073 164
83 3300005330 Ga0070690_100236886 Ga0070690_1002368862 164
84 3300005335 Ga0070666_10211058 Ga0070666_102110582 164
85 3300005344 Ga0070661_100728373 Ga0070661_1007283732 164
86 3300005355 Ga0070671_100309030 Ga0070671_1003090302 164
87 3300005356 Ga0070674_100049894 Ga0070674_1000498944 164
88 3300005364 Ga0070673_100050357 Ga0070673_1000503573 164
89 3300005367 Ga0070667_100111142 Ga0070667_1001111422 164
90 3300005543 Ga0070672_100451389 Ga0070672_1004513892 164
91 3300005548 Ga0070665_100145876 Ga0070665_1001458762 164
92 3300005617 Ga0068859_100031175 Ga0068859_1000311754 164
93 3300005618 Ga0068864_100033988 Ga0068864_1000339886 164
94 3300005834 Ga0068851_10146083 Ga0068851_101460832 164
95 3300005841 Ga0068863_100013325 Ga0068863_1000133258 164
96 3300006358 Ga0068871_100019088 Ga0068871_1000190886 164
97 3300006881 Ga0068865_100060644 Ga0068865_1000606442 164
98 3300006931 Ga0097620_100031175 Ga0097620_1000311754 164
99 3300009093 Ga0105240_11068412 Ga0105240_110684122 164
100 3300009098 Ga0105245_10025575 Ga0105245_100255752 164
101 3300009101 Ga0105247_10170224 Ga0105247_101702242 164
102 3300009148 Ga0105243_10093452 Ga0105243_100934522 164
103 3300009177 Ga0105248_10748816 Ga0105248_107488162 164
104 3300009551 Ga0105238_10108048 Ga0105238_101080483 164
105 3300010375 Ga0105239_10980578 Ga0105239_109805782 164
106 3300013102 Ga0157371_10032397 Ga0157371_100323977 164
107 3300013296 Ga0157374_10434808 Ga0157374_104348082 164
108 3300013296 Ga0157374_10735054 Ga0157374_107350542 164
109 3300013307 Ga0157372_11054279 Ga0157372_110542792 164
110 3300025250 Ga0209026_1030492 Ga0209026_10304921 164
111 3300025907 Ga0207645_10047302 Ga0207645_100473024 164
112 3300025909 Ga0207705_10304205 Ga0207705_103042052 164
113 3300025924 Ga0207694_10353013 Ga0207694_103530132 164
114 3300025927 Ga0207687_10159059 Ga0207687_101590593 164
115 3300025927 Ga0207687_10244056 Ga0207687_102440562 164
116 3300025932 Ga0207690_10162139 Ga0207690_101621393 164
117 3300025933 Ga0207706_10007351 Ga0207706_100073513 164
118 3300025934 Ga0207686_10158382 Ga0207686_101583823 164
119 3300025937 Ga0207669_10149697 Ga0207669_101496973 164
120 3300025941 Ga0207711_10277038 Ga0207711_102770382 164
121 3300025945 Ga0207679_10368489 Ga0207679_103684892 164
122 3300025972 Ga0207668_10607998 Ga0207668_106079982 164
123 3300025986 Ga0207658_10080928 Ga0207658_100809282 164
124 3300026023 Ga0207677_10134660 Ga0207677_101346601 164
125 3300026078 Ga0207702_10104404 Ga0207702_101044043 164
126 3300026121 Ga0207683_10012478 Ga0207683_100124787 164
127 3300026142 Ga0207698_10394762 Ga0207698_103947622 164
128 3300028379 Ga0268266_10407987 Ga0268266_104079872 164
129 3300028381 Ga0268264_12320602 Ga0268264_123206021 164
130 3300034957 Ga0373938_0076778 Ga0373938_0076778_119_613 164
131 3300035691 Ga0373931_0345537 Ga0373931_0345537_34_528 164
132 3300037418 Ga0395900_0027416 Ga0395900_0027416_149_643 164
133 3300037466 Ga0395898_0089245 Ga0395898_0089245_918_1412 164
134 3300038443 Ga0395901_0240981 Ga0395901_0240981_1358_1852 164
135 3300048904 Ga0496101_0251701 Ga0496101_0251701_736_1230 164
136 3300048905 Ga0496102_0351826 Ga0496102_0351826_812_1306 164
137 3300048906 Ga0496103_0016288 Ga0496103_0016288_188_682 164
138 3300048908 Ga0496105_0103044 Ga0496105_0103044_1205_1699 164
139 3300048910 Ga0496107_0011923 Ga0496107_0011923_5478_5972 164
140 3300048911 Ga0496108_1336756 Ga0496108_1336756_90_584 164
141 3300048912 Ga0496109_0346772 Ga0496109_0346772_507_1001 164
142 3300048912 Ga0496109_0451309 Ga0496109_0451309_581_1075 164
143 3300048913 Ga0496110_0017892 Ga0496110_0017892_4934_5428 164
144 3300048914 Ga0496111_0141209 Ga0496111_0141209_253_747 164
145 3300048915 Ga0496112_0247979 Ga0496112_0247979_87_581 164
146 3300048916 Ga0496113_0138100 Ga0496113_0138100_1407_1901 164
147 3300048917 Ga0496114_0566546 Ga0496114_0566546_245_739 164
148 3300001915 JGI24741J21665_1020694 JGI24741J21665_10206942 165
149 3300001979 JGI24740J21852_10010064 JGI24740J21852_100100642 165
150 3300001979 JGI24740J21852_10014842 JGI24740J21852_100148422 165
151 3300001979 JGI24740J21852_10051691 JGI24740J21852_100516912 165
152 3300001989 JGI24739J22299_10001236 JGI24739J22299_100012368 165
153 3300001989 JGI24739J22299_10012130 JGI24739J22299_100121303 165
154 3300001990 JGI24737J22298_10001280 JGI24737J22298_100012808 165
155 3300001991 JGI24743J22301_10010710 JGI24743J22301_100107103 165
