F472862
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 654 | 235 | 653 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0211250|Ga0395899_0211250_132_629 |
| Length | 153 |
| Sequence | MTNKLTTCLWFDRGEARKAAEFYASVFPDSHVGKAHNAPGVDFTVLGQSFVGLNGGDMFKPNEAVSFMIVTENQEETDRYWNAIVGNGGQESQCGWCKDKWGFSWQITPRVLLEAMDNPDRAAAKRAFEAMMSMQKIDVAKIEAALAGETADA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 162 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 163 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 172 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 177 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 222 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 223 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 224 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 225 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 226 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 227 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 228 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 229 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 230 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 231 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 232 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 233 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 234 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 235 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.15 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0 |
| Rhizoplane | 3.21 |
| Rhizosphere | 94.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1020694 | 3300001915 | Bacteria | 1033 |
| 2 | JGI24740J21852_10010064 | 3300001979 | Bacteria | 3663 |
| 3 | JGI24740J21852_10014842 | 3300001979 | Bacteria | 2861 |
| 4 | JGI24740J21852_10051691 | 3300001979 | Bacteria | 1174 |
| 5 | JGI24739J22299_10001236 | 3300001989 | Bacteria | 9612 |
| 6 | JGI24739J22299_10012130 | 3300001989 | Bacteria | 3165 |
| 7 | JGI24737J22298_10001280 | 3300001990 | Bacteria | 8902 |
| 8 | JGI24743J22301_10010710 | 3300001991 | Bacteria | 1640 |
| 9 | JGI24735J21928_10022144 | 3300002067 | Bacteria | 1937 |
| 10 | JGI24738J21930_10004676 | 3300002075 | Bacteria | 3334 |
| 11 | JGI24738J21930_10009394 | 3300002075 | Bacteria | 2201 |
| 12 | JGI24738J21930_10077866 | 3300002075 | Bacteria | 692 |
| 13 | JGI24738J21930_10116179 | 3300002075 | Bacteria | 579 |
| 14 | JGI24034J26672_10016617 | 3300002239 | Bacteria | 1134 |
| 15 | JGI25406J46586_10153179 | 3300003203 | Bacteria | 673 |
| 16 | Ga0065712_10068456 | 3300005290 | Bacteria | 10541 |
| 17 | Ga0065712_10117367 | 3300005290 | Bacteria | 1721 |
| 18 | Ga0070658_10001186 | 3300005327 | Bacteria | 22303 |
| 19 | Ga0070658_10010418 | 3300005327 | Bacteria | 7455 |
| 20 | Ga0070658_10078315 | 3300005327 | Bacteria | 2713 |
| 21 | Ga0070658_10114206 | 3300005327 | Bacteria | 2239 |
| 22 | Ga0070658_10164813 | 3300005327 | Bacteria | 1860 |
| 23 | Ga0070658_10175405 | 3300005327 | Bacteria | 1802 |
| 24 | Ga0070676_10029039 | 3300005328 | Bacteria | 3143 |