156 3300002067 JGI24735J21928_10022144 JGI24735J21928_100221443 165
157 3300002075 JGI24738J21930_10004676 JGI24738J21930_100046765 165
158 3300002075 JGI24738J21930_10009394 JGI24738J21930_100093943 165
159 3300002075 JGI24738J21930_10077866 JGI24738J21930_100778662 165
160 3300003203 JGI25406J46586_10153179 JGI25406J46586_101531791 165
161 3300005290 Ga0065712_10068456 Ga0065712_100684563 165
162 3300005290 Ga0065712_10117367 Ga0065712_101173672 165
163 3300005327 Ga0070658_10001186 Ga0070658_1000118625 165
164 3300005327 Ga0070658_10010418 Ga0070658_100104188 165
165 3300005327 Ga0070658_10078315 Ga0070658_100783152 165
166 3300005327 Ga0070658_10164813 Ga0070658_101648132 165
167 3300005328 Ga0070676_10231108 Ga0070676_102311082 165
168 3300005328 Ga0070676_10255021 Ga0070676_102550212 165
169 3300005328 Ga0070676_10386038 Ga0070676_103860382 165
170 3300005329 Ga0070683_100004557 Ga0070683_10000455713 165
171 3300005329 Ga0070683_100009073 Ga0070683_1000090738 165
172 3300005329 Ga0070683_100092986 Ga0070683_1000929863 165
173 3300005329 Ga0070683_100105954 Ga0070683_1001059543 165
174 3300005331 Ga0070670_100002608 Ga0070670_1000026089 165
175 3300005331 Ga0070670_100021727 Ga0070670_1000217278 165
176 3300005331 Ga0070670_100037531 Ga0070670_1000375315 165
177 3300005331 Ga0070670_100056034 Ga0070670_1000560343 165
178 3300005331 Ga0070670_100122546 Ga0070670_1001225462 165
179 3300005331 Ga0070670_100540607 Ga0070670_1005406072 165
180 3300005333 Ga0070677_10030433 Ga0070677_100304331 165
181 3300005333 Ga0070677_10410202 Ga0070677_104102022 165
182 3300005333 Ga0070677_10472442 Ga0070677_104724422 165
183 3300005334 Ga0068869_100144463 Ga0068869_1001444632 165
184 3300005335 Ga0070666_10011522 Ga0070666_100115222 165
185 3300005335 Ga0070666_10013233 Ga0070666_100132336 165
186 3300005335 Ga0070666_10024213 Ga0070666_100242135 165
187 3300005335 Ga0070666_10029514 Ga0070666_100295144 165
188 3300005335 Ga0070666_10083930 Ga0070666_100839303 165
189 3300005335 Ga0070666_10400570 Ga0070666_104005702 165
190 3300005337 Ga0070682_100347852 Ga0070682_1003478522 165
191 3300005338 Ga0068868_100001432 Ga0068868_10000143220 165
192 3300005338 Ga0068868_100121714 Ga0068868_1001217143 165
193 3300005338 Ga0068868_100445123 Ga0068868_1004451232 165
194 3300005338 Ga0068868_100903308 Ga0068868_1009033082 165
195 3300005339 Ga0070660_100000707 Ga0070660_10000070721 165
196 3300005339 Ga0070660_100006342 Ga0070660_1000063427 165
197 3300005339 Ga0070660_100028508 Ga0070660_1000285081 165
198 3300005339 Ga0070660_100298811 Ga0070660_1002988112 165
199 3300005343 Ga0070687_100291325 Ga0070687_1002913252 165
200 3300005344 Ga0070661_100000101 Ga0070661_10000010161 165
201 3300005344 Ga0070661_100006080 Ga0070661_1000060807 165
202 3300005344 Ga0070661_100011558 Ga0070661_1000115585 165
203 3300005344 Ga0070661_100083601 Ga0070661_1000836013 165
204 3300005344 Ga0070661_100170313 Ga0070661_1001703132 165
205 3300005344 Ga0070661_100720474 Ga0070661_1007204741 165
206 3300005345 Ga0070692_10012745 Ga0070692_100127455 165
207 3300005347 Ga0070668_100746386 Ga0070668_1007463862 165
208 3300005353 Ga0070669_100037548 Ga0070669_1000375482 165
209 3300005353 Ga0070669_100159692 Ga0070669_1001596923 165
210 3300005353 Ga0070669_100184210 Ga0070669_1001842103 165
211 3300005353 Ga0070669_100307334 Ga0070669_1003073341 165
212 3300005353 Ga0070669_100942922 Ga0070669_1009429221 165
213 3300005353 Ga0070669_101109158 Ga0070669_1011091582 165
214 3300005354 Ga0070675_100001714 Ga0070675_10000171414 165
215 3300005354 Ga0070675_100031113 Ga0070675_1000311135 165
216 3300005354 Ga0070675_100041860 Ga0070675_1000418605 165
217 3300005354 Ga0070675_100152720 Ga0070675_1001527202 165
218 3300005354 Ga0070675_100627348 Ga0070675_1006273482 165
219 3300005355 Ga0070671_100002144 Ga0070671_10000214411 165
220 3300005355 Ga0070671_100086364 Ga0070671_1000863644 165
221 3300005355 Ga0070671_100202037 Ga0070671_1002020372 165
222 3300005355 Ga0070671_100256109 Ga0070671_1002561092 165
223 3300005355 Ga0070671_101446392 Ga0070671_1014463921 165
224 3300005356 Ga0070674_100043232 Ga0070674_1000432324 165
225 3300005356 Ga0070674_100141964 Ga0070674_1001419642 165
226 3300005364 Ga0070673_100000809 Ga0070673_1000008098 165
227 3300005364 Ga0070673_100014339 Ga0070673_1000143395 165
228 3300005364 Ga0070673_100026517 Ga0070673_1000265177 165
229 3300005364 Ga0070673_100037408 Ga0070673_1000374082 165
230 3300005364 Ga0070673_100313351 Ga0070673_1003133512 165
231 3300005366 Ga0070659_100000045 Ga0070659_100000045100 165
232 3300005366 Ga0070659_100029842 Ga0070659_1000298426 165
233 3300005366 Ga0070659_100080394 Ga0070659_1000803942 165
234 3300005366 Ga0070659_100441628 Ga0070659_1004416282 165
235 3300005366 Ga0070659_101234341 Ga0070659_1012343411 165
236 3300005366 Ga0070659_101480723 Ga0070659_1014807231 165
237 3300005367 Ga0070667_100021775 Ga0070667_1000217756 165
238 3300005367 Ga0070667_100026727 Ga0070667_1000267276 165
239 3300005367 Ga0070667_100159980 Ga0070667_1001599802 165
240 3300005367 Ga0070667_100877115 Ga0070667_1008771151 165
241 3300005444 Ga0070694_100825067 Ga0070694_1008250671 165
242 3300005455 Ga0070663_100001602 Ga0070663_10000160211 165
243 3300005455 Ga0070663_100030502 Ga0070663_1000305024 165
244 3300005455 Ga0070663_100447075 Ga0070663_1004470752 165
245 3300005455 Ga0070663_100684069 Ga0070663_1006840691 165
246 3300005455 Ga0070663_100945439 Ga0070663_1009454391 165
247 3300005456 Ga0070678_100022589 Ga0070678_1000225892 165
248 3300005457 Ga0070662_100000036 Ga0070662_10000003621 165
249 3300005457 Ga0070662_100006879 Ga0070662_1000068798 165
250 3300005457 Ga0070662_100028207 Ga0070662_1000282073 165
251 3300005457 Ga0070662_100114215 Ga0070662_1001142153 165
252 3300005457 Ga0070662_100268405 Ga0070662_1002684052 165
253 3300005457 Ga0070662_100307970 Ga0070662_1003079702 165
254 3300005457 Ga0070662_100366258 Ga0070662_1003662582 165
255 3300005457 Ga0070662_100408978 Ga0070662_1004089782 165
256 3300005457 Ga0070662_100462982 Ga0070662_1004629822 165
257 3300005457 Ga0070662_101220646 Ga0070662_1012206461 165
258 3300005458 Ga0070681_10079481 Ga0070681_100794815 165
259 3300005458 Ga0070681_10807015 Ga0070681_108070152 165
260 3300005530 Ga0070679_100256058 Ga0070679_1002560582 165
261 3300005530 Ga0070679_100442957 Ga0070679_1004429571 165
262 3300005530 Ga0070679_100560894 Ga0070679_1005608942 165
263 3300005535 Ga0070684_100141106 Ga0070684_1001411062 165
264 3300005539 Ga0068853_100000059 Ga0068853_10000005971 165
265 3300005539 Ga0068853_100063347 Ga0068853_1000633474 165
266 3300005539 Ga0068853_100571222 Ga0068853_1005712222 165
267 3300005543 Ga0070672_100000841 Ga0070672_1000008418 165
268 3300005543 Ga0070672_100017944 Ga0070672_1000179443 165
269 3300005543 Ga0070672_100116825 Ga0070672_1001168254 165
270 3300005545 Ga0070695_100304238 Ga0070695_1003042382 165
271 3300005546 Ga0070696_100215402 Ga0070696_1002154023 165
272 3300005547 Ga0070693_100002442 Ga0070693_1000024429 165
273 3300005548 Ga0070665_100009353 Ga0070665_10000935310 165
274 3300005548 Ga0070665_100018026 Ga0070665_1000180268 165
275 3300005548 Ga0070665_100022026 Ga0070665_1000220268 165
276 3300005548 Ga0070665_100106194 Ga0070665_1001061942 165
277 3300005548 Ga0070665_100241751 Ga0070665_1002417512 165
278 3300005563 Ga0068855_100003816 Ga0068855_10000381618 165
279 3300005563 Ga0068855_100051577 Ga0068855_1000515772 165
280 3300005563 Ga0068855_100325153 Ga0068855_1003251533 165
281 3300005563 Ga0068855_100411460 Ga0068855_1004114602 165
282 3300005564 Ga0070664_100000027 Ga0070664_10000002721 165
283 3300005564 Ga0070664_100001887 Ga0070664_1000018878 165
284 3300005564 Ga0070664_100023734 Ga0070664_1000237344 165
285 3300005564 Ga0070664_100118968 Ga0070664_1001189682 165
286 3300005564 Ga0070664_100430810 Ga0070664_1004308102 165
287 3300005564 Ga0070664_100757234 Ga0070664_1007572342 165
288 3300005577 Ga0068857_100021317 Ga0068857_1000213172 165
289 3300005577 Ga0068857_100035284 Ga0068857_1000352842 165
290 3300005578 Ga0068854_100002620 Ga0068854_1000026209 165
291 3300005578 Ga0068854_100006961 Ga0068854_1000069614 165
292 3300005578 Ga0068854_100010386 Ga0068854_1000103865 165
293 3300005578 Ga0068854_100589527 Ga0068854_1005895272 165
294 3300005614 Ga0068856_100000699 Ga0068856_10000069921 165
295 3300005614 Ga0068856_100060969 Ga0068856_1000609696 165
296 3300005614 Ga0068856_101249569 Ga0068856_1012495691 165
297 3300005616 Ga0068852_100000647 Ga0068852_10000064721 165
298 3300005616 Ga0068852_100019017 Ga0068852_1000190175 165
299 3300005616 Ga0068852_100054625 Ga0068852_1000546253 165
300 3300005616 Ga0068852_100229253 Ga0068852_1002292531 165
301 3300005616 Ga0068852_100297209 Ga0068852_1002972093 165
302 3300005617 Ga0068859_100034991 Ga0068859_1000349912 165