| 25 | Ga0070676_10043507 | 3300005328 | Bacteria | 2611 |
| 26 | Ga0070676_10231108 | 3300005328 | Bacteria | 1226 |
| 27 | Ga0070676_10255021 | 3300005328 | Bacteria | 1172 |
| 28 | Ga0070676_10386038 | 3300005328 | Bacteria | 971 |
| 29 | Ga0070683_100004557 | 3300005329 | Bacteria | 11439 |
| 30 | Ga0070683_100009073 | 3300005329 | Bacteria | 8487 |
| 31 | Ga0070683_100092986 | 3300005329 | Bacteria | 2833 |
| 32 | Ga0070683_100105954 | 3300005329 | Bacteria | 2650 |
| 33 | Ga0070690_100236886 | 3300005330 | Bacteria | 1286 |
| 34 | Ga0070670_100002608 | 3300005331 | Bacteria | 14900 |
| 35 | Ga0070670_100021727 | 3300005331 | Bacteria | 5519 |
| 36 | Ga0070670_100037531 | 3300005331 | Bacteria | 4168 |
| 37 | Ga0070670_100050398 | 3300005331 | Bacteria | 3578 |
| 38 | Ga0070670_100056034 | 3300005331 | Bacteria | 3383 |
| 39 | Ga0070670_100122546 | 3300005331 | Bacteria | 2243 |
| 40 | Ga0070670_100540607 | 3300005331 | Bacteria | 1039 |
| 41 | Ga0070677_10030433 | 3300005333 | Bacteria | 2055 |
| 42 | Ga0070677_10410202 | 3300005333 | Bacteria | 716 |
| 43 | Ga0070677_10472442 | 3300005333 | Bacteria | 675 |
| 44 | Ga0068869_100144463 | 3300005334 | Bacteria | 1840 |
| 45 | Ga0070666_10011522 | 3300005335 | Bacteria | 5552 |
| 46 | Ga0070666_10013233 | 3300005335 | Bacteria | 5230 |
| 47 | Ga0070666_10024213 | 3300005335 | Bacteria | 3954 |
| 48 | Ga0070666_10029514 | 3300005335 | Bacteria | 3606 |
| 49 | Ga0070666_10083930 | 3300005335 | Bacteria | 2180 |
| 50 | Ga0070666_10211058 | 3300005335 | Bacteria | 1367 |
| 51 | Ga0070666_10400570 | 3300005335 | Bacteria | 987 |
| 52 | Ga0070680_101024698 | 3300005336 | Bacteria | 713 |
| 53 | Ga0070682_100347852 | 3300005337 | Bacteria | 1104 |
| 54 | Ga0068868_100001432 | 3300005338 | Bacteria | 16459 |
| 55 | Ga0068868_100121714 | 3300005338 | Bacteria | 2129 |
| 56 | Ga0068868_100445123 | 3300005338 | Bacteria | 1126 |
| 57 | Ga0068868_100903308 | 3300005338 | Bacteria | 803 |
| 58 | Ga0070660_100000707 | 3300005339 | Bacteria | 22075 |
| 59 | Ga0070660_100006342 | 3300005339 | Bacteria | 8193 |
| 60 | Ga0070660_100028508 | 3300005339 | Bacteria | 4178 |
| 61 | Ga0070660_100298811 | 3300005339 | Bacteria | 1320 |
| 62 | Ga0070660_100340788 | 3300005339 | Bacteria | 1233 |
| 63 | Ga0070687_100291325 | 3300005343 | Bacteria | 1032 |
| 64 | Ga0070661_100000101 | 3300005344 | Bacteria | 70279 |
| 65 | Ga0070661_100006080 | 3300005344 | Bacteria | 8307 |
| 66 | Ga0070661_100011558 | 3300005344 | Bacteria | 6151 |
| 67 | Ga0070661_100083601 | 3300005344 | Bacteria | 2358 |
| 68 | Ga0070661_100170313 | 3300005344 | Bacteria | 1653 |
| 69 | Ga0070661_100720474 | 3300005344 | Bacteria | 814 |
| 70 | Ga0070661_100728373 | 3300005344 | Bacteria | 810 |
| 71 | Ga0070692_10012745 | 3300005345 | Bacteria | 3902 |
| 72 | Ga0070668_100000037 | 3300005347 | Bacteria | 80771 |
| 73 | Ga0070668_100746386 | 3300005347 | Bacteria | 866 |
| 74 | Ga0070669_100037548 | 3300005353 | Bacteria | 3514 |
| 75 | Ga0070669_100159692 | 3300005353 | Bacteria | 1751 |
| 76 | Ga0070669_100184210 | 3300005353 | Bacteria | 1635 |