303 3300005617 Ga0068859_100116695 Ga0068859_1001166954 165
304 3300005617 Ga0068859_100620673 Ga0068859_1006206732 165
305 3300005618 Ga0068864_100013694 Ga0068864_1000136945 165
306 3300005618 Ga0068864_100018649 Ga0068864_1000186497 165
307 3300005834 Ga0068851_10015145 Ga0068851_100151454 165
308 3300005834 Ga0068851_10146969 Ga0068851_101469692 165
309 3300005841 Ga0068863_100293959 Ga0068863_1002939593 165
310 3300005841 Ga0068863_100371305 Ga0068863_1003713052 165
311 3300005841 Ga0068863_100452671 Ga0068863_1004526712 165
312 3300005842 Ga0068858_100001436 Ga0068858_1000014366 165
313 3300005842 Ga0068858_100011909 Ga0068858_1000119094 165
314 3300005842 Ga0068858_100105083 Ga0068858_1001050834 165
315 3300005843 Ga0068860_100280367 Ga0068860_1002803672 165
316 3300005843 Ga0068860_100396393 Ga0068860_1003963932 165
317 3300005843 Ga0068860_101109410 Ga0068860_1011094102 165
318 3300005985 Ga0081539_10281172 Ga0081539_102811722 165
319 3300006058 Ga0075432_10260207 Ga0075432_102602072 165
320 3300006237 Ga0097621_100738190 Ga0097621_1007381902 165
321 3300006237 Ga0097621_101962914 Ga0097621_1019629141 165
322 3300006358 Ga0068871_100607748 Ga0068871_1006077482 165
323 3300006846 Ga0075430_100158655 Ga0075430_1001586552 165
324 3300006880 Ga0075429_100478694 Ga0075429_1004786942 165
325 3300006881 Ga0068865_100061757 Ga0068865_1000617574 165
326 3300006931 Ga0097620_100034990 Ga0097620_1000349902 165
327 3300006931 Ga0097620_100116698 Ga0097620_1001166984 165
328 3300006931 Ga0097620_100620630 Ga0097620_1006206302 165
329 3300009093 Ga0105240_10010384 Ga0105240_100103849 165
330 3300009094 Ga0111539_11322747 Ga0111539_113227472 165
331 3300009174 Ga0105241_10622026 Ga0105241_106220262 165
332 3300009177 Ga0105248_10001529 Ga0105248_1000152912 165
333 3300009177 Ga0105248_10007926 Ga0105248_100079268 165
334 3300009177 Ga0105248_10577592 Ga0105248_105775922 165
335 3300009177 Ga0105248_12350139 Ga0105248_123501391 165
336 3300009551 Ga0105238_10053894 Ga0105238_100538942 165
337 3300009551 Ga0105238_10129953 Ga0105238_101299533 165
338 3300009553 Ga0105249_10773075 Ga0105249_107730752 165
339 3300013100 Ga0157373_10189860 Ga0157373_101898603 165
340 3300013100 Ga0157373_10684424 Ga0157373_106844242 165
341 3300013102 Ga0157371_10004543 Ga0157371_1000454312 165
342 3300013102 Ga0157371_10029097 Ga0157371_100290975 165
343 3300013102 Ga0157371_10489506 Ga0157371_104895062 165
344 3300013104 Ga0157370_10008454 Ga0157370_1000845412 165
345 3300013104 Ga0157370_10465274 Ga0157370_104652742 165
346 3300013105 Ga0157369_10099482 Ga0157369_100994823 165
347 3300013105 Ga0157369_10361778 Ga0157369_103617782 165
348 3300013105 Ga0157369_12183949 Ga0157369_121839491 165
349 3300013296 Ga0157374_10010355 Ga0157374_100103554 165
350 3300013296 Ga0157374_10040864 Ga0157374_100408642 165
351 3300013297 Ga0157378_10840045 Ga0157378_108400452 165
352 3300013306 Ga0163162_10012953 Ga0163162_100129534 165
353 3300013306 Ga0163162_10721395 Ga0163162_107213952 165
354 3300013307 Ga0157372_10009481 Ga0157372_100094816 165
355 3300013307 Ga0157372_10209612 Ga0157372_102096123 165
356 3300013308 Ga0157375_10050138 Ga0157375_100501382 165
357 3300013308 Ga0157375_10763645 Ga0157375_107636452 165
358 3300013308 Ga0157375_10781847 Ga0157375_107818471 165
359 3300014325 Ga0163163_10000187 Ga0163163_1000018757 165
360 3300014326 Ga0157380_11915642 Ga0157380_119156422 165
361 3300014968 Ga0157379_10095031 Ga0157379_100950312 165
362 3300017792 Ga0163161_10041659 Ga0163161_100416594 165
363 3300025315 Ga0207697_10028036 Ga0207697_100280363 165
364 3300025315 Ga0207697_10222505 Ga0207697_102225051 165
365 3300025321 Ga0207656_10016002 Ga0207656_100160023 165
366 3300025321 Ga0207656_10024806 Ga0207656_100248064 165
367 3300025893 Ga0207682_10328123 Ga0207682_103281232 165
368 3300025893 Ga0207682_10360451 Ga0207682_103604511 165
369 3300025901 Ga0207688_10583593 Ga0207688_105835932 165
370 3300025903 Ga0207680_10000896 Ga0207680_100008969 165
371 3300025903 Ga0207680_10001103 Ga0207680_100011032 165
372 3300025903 Ga0207680_10022675 Ga0207680_100226752 165
373 3300025903 Ga0207680_10319440 Ga0207680_103194402 165
374 3300025903 Ga0207680_10452914 Ga0207680_104529142 165
375 3300025904 Ga0207647_10016771 Ga0207647_100167718 165
376 3300025904 Ga0207647_10027617 Ga0207647_100276175 165
377 3300025904 Ga0207647_10046780 Ga0207647_100467802 165
378 3300025904 Ga0207647_10097430 Ga0207647_100974302 165