| 77 | Ga0070669_100307334 | 3300005353 | Bacteria | 1277 |
| 78 | Ga0070669_100942922 | 3300005353 | Bacteria | 738 |
| 79 | Ga0070669_101109158 | 3300005353 | Bacteria | 682 |
| 80 | Ga0070675_100001714 | 3300005354 | Bacteria | 16191 |
| 81 | Ga0070675_100031113 | 3300005354 | Bacteria | 4313 |
| 82 | Ga0070675_100041860 | 3300005354 | Bacteria | 3742 |
| 83 | Ga0070675_100152720 | 3300005354 | Bacteria | 1980 |
| 84 | Ga0070675_100627348 | 3300005354 | Bacteria | 976 |
| 85 | Ga0070671_100002144 | 3300005355 | Bacteria | 15240 |
| 86 | Ga0070671_100002365 | 3300005355 | Bacteria | 14559 |
| 87 | Ga0070671_100086364 | 3300005355 | Bacteria | 2625 |
| 88 | Ga0070671_100202037 | 3300005355 | Bacteria | 1685 |
| 89 | Ga0070671_100256109 | 3300005355 | Bacteria | 1487 |
| 90 | Ga0070671_100309030 | 3300005355 | Bacteria | 1346 |
| 91 | Ga0070671_101446392 | 3300005355 | Bacteria | 608 |
| 92 | Ga0070674_100043232 | 3300005356 | Bacteria | 3064 |
| 93 | Ga0070674_100049894 | 3300005356 | Bacteria | 2880 |
| 94 | Ga0070674_100141964 | 3300005356 | Bacteria | 1803 |
| 95 | Ga0070673_100000809 | 3300005364 | Bacteria | 17505 |
| 96 | Ga0070673_100014339 | 3300005364 | Bacteria | 5515 |
| 97 | Ga0070673_100026517 | 3300005364 | Bacteria | 4280 |
| 98 | Ga0070673_100037408 | 3300005364 | Bacteria | 3697 |
| 99 | Ga0070673_100050357 | 3300005364 | Bacteria | 3256 |
| 100 | Ga0070673_100313351 | 3300005364 | Bacteria | 1384 |
| 101 | Ga0070659_100000045 | 3300005366 | Bacteria | 101520 |
| 102 | Ga0070659_100029842 | 3300005366 | Bacteria | 4216 |
| 103 | Ga0070659_100080394 | 3300005366 | Bacteria | 2602 |
| 104 | Ga0070659_100441628 | 3300005366 | Bacteria | 1102 |
| 105 | Ga0070659_101234341 | 3300005366 | Bacteria | 662 |
| 106 | Ga0070659_101480723 | 3300005366 | Bacteria | 604 |
| 107 | Ga0070667_100021775 | 3300005367 | Bacteria | 5319 |
| 108 | Ga0070667_100026727 | 3300005367 | Bacteria | 4802 |
| 109 | Ga0070667_100111142 | 3300005367 | Bacteria | 2376 |
| 110 | Ga0070667_100159980 | 3300005367 | Bacteria | 1983 |
| 111 | Ga0070667_100877115 | 3300005367 | Bacteria | 835 |
| 112 | Ga0070694_100825067 | 3300005444 | Bacteria | 762 |
| 113 | Ga0070663_100001602 | 3300005455 | Bacteria | 12480 |
| 114 | Ga0070663_100030502 | 3300005455 | Bacteria | 3696 |
| 115 | Ga0070663_100447075 | 3300005455 | Bacteria | 1064 |
| 116 | Ga0070663_100684069 | 3300005455 | Bacteria | 871 |
| 117 | Ga0070663_100945439 | 3300005455 | Bacteria | 747 |
| 118 | Ga0070678_100022589 | 3300005456 | Bacteria | 4173 |
| 119 | Ga0070662_100000036 | 3300005457 | Bacteria | 77190 |
| 120 | Ga0070662_100006879 | 3300005457 | Bacteria | 7359 |
| 121 | Ga0070662_100028207 | 3300005457 | Bacteria | 3904 |
| 122 | Ga0070662_100114215 | 3300005457 | Bacteria | 2061 |
| 123 | Ga0070662_100268405 | 3300005457 | Bacteria | 1377 |
| 124 | Ga0070662_100307970 | 3300005457 | Bacteria | 1289 |
| 125 | Ga0070662_100366258 | 3300005457 | Bacteria | 1184 |
| 126 | Ga0070662_100408978 | 3300005457 | Bacteria | 1121 |