379 3300025907 Ga0207645_10224690 Ga0207645_102246902 165
380 3300025907 Ga0207645_10327103 Ga0207645_103271032 165
381 3300025909 Ga0207705_10000912 Ga0207705_1000091229 165
382 3300025909 Ga0207705_10042473 Ga0207705_100424733 165
383 3300025909 Ga0207705_10090003 Ga0207705_100900032 165
384 3300025909 Ga0207705_10160813 Ga0207705_101608132 165
385 3300025909 Ga0207705_10209519 Ga0207705_102095193 165
386 3300025909 Ga0207705_10372357 Ga0207705_103723572 165
387 3300025909 Ga0207705_10474475 Ga0207705_104744752 165
388 3300025912 Ga0207707_10233209 Ga0207707_102332093 165
389 3300025912 Ga0207707_10239796 Ga0207707_102397962 165
390 3300025913 Ga0207695_10004614 Ga0207695_100046149 165
391 3300025917 Ga0207660_10094066 Ga0207660_100940663 165
392 3300025919 Ga0207657_10000133 Ga0207657_1000013382 165
393 3300025919 Ga0207657_10003883 Ga0207657_1000388312 165
394 3300025919 Ga0207657_10005051 Ga0207657_100050515 165
395 3300025919 Ga0207657_10169942 Ga0207657_101699422 165
396 3300025919 Ga0207657_10261527 Ga0207657_102615272 165
397 3300025919 Ga0207657_10875150 Ga0207657_108751502 165
398 3300025920 Ga0207649_10000680 Ga0207649_1000068011 165
399 3300025920 Ga0207649_10014355 Ga0207649_100143553 165
400 3300025920 Ga0207649_10043625 Ga0207649_100436253 165
401 3300025920 Ga0207649_10075399 Ga0207649_100753993 165
402 3300025920 Ga0207649_10096230 Ga0207649_100962302 165
403 3300025920 Ga0207649_10243205 Ga0207649_102432051 165
404 3300025920 Ga0207649_10503584 Ga0207649_105035842 165
405 3300025920 Ga0207649_10577621 Ga0207649_105776212 165
406 3300025921 Ga0207652_10004117 Ga0207652_1000411715 165
407 3300025921 Ga0207652_10700728 Ga0207652_107007281 165
408 3300025923 Ga0207681_10061772 Ga0207681_100617723 165
409 3300025923 Ga0207681_10110624 Ga0207681_101106243 165
410 3300025923 Ga0207681_10155828 Ga0207681_101558281 165
411 3300025923 Ga0207681_10182466 Ga0207681_101824662 165
412 3300025923 Ga0207681_10254900 Ga0207681_102549002 165
413 3300025923 Ga0207681_10301952 Ga0207681_103019522 165
414 3300025923 Ga0207681_10389530 Ga0207681_103895302 165
415 3300025923 Ga0207681_11045414 Ga0207681_110454141 165
416 3300025924 Ga0207694_10031714 Ga0207694_100317147 165
417 3300025925 Ga0207650_10004757 Ga0207650_1000475711 165
418 3300025925 Ga0207650_10048011 Ga0207650_100480114 165
419 3300025925 Ga0207650_10088564 Ga0207650_100885642 165
420 3300025925 Ga0207650_10163718 Ga0207650_101637182 165
421 3300025925 Ga0207650_10492157 Ga0207650_104921571 165
422 3300025926 Ga0207659_10001712 Ga0207659_1000171215 165
423 3300025926 Ga0207659_10013351 Ga0207659_100133512 165
424 3300025926 Ga0207659_10070747 Ga0207659_100707471 165
425 3300025926 Ga0207659_10131259 Ga0207659_101312592 165
426 3300025926 Ga0207659_10255685 Ga0207659_102556853 165
427 3300025926 Ga0207659_10563406 Ga0207659_105634062 165
428 3300025931 Ga0207644_10028004 Ga0207644_100280043 165
429 3300025931 Ga0207644_10039094 Ga0207644_100390942 165
430 3300025931 Ga0207644_10048420 Ga0207644_100484202 165
431 3300025931 Ga0207644_10252557 Ga0207644_102525572 165
432 3300025932 Ga0207690_10000080 Ga0207690_1000008071 165
433 3300025932 Ga0207690_10122599 Ga0207690_101225992 165
434 3300025932 Ga0207690_10191170 Ga0207690_101911702 165
435 3300025933 Ga0207706_10000159 Ga0207706_1000015982 165
436 3300025933 Ga0207706_10005845 Ga0207706_1000584511 165
437 3300025933 Ga0207706_10012188 Ga0207706_100121884 165
438 3300025933 Ga0207706_10016374 Ga0207706_100163746 165
439 3300025933 Ga0207706_10022333 Ga0207706_100223337 165
440 3300025933 Ga0207706_10052604 Ga0207706_100526044 165
441 3300025933 Ga0207706_10065216 Ga0207706_100652165 165
442 3300025933 Ga0207706_10126577 Ga0207706_101265774 165
443 3300025933 Ga0207706_10823916 Ga0207706_108239162 165
444 3300025936 Ga0207670_10251706 Ga0207670_102517062 165
445 3300025936 Ga0207670_10397142 Ga0207670_103971422 165
446 3300025937 Ga0207669_10013884 Ga0207669_100138843 165
447 3300025937 Ga0207669_10086594 Ga0207669_100865944 165
448 3300025940 Ga0207691_10002529 Ga0207691_100025299 165
449 3300025940 Ga0207691_10248236 Ga0207691_102482362 165
450 3300025940 Ga0207691_10288558 Ga0207691_102885583 165
451 3300025940 Ga0207691_11215090 Ga0207691_112150901 165
452 3300025941 Ga0207711_10007466 Ga0207711_100074664 165
453 3300025941 Ga0207711_10019049 Ga0207711_100190498 165
454 3300025941 Ga0207711_10029794 Ga0207711_100297944 165
455 3300025941 Ga0207711_10455616 Ga0207711_104556162 165
456 3300025944 Ga0207661_10038601 Ga0207661_100386012 165
457 3300025944 Ga0207661_10051516 Ga0207661_100515164 165
458 3300025944 Ga0207661_10102387 Ga0207661_101023872 165
459 3300025944 Ga0207661_10164037 Ga0207661_101640371 165
460 3300025945 Ga0207679_10001226 Ga0207679_100012262 165
461 3300025945 Ga0207679_10008147 Ga0207679_100081478 165
462 3300025945 Ga0207679_10657260 Ga0207679_106572602 165
463 3300025945 Ga0207679_10791595 Ga0207679_107915952 165
464 3300025945 Ga0207679_11125821 Ga0207679_111258212 165
465 3300025949 Ga0207667_10005833 Ga0207667_1000583312 165
466 3300025949 Ga0207667_10007031 Ga0207667_100070318 165
467 3300025949 Ga0207667_11275056 Ga0207667_112750562 165
468 3300025960 Ga0207651_10029148 Ga0207651_100291482 165
469 3300025960 Ga0207651_10253837 Ga0207651_102538372 165
470 3300025960 Ga0207651_10423125 Ga0207651_104231252 165
471 3300025961 Ga0207712_10089823 Ga0207712_100898232 165
472 3300025972 Ga0207668_10148409 Ga0207668_101484092 165
473 3300025972 Ga0207668_10585121 Ga0207668_105851212 165
474 3300025981 Ga0207640_10001181 Ga0207640_1000118110 165
475 3300025981 Ga0207640_10155332 Ga0207640_101553322 165
476 3300025981 Ga0207640_10687074 Ga0207640_106870742 165
477 3300025986 Ga0207658_10044959 Ga0207658_100449595 165
478 3300025986 Ga0207658_10058789 Ga0207658_100587894 165
479 3300025986 Ga0207658_10075335 Ga0207658_100753353 165
480 3300026023 Ga0207677_10016567 Ga0207677_100165672 165
481 3300026035 Ga0207703_10004976 Ga0207703_1000497611 165
482 3300026035 Ga0207703_10012033 Ga0207703_100120338 165
483 3300026035 Ga0207703_10014199 Ga0207703_100141994 165
484 3300026041 Ga0207639_10001590 Ga0207639_1000159012 165
485 3300026041 Ga0207639_10609663 Ga0207639_106096632 165
486 3300026041 Ga0207639_10635847 Ga0207639_106358472 165
487 3300026041 Ga0207639_11467371 Ga0207639_114673711 165
488 3300026067 Ga0207678_10003713 Ga0207678_1000371312 165
489 3300026067 Ga0207678_10017778 Ga0207678_100177786 165
490 3300026067 Ga0207678_10126739 Ga0207678_101267393 165
491 3300026067 Ga0207678_10131551 Ga0207678_101315512 165
492 3300026067 Ga0207678_10254631 Ga0207678_102546313 165
493 3300026078 Ga0207702_10000246 Ga0207702_100002469 165
494 3300026078 Ga0207702_10297875 Ga0207702_102978753 165
495 3300026078 Ga0207702_10363223 Ga0207702_103632232 165
496 3300026088 Ga0207641_10040156 Ga0207641_100401563 165
497 3300026088 Ga0207641_10406726 Ga0207641_104067262 165
498 3300026088 Ga0207641_10430237 Ga0207641_104302372 165
499 3300026089 Ga0207648_10506200 Ga0207648_105062002 165
500 3300026095 Ga0207676_10186455 Ga0207676_101864553 165
501 3300026095 Ga0207676_10460221 Ga0207676_104602211 165
502 3300026116 Ga0207674_10009817 Ga0207674_1000981711 165
503 3300026116 Ga0207674_10048018 Ga0207674_100480186 165
504 3300026121 Ga0207683_10027998 Ga0207683_100279982 165
505 3300026121 Ga0207683_10282213 Ga0207683_102822132 165
506 3300026142 Ga0207698_10000759 Ga0207698_1000075912 165
507 3300026142 Ga0207698_10024082 Ga0207698_100240826 165
508 3300026142 Ga0207698_10070313 Ga0207698_100703135 165
509 3300026142 Ga0207698_10234705 Ga0207698_102347053 165
510 3300026142 Ga0207698_10494010 Ga0207698_104940102 165
511 3300026142 Ga0207698_11475287 Ga0207698_114752871 165
512 3300027876 Ga0209974_10056674 Ga0209974_100566742 165
513 3300027907 Ga0207428_10874123 Ga0207428_108741231 165
514 3300028379 Ga0268266_10012378 Ga0268266_100123788 165
515 3300028379 Ga0268266_10029745 Ga0268266_100297452 165
516 3300028379 Ga0268266_10038097 Ga0268266_100380974 165
517 3300028379 Ga0268266_10065905 Ga0268266_100659052 165
518 3300028380 Ga0268265_10246843 Ga0268265_102468432 165
519 3300028381 Ga0268264_10120588 Ga0268264_101205883 165
520 3300028381 Ga0268264_10132890 Ga0268264_101328902 165
521 3300031251 Ga0265327_10026289 Ga0265327_100262893 165
522 3300031548 Ga0307408_100019242 Ga0307408_1000192426 165
523 3300031548 Ga0307408_100078786 Ga0307408_1000787863 165
524 3300031731 Ga0307405_10173335 Ga0307405_101733352 165
525 3300031731 Ga0307405_10790121 Ga0307405_107901212 165
526 3300031824 Ga0307413_10037496 Ga0307413_100374963 165
527 3300031824 Ga0307413_10142862 Ga0307413_101428622 165
528 3300031824 Ga0307413_10254331 Ga0307413_102543312 165
529 3300031824 Ga0307413_10425741 Ga0307413_104257412 165
530 3300031824 Ga0307413_10935868 Ga0307413_109358682 165