| 127 | Ga0070662_100462982 | 3300005457 | Bacteria | 1054 |
| 128 | Ga0070662_101220646 | 3300005457 | Bacteria | 646 |
| 129 | Ga0070681_10079481 | 3300005458 | Bacteria | 3236 |
| 130 | Ga0070681_10807015 | 3300005458 | Bacteria | 856 |
| 131 | Ga0070679_100117468 | 3300005530 | Bacteria | 2645 |
| 132 | Ga0070679_100256058 | 3300005530 | Bacteria | 1706 |
| 133 | Ga0070679_100442957 | 3300005530 | Bacteria | 1244 |
| 134 | Ga0070679_100560894 | 3300005530 | Bacteria | 1086 |
| 135 | Ga0070684_100141106 | 3300005535 | Bacteria | 2179 |
| 136 | Ga0068853_100000059 | 3300005539 | Bacteria | 78301 |
| 137 | Ga0068853_100063347 | 3300005539 | Bacteria | 3202 |
| 138 | Ga0068853_100571222 | 3300005539 | Bacteria | 1072 |
| 139 | Ga0070672_100000841 | 3300005543 | Bacteria | 18380 |
| 140 | Ga0070672_100017944 | 3300005543 | Bacteria | 5104 |
| 141 | Ga0070672_100116825 | 3300005543 | Bacteria | 2180 |
| 142 | Ga0070672_100451389 | 3300005543 | Bacteria | 1107 |
| 143 | Ga0070695_100304238 | 3300005545 | Bacteria | 1180 |
| 144 | Ga0070696_100215402 | 3300005546 | Bacteria | 1439 |
| 145 | Ga0070693_100002442 | 3300005547 | Bacteria | 8560 |
| 146 | Ga0070665_100009353 | 3300005548 | Bacteria | 9917 |
| 147 | Ga0070665_100016932 | 3300005548 | Bacteria | 7309 |
| 148 | Ga0070665_100018026 | 3300005548 | Bacteria | 7085 |
| 149 | Ga0070665_100022026 | 3300005548 | Bacteria | 6411 |
| 150 | Ga0070665_100106194 | 3300005548 | Bacteria | 2810 |
| 151 | Ga0070665_100145876 | 3300005548 | Bacteria | 2370 |
| 152 | Ga0070665_100241751 | 3300005548 | Bacteria | 1806 |
| 153 | Ga0068855_100003816 | 3300005563 | Bacteria | 18418 |
| 154 | Ga0068855_100051577 | 3300005563 | Bacteria | 4846 |
| 155 | Ga0068855_100325153 | 3300005563 | Bacteria | 1699 |
| 156 | Ga0068855_100411460 | 3300005563 | Bacteria | 1480 |
| 157 | Ga0070664_100000027 | 3300005564 | Bacteria | 90881 |
| 158 | Ga0070664_100001887 | 3300005564 | Bacteria | 16827 |
| 159 | Ga0070664_100023734 | 3300005564 | Bacteria | 5065 |
| 160 | Ga0070664_100118968 | 3300005564 | Bacteria | 2311 |
| 161 | Ga0070664_100430810 | 3300005564 | Bacteria | 1209 |
| 162 | Ga0070664_100757234 | 3300005564 | Bacteria | 907 |
| 163 | Ga0068857_100021317 | 3300005577 | Bacteria | 5704 |
| 164 | Ga0068857_100035284 | 3300005577 | Bacteria | 4429 |
| 165 | Ga0068857_101136371 | 3300005577 | Bacteria | 755 |
| 166 | Ga0068854_100002620 | 3300005578 | Bacteria | 11153 |
| 167 | Ga0068854_100006961 | 3300005578 | Bacteria | 7215 |
| 168 | Ga0068854_100010386 | 3300005578 | Bacteria | 6036 |
| 169 | Ga0068854_100589527 | 3300005578 | Bacteria | 948 |
| 170 | Ga0068856_100000699 | 3300005614 | Bacteria | 36354 |
| 171 | Ga0068856_100060969 | 3300005614 | Bacteria | 3726 |
| 172 | Ga0068856_101249569 | 3300005614 | Bacteria | 758 |
| 173 | Ga0068852_100000647 | 3300005616 | Bacteria | 22808 |
| 174 | Ga0068852_100019017 | 3300005616 | Bacteria | 5426 |
| 175 | Ga0068852_100054625 | 3300005616 | Bacteria | 3444 |
| 176 | Ga0068852_100229253 | 3300005616 | Bacteria | 1770 |
| 177 | Ga0068852_100297209 | 3300005616 | Bacteria | 1562 |