531 3300031852 Ga0307410_10000318 Ga0307410_1000031816 165
532 3300031852 Ga0307410_10033090 Ga0307410_100330904 165
533 3300031852 Ga0307410_10038729 Ga0307410_100387293 165
534 3300031852 Ga0307410_10184712 Ga0307410_101847122 165
535 3300031852 Ga0307410_10242133 Ga0307410_102421332 165
536 3300031852 Ga0307410_11257112 Ga0307410_112571122 165
537 3300031901 Ga0307406_10117751 Ga0307406_101177512 165
538 3300031901 Ga0307406_10120499 Ga0307406_101204992 165
539 3300031901 Ga0307406_10203884 Ga0307406_102038843 165
540 3300031911 Ga0307412_10036091 Ga0307412_100360912 165
541 3300031911 Ga0307412_10143732 Ga0307412_101437323 165
542 3300031911 Ga0307412_10315175 Ga0307412_103151751 165
543 3300031911 Ga0307412_10600551 Ga0307412_106005512 165
544 3300031911 Ga0307412_10683428 Ga0307412_106834282 165
545 3300031995 Ga0307409_100016988 Ga0307409_1000169881 165
546 3300031995 Ga0307409_100137087 Ga0307409_1001370873 165
547 3300031995 Ga0307409_100195101 Ga0307409_1001951012 165
548 3300031995 Ga0307409_100561639 Ga0307409_1005616392 165
549 3300031995 Ga0307409_100689919 Ga0307409_1006899192 165
550 3300032002 Ga0307416_100031399 Ga0307416_1000313993 165
551 3300032002 Ga0307416_100031584 Ga0307416_1000315845 165
552 3300032002 Ga0307416_100276263 Ga0307416_1002762632 165
553 3300032002 Ga0307416_100619393 Ga0307416_1006193932 165
554 3300032002 Ga0307416_101083653 Ga0307416_1010836532 165
555 3300032002 Ga0307416_101119731 Ga0307416_1011197312 165
556 3300032004 Ga0307414_10002184 Ga0307414_100021844 165
557 3300032004 Ga0307414_10003044 Ga0307414_100030443 165
558 3300032004 Ga0307414_10074760 Ga0307414_100747603 165
559 3300032004 Ga0307414_10196687 Ga0307414_101966872 165
560 3300032005 Ga0307411_10021174 Ga0307411_100211742 165
561 3300032005 Ga0307411_10052358 Ga0307411_100523584 165
562 3300032005 Ga0307411_10204897 Ga0307411_102048972 165
563 3300032126 Ga0307415_100007926 Ga0307415_1000079264 165
564 3300032126 Ga0307415_100190779 Ga0307415_1001907793 165
565 3300032126 Ga0307415_101185178 Ga0307415_1011851782 165
566 3300034820 Ga0373959_0098206 Ga0373959_0098206_107_604 165
567 3300035085 Ga0373929_0083490 Ga0373929_0083490_50_547 165
568 3300035121 Ga0373960_0082981 Ga0373960_0082981_125_622 165
569 3300037312 Ga0395899_0010088 Ga0395899_0010088_239_736 165
570 3300037312 Ga0395899_0013975 Ga0395899_0013975_229_726 165
571 3300037312 Ga0395899_0014720 Ga0395899_0014720_3950_4447 165
572 3300037312 Ga0395899_0031251 Ga0395899_0031251_379_876 165
573 3300037312 Ga0395899_0128790 Ga0395899_0128790_866_1363 165
574 3300037312 Ga0395899_0450918 Ga0395899_0450918_182_679 165
575 3300037418 Ga0395900_0006695 Ga0395900_0006695_4461_4961 165
576 3300037418 Ga0395900_0011778 Ga0395900_0011778_8028_8525 165
577 3300037418 Ga0395900_0018717 Ga0395900_0018717_3712_4209 165
578 3300037418 Ga0395900_0030421 Ga0395900_0030421_4822_5319 165
579 3300037418 Ga0395900_0037001 Ga0395900_0037001_3666_4163 165
580 3300037418 Ga0395900_0091833 Ga0395900_0091833_1513_2010 165
581 3300037418 Ga0395900_0091851 Ga0395900_0091851_1034_1534 165
582 3300037418 Ga0395900_0145621 Ga0395900_0145621_1532_2029 165
583 3300037418 Ga0395900_0168774 Ga0395900_0168774_1455_1952 165
584 3300037418 Ga0395900_0238708 Ga0395900_0238708_596_1093 165
585 3300037418 Ga0395900_0302554 Ga0395900_0302554_790_1287 165
586 3300037466 Ga0395898_0035058 Ga0395898_0035058_2628_3125 165
587 3300037466 Ga0395898_0064763 Ga0395898_0064763_379_876 165
588 3300037466 Ga0395898_0398552 Ga0395898_0398552_120_617 165
589 3300037471 Ga0395905_0000187 Ga0395905_0000187_35408_35905 165
590 3300037471 Ga0395905_0000215 Ga0395905_0000215_43653_44150 165
591 3300037471 Ga0395905_0008278 Ga0395905_0008278_8701_9198 165
592 3300037471 Ga0395905_0017175 Ga0395905_0017175_4741_5241 165
593 3300037471 Ga0395905_0034610 Ga0395905_0034610_56_553 165
594 3300037471 Ga0395905_0122444 Ga0395905_0122444_1029_1526 165
595 3300037471 Ga0395905_0266814 Ga0395905_0266814_507_1004 165
596 3300037471 Ga0395905_0300883 Ga0395905_0300883_948_1445 165
597 3300037471 Ga0395905_0341959 Ga0395905_0341959_98_595 165
598 3300037471 Ga0395905_0586353 Ga0395905_0586353_189_686 165
599 3300037471 Ga0395905_0628439 Ga0395905_0628439_86_586 165
600 3300038443 Ga0395901_0000876 Ga0395901_0000876_27945_28442 165
601 3300038443 Ga0395901_0001382 Ga0395901_0001382_11290_11787 165
602 3300038443 Ga0395901_0104829 Ga0395901_0104829_578_1078 165
603 3300038443 Ga0395901_0129726 Ga0395901_0129726_307_807 165
604 3300038443 Ga0395901_0188467 Ga0395901_0188467_879_1376 165
605 3300038443 Ga0395901_0436348 Ga0395901_0436348_406_903 165
606 3300038443 Ga0395901_0465587 Ga0395901_0465587_450_947 165
607 3300038443 Ga0395901_0795543 Ga0395901_0795543_350_847 165
608 3300042439 Ga0439464_0003664 Ga0439464_0003664_797_1294 165
609 3300044693 Ga0466961_0127827 Ga0466961_0127827_11_508 165
610 3300044694 Ga0466963_0078624 Ga0466963_0078624_831_1328 165
611 3300044706 Ga0466964_0049526 Ga0466964_0049526_318_815 165
612 3300044719 Ga0466971_0033232 Ga0466971_0033232_903_1400 165
613 3300044765 Ga0466970_0190225 Ga0466970_0190225_35_532 165
614 3300044842 Ga0466957_0255467 Ga0466957_0255467_324_821 165
615 3300045049 Ga0466959_0596947 Ga0466959_0596947_146_643 165
616 3300045836 Ga0466958_0258943 Ga0466958_0258943_78_575 165
617 3300045836 Ga0466958_0336100 Ga0466958_0336100_185_682 165
618 3300046525 Ga0495663_0059024 Ga0495663_0059024_59_556 165
619 3300046525 Ga0495663_0182087 Ga0495663_0182087_53_550 165
620 3300046537 Ga0495598_0001145 Ga0495598_0001145_3374_3874 165
621 3300046539 Ga0495621_0044704 Ga0495621_0044704_24_524 165
622 3300046558 Ga0495633_0015973 Ga0495633_0015973_465_965 165
623 3300046616 Ga0495668_0038691 Ga0495668_0038691_1399_1896 165
624 3300046664 Ga0495659_0002607 Ga0495659_0002607_1293_1793 165
625 3300046664 Ga0495659_0065611 Ga0495659_0065611_77_577 165
626 3300046665 Ga0495661_0334067 Ga0495661_0334067_74_571 165
627 3300046674 Ga0495588_0064987 Ga0495588_0064987_974_1471 165
628 3300046684 Ga0495669_0011541 Ga0495669_0011541_1725_2222 165
629 3300046684 Ga0495669_0011559 Ga0495669_0011559_2213_2710 165
630 3300046684 Ga0495669_0013564 Ga0495669_0013564_192_692 165
631 3300046684 Ga0495669_0020477 Ga0495669_0020477_2064_2561 165
632 3300046684 Ga0495669_0036507 Ga0495669_0036507_1629_2126 165
633 3300046684 Ga0495669_0062378 Ga0495669_0062378_556_1053 165
634 3300046691 Ga0495670_0039869 Ga0495670_0039869_1643_2143 165
635 3300046691 Ga0495670_0188136 Ga0495670_0188136_552_1052 165
636 3300047318 Ga0495636_0053983 Ga0495636_0053983_810_1307 165
637 3300047323 Ga0495683_0039357 Ga0495683_0039357_160_657 165
638 3300048909 Ga0496106_0347103 Ga0496106_0347103_309_806 165
639 3300048911 Ga0496108_0734008 Ga0496108_0734008_315_812 165
640 3300048911 Ga0496108_1179051 Ga0496108_1179051_127_624 165
641 3300048912 Ga0496109_0040809 Ga0496109_0040809_480_977 165
642 3300048912 Ga0496109_0697105 Ga0496109_0697105_246_743 165
643 3300048913 Ga0496110_0007383 Ga0496110_0007383_3199_3696 165
644 3300048914 Ga0496111_0532492 Ga0496111_0532492_122_619 165
645 3300048917 Ga0496114_0680298 Ga0496114_0680298_302_799 165
646 3300049572 Ga0501036_0569406 Ga0501036_0569406_180_746 165
647 3300049577 Ga0501041_0115290 Ga0501041_0115290_252_818 165
648 3300049584 Ga0501068_0091796 Ga0501068_0091796_1328_1825 165
649 3300049588 Ga0501072_0115968 Ga0501072_0115968_102_668 165
650 3300049591 Ga0501075_0132269 Ga0501075_0132269_1076_1642 165
651 3300049742 Ga0501080_0262972 Ga0501080_0262972_93_659 165
652 3300053083 Ga0495655_0075872 Ga0495655_0075872_74_571 165
653 3300053083 Ga0495655_0083155 Ga0495655_0083155_261_758 165
654 3300061719 Ga0466962_0067512 Ga0466962_0067512_322_819 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

3

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.946 4 157
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9308 4 157
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9273 4 157
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9245 4 157
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9137 4 157
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9388 4 157 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9198 4 157 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8778 75 120 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7221 9 116 3.10.180.10
af_I1N1R1_19_162_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7046 5 120 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3P670-F1-model_v4 deleted 1.001 83 159
AF-A0A534H6Z1-F1-model_v4 VOC family protein 0.9983 80 161
AF-K1YPH7-F1-model_v4 PhnB-like domain-containing protein 0.9971 98 159
AF-A0A7W0WRQ8-F1-model_v4 VOC family protein 0.9934 85 159
AF-A0A435UWU8-F1-model_v4 deleted 0.991 78 159

Feature Viewer

pLDDT pTM Quality
91.2 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map