| 178 | Ga0068852_100675250 | 3300005616 | Bacteria | 1042 |
| 179 | Ga0068859_100031175 | 3300005617 | Bacteria | 5352 |
| 180 | Ga0068859_100034991 | 3300005617 | Bacteria | 5039 |
| 181 | Ga0068859_100116695 | 3300005617 | Bacteria | 2734 |
| 182 | Ga0068859_100173035 | 3300005617 | Bacteria | 2241 |
| 183 | Ga0068859_100620673 | 3300005617 | Bacteria | 1174 |
| 184 | Ga0068864_100013694 | 3300005618 | Bacteria | 6726 |
| 185 | Ga0068864_100018649 | 3300005618 | Bacteria | 5799 |
| 186 | Ga0068864_100033988 | 3300005618 | Bacteria | 4335 |
| 187 | Ga0068851_10015145 | 3300005834 | Bacteria | 3671 |
| 188 | Ga0068851_10146083 | 3300005834 | Bacteria | 1289 |
| 189 | Ga0068851_10146969 | 3300005834 | Bacteria | 1286 |
| 190 | Ga0068863_100000017 | 3300005841 | Bacteria | 207950 |
| 191 | Ga0068863_100013325 | 3300005841 | Bacteria | 7930 |
| 192 | Ga0068863_100293959 | 3300005841 | Bacteria | 1575 |
| 193 | Ga0068863_100371305 | 3300005841 | Bacteria | 1396 |
| 194 | Ga0068863_100452671 | 3300005841 | Bacteria | 1260 |
| 195 | Ga0068858_100001436 | 3300005842 | Bacteria | 24507 |
| 196 | Ga0068858_100011909 | 3300005842 | Bacteria | 8197 |
| 197 | Ga0068858_100105083 | 3300005842 | Bacteria | 2635 |
| 198 | Ga0068860_100022422 | 3300005843 | Bacteria | 6107 |
| 199 | Ga0068860_100280367 | 3300005843 | Bacteria | 1628 |
| 200 | Ga0068860_100396393 | 3300005843 | Bacteria | 1365 |
| 201 | Ga0068860_101109410 | 3300005843 | Bacteria | 811 |
| 202 | Ga0068862_100072920 | 3300005844 | Bacteria | 2967 |
| 203 | Ga0081539_10281172 | 3300005985 | Bacteria | 724 |
| 204 | Ga0075432_10260207 | 3300006058 | Bacteria | 707 |
| 205 | Ga0097621_100738190 | 3300006237 | Bacteria | 909 |
| 206 | Ga0097621_101962914 | 3300006237 | Bacteria | 559 |
| 207 | Ga0068871_100019088 | 3300006358 | Bacteria | 5228 |
| 208 | Ga0068871_100607748 | 3300006358 | Bacteria | 995 |
| 209 | Ga0075430_100158655 | 3300006846 | Bacteria | 1883 |
| 210 | Ga0075429_100478694 | 3300006880 | Bacteria | 1091 |
| 211 | Ga0068865_100060644 | 3300006881 | Bacteria | 2649 |
| 212 | Ga0068865_100061757 | 3300006881 | Bacteria | 2628 |
| 213 | Ga0097620_100031175 | 3300006931 | Bacteria | 5352 |
| 214 | Ga0097620_100034990 | 3300006931 | Bacteria | 5039 |
| 215 | Ga0097620_100116698 | 3300006931 | Bacteria | 2734 |
| 216 | Ga0097620_100173036 | 3300006931 | Bacteria | 2241 |
| 217 | Ga0097620_100620630 | 3300006931 | Bacteria | 1174 |
| 218 | Ga0105240_10010384 | 3300009093 | Bacteria | 13094 |
| 219 | Ga0105240_11068412 | 3300009093 | Bacteria | 860 |
| 220 | Ga0111539_11322747 | 3300009094 | Bacteria | 836 |
| 221 | Ga0105245_10025575 | 3300009098 | Bacteria | 5192 |
| 222 | Ga0105247_10170224 | 3300009101 | Bacteria | 1448 |
| 223 | Ga0105243_10093452 | 3300009148 | Bacteria | 2482 |
| 224 | Ga0105241_10524818 | 3300009174 | Bacteria | 1059 |
| 225 | Ga0105241_10622026 | 3300009174 | Bacteria | 978 |
| 226 | Ga0105248_10001529 | 3300009177 | Bacteria | 25755 |
| 227 | Ga0105248_10007926 | 3300009177 | Bacteria | 11673 |
| 228 | Ga0105248_10577592 | 3300009177 | Bacteria | 1268 |
| 229 | Ga0105248_10748816 | 3300009177 | Bacteria | 1102 |
| 230 | Ga0105248_12350139 | 3300009177 | Bacteria | 607 |
| 231 | Ga0105238_10053894 | 3300009551 | Bacteria | 4041 |
| 232 | Ga0105238_10108048 | 3300009551 | Bacteria | 2763 |
| 233 | Ga0105238_10129953 | 3300009551 | Bacteria | 2497 |
| 234 | Ga0105238_10438848 | 3300009551 | Bacteria | 1302 |
| 235 | Ga0105238_10849902 | 3300009551 | Bacteria | 930 |
| 236 | Ga0105249_10008965 | 3300009553 | Bacteria | 8738 |
| 237 | Ga0105249_10773075 | 3300009553 | Bacteria | 1023 |
| 238 | Ga0105239_10980578 | 3300010375 | Bacteria | 971 |
| 239 | Ga0157373_10189860 | 3300013100 | Bacteria | 1448 |
| 240 | Ga0157373_10684424 | 3300013100 | Bacteria | 751 |
| 241 | Ga0157371_10004543 | 3300013102 | Bacteria | 12085 |
| 242 | Ga0157371_10029097 | 3300013102 | Bacteria | 3999 |
| 243 | Ga0157371_10032397 | 3300013102 | Bacteria | 3761 |
| 244 | Ga0157371_10489506 | 3300013102 | Bacteria | 907 |
| 245 | Ga0157371_10523646 | 3300013102 | Bacteria | 877 |
| 246 | Ga0157370_10008454 | 3300013104 | Bacteria | 11102 |
| 247 | Ga0157370_10465274 | 3300013104 | Bacteria | 1162 |
| 248 | Ga0157369_10099482 | 3300013105 | Bacteria | 3100 |
| 249 | Ga0157369_10361778 | 3300013105 | Bacteria | 1506 |
| 250 | Ga0157369_10511676 | 3300013105 | Bacteria | 1242 |
| 251 | Ga0157369_12183949 | 3300013105 | Bacteria | 561 |
| 252 | Ga0157374_10010355 | 3300013296 | Bacteria | 8021 |
| 253 | Ga0157374_10040864 | 3300013296 | Bacteria | 4272 |
| 254 | Ga0157374_10434808 | 3300013296 | Bacteria | 1312 |
| 255 | Ga0157374_10735054 | 3300013296 | Bacteria | 1001 |
| 256 | Ga0157378_10840045 | 3300013297 | Bacteria | 946 |
| 257 | Ga0163162_10012953 | 3300013306 | Bacteria | 8140 |
| 258 | Ga0163162_10721395 | 3300013306 | Bacteria | 1117 |
| 259 | Ga0157372_10009481 | 3300013307 | Bacteria | 10352 |
| 260 | Ga0157372_10209612 | 3300013307 | Bacteria | 2258 |
| 261 | Ga0157372_11054279 | 3300013307 | Bacteria | 941 |
| 262 | Ga0157375_10050138 | 3300013308 | Bacteria | 4094 |
| 263 | Ga0157375_10704767 | 3300013308 | Bacteria | 1163 |
| 264 | Ga0157375_10763645 | 3300013308 | Bacteria | 1117 |
| 265 | Ga0157375_10781847 | 3300013308 | Bacteria | 1104 |
| 266 | Ga0163163_10000187 | 3300014325 | Bacteria | 63661 |
| 267 | Ga0157380_11915642 | 3300014326 | Bacteria | 653 |
| 268 | Ga0182008_10442835 | 3300014497 | Bacteria | 705 |
| 269 | Ga0157379_10095031 | 3300014968 | Bacteria | 2674 |
| 270 | Ga0163161_10041659 | 3300017792 | Bacteria | 3300 |
| 271 | Ga0206352_10340437 | 3300020078 | Bacteria | 2225 |
| 272 | Ga0209026_1030492 | 3300025250 | Bacteria | 800 |
| 273 | Ga0207697_10028036 | 3300025315 | Bacteria | 2302 |
| 274 | Ga0207697_10222505 | 3300025315 | Bacteria | 833 |
| 275 | Ga0207656_10016002 | 3300025321 | Bacteria | 2911 |
| 276 | Ga0207656_10024806 | 3300025321 | Bacteria | 2429 |
| 277 | Ga0207682_10328123 | 3300025893 | Bacteria | 719 |
| 278 | Ga0207682_10360451 | 3300025893 | Bacteria | 685 |
| 279 | Ga0207688_10583593 | 3300025901 | Bacteria | 704 |
| 280 | Ga0207680_10000896 | 3300025903 | Bacteria | 14078 |
| 281 | Ga0207680_10001103 | 3300025903 | Bacteria | 12733 |
| 282 | Ga0207680_10022675 | 3300025903 | Bacteria | 3418 |
| 283 | Ga0207680_10319440 | 3300025903 | Bacteria | 1085 |
| 284 | Ga0207680_10452914 | 3300025903 | Bacteria | 911 |
| 285 | Ga0207647_10016771 | 3300025904 | Bacteria | 4990 |
| 286 | Ga0207647_10027617 | 3300025904 | Bacteria | 3698 |
| 287 | Ga0207647_10046780 | 3300025904 | Bacteria | 2694 |
| 288 | Ga0207647_10097430 | 3300025904 | Bacteria | 1749 |
| 289 | Ga0207645_10047302 | 3300025907 | Bacteria | 2747 |
| 290 | Ga0207645_10224690 | 3300025907 | Bacteria | 1238 |
| 291 | Ga0207645_10327103 | 3300025907 | Bacteria | 1023 |
| 292 | Ga0207645_10623905 | 3300025907 | Bacteria | 732 |
| 293 | Ga0207705_10000912 | 3300025909 | Bacteria | 24200 |
| 294 | Ga0207705_10042473 | 3300025909 | Bacteria | 3264 |
| 295 | Ga0207705_10090003 | 3300025909 | Bacteria | 2246 |
| 296 | Ga0207705_10098604 | 3300025909 | Bacteria | 2147 |
| 297 | Ga0207705_10160813 | 3300025909 | Bacteria | 1687 |
| 298 | Ga0207705_10209519 | 3300025909 | Bacteria | 1478 |
| 299 | Ga0207705_10304205 | 3300025909 | Bacteria | 1223 |
| 300 | Ga0207705_10372357 | 3300025909 | Bacteria | 1103 |
| 301 | Ga0207705_10474475 | 3300025909 | Bacteria | 971 |
| 302 | Ga0207654_10293372 | 3300025911 | Bacteria | 1103 |
| 303 | Ga0207707_10233209 | 3300025912 | Bacteria | 1601 |
| 304 | Ga0207707_10239796 | 3300025912 | Bacteria | 1576 |
| 305 | Ga0207695_10004614 | 3300025913 | Bacteria | 18683 |
| 306 | Ga0207695_10217131 | 3300025913 | Bacteria | 1821 |
| 307 | Ga0207660_10094066 | 3300025917 | Bacteria | 2227 |
| 308 | Ga0207657_10000133 | 3300025919 | Bacteria | 75282 |
| 309 | Ga0207657_10003883 | 3300025919 | Bacteria | 15855 |
| 310 | Ga0207657_10005051 | 3300025919 | Bacteria | 13844 |
| 311 | Ga0207657_10068704 | 3300025919 | Bacteria | 3009 |
| 312 | Ga0207657_10169942 | 3300025919 | Bacteria | 1767 |
| 313 | Ga0207657_10261527 | 3300025919 | Bacteria | 1377 |
| 314 | Ga0207657_10875150 | 3300025919 | Bacteria | 693 |
| 315 | Ga0207649_10000680 | 3300025920 | Bacteria | 22565 |
| 316 | Ga0207649_10014355 | 3300025920 | Bacteria | 4433 |
| 317 | Ga0207649_10043625 | 3300025920 | Bacteria | 2743 |
| 318 | Ga0207649_10075399 | 3300025920 | Bacteria | 2167 |
| 319 | Ga0207649_10096230 | 3300025920 | Bacteria | 1950 |
| 320 | Ga0207649_10243205 | 3300025920 | Bacteria | 1293 |
| 321 | Ga0207649_10503584 | 3300025920 | Bacteria | 921 |
| 322 | Ga0207649_10577621 | 3300025920 | Bacteria | 863 |
| 323 | Ga0207652_10004117 | 3300025921 | Bacteria | 11871 |
| 324 | Ga0207652_10411259 | 3300025921 | Bacteria | 1220 |
| 325 | Ga0207652_10700728 | 3300025921 | Bacteria | 903 |
| 326 | Ga0207681_10061772 | 3300025923 | Bacteria | 2577 |
| 327 | Ga0207681_10110624 | 3300025923 | Bacteria | 1998 |
| 328 | Ga0207681_10155828 | 3300025923 | Bacteria | 1717 |
| 329 | Ga0207681_10182466 | 3300025923 | Bacteria | 1600 |
| 330 | Ga0207681_10254900 | 3300025923 | Bacteria | 1371 |
| 331 | Ga0207681_10301952 | 3300025923 | Bacteria | 1267 |
| 332 | Ga0207681_10389530 | 3300025923 | Bacteria | 1123 |
| 333 | Ga0207681_11045414 | 3300025923 | Bacteria | 685 |
| 334 | Ga0207694_10031714 | 3300025924 | Bacteria | 4040 |
| 335 | Ga0207694_10353013 | 3300025924 | Bacteria | 1217 |
| 336 | Ga0207650_10004757 | 3300025925 | Bacteria | 9275 |
| 337 | Ga0207650_10048011 | 3300025925 | Bacteria | 3147 |
| 338 | Ga0207650_10088564 | 3300025925 | Bacteria | 2361 |
| 339 | Ga0207650_10163718 | 3300025925 | Bacteria | 1764 |
| 340 | Ga0207650_10492157 | 3300025925 | Bacteria | 1024 |
| 341 | Ga0207650_11012034 | 3300025925 | Bacteria | 707 |
| 342 | Ga0207659_10001712 | 3300025926 | Bacteria | 13017 |
| 343 | Ga0207659_10013351 | 3300025926 | Bacteria | 5256 |
| 344 | Ga0207659_10070747 | 3300025926 | Bacteria | 2545 |
| 345 | Ga0207659_10131259 | 3300025926 | Bacteria | 1934 |
| 346 | Ga0207659_10255685 | 3300025926 | Bacteria | 1423 |
| 347 | Ga0207659_10563406 | 3300025926 | Bacteria | 969 |
| 348 | Ga0207687_10159059 | 3300025927 | Bacteria | 1732 |
| 349 | Ga0207687_10244056 | 3300025927 | Bacteria | 1425 |
| 350 | Ga0207644_10000145 | 3300025931 | Bacteria | 50586 |
| 351 | Ga0207644_10028004 | 3300025931 | Bacteria | 3896 |
| 352 | Ga0207644_10039094 | 3300025931 | Bacteria | 3347 |
| 353 | Ga0207644_10048420 | 3300025931 | Bacteria | 3039 |
| 354 | Ga0207644_10252557 | 3300025931 | Bacteria | 1407 |
| 355 | Ga0207690_10000080 | 3300025932 | Bacteria | 82082 |
| 356 | Ga0207690_10122599 | 3300025932 | Bacteria | 1890 |
| 357 | Ga0207690_10162139 | 3300025932 | Bacteria | 1668 |
| 358 | Ga0207690_10191170 | 3300025932 | Bacteria | 1548 |
| 359 | Ga0207706_10000159 | 3300025933 | Bacteria | 75284 |
| 360 | Ga0207706_10005845 | 3300025933 | Bacteria | 11439 |
| 361 | Ga0207706_10007351 | 3300025933 | Bacteria | 10184 |
| 362 | Ga0207706_10012188 | 3300025933 | Bacteria | 7833 |
| 363 | Ga0207706_10016374 | 3300025933 | Bacteria | 6694 |
| 364 | Ga0207706_10022333 | 3300025933 | Bacteria | 5678 |
| 365 | Ga0207706_10052604 | 3300025933 | Bacteria | 3595 |
| 366 | Ga0207706_10065216 | 3300025933 | Bacteria | 3206 |
| 367 | Ga0207706_10126577 | 3300025933 | Bacteria | 2247 |
| 368 | Ga0207706_10823916 | 3300025933 | Bacteria | 787 |
| 369 | Ga0207686_10158382 | 3300025934 | Bacteria | 1584 |
| 370 | Ga0207670_10251706 | 3300025936 | Bacteria | 1366 |
| 371 | Ga0207670_10397142 | 3300025936 | Bacteria | 1102 |
| 372 | Ga0207669_10013884 | 3300025937 | Bacteria | 4020 |
| 373 | Ga0207669_10086594 | 3300025937 | Bacteria | 2026 |
| 374 | Ga0207669_10149697 | 3300025937 | Bacteria | 1633 |
| 375 | Ga0207691_10002529 | 3300025940 | Bacteria | 17863 |
| 376 | Ga0207691_10248236 | 3300025940 | Bacteria | 1537 |
| 377 | Ga0207691_10288558 | 3300025940 | Bacteria | 1411 |
| 378 | Ga0207691_11069788 | 3300025940 | Bacteria | 672 |
| 379 | Ga0207691_11215090 | 3300025940 | Bacteria | 625 |
| 380 | Ga0207711_10007466 | 3300025941 | Bacteria | 9146 |
| 381 | Ga0207711_10019049 | 3300025941 | Bacteria | 5711 |
| 382 | Ga0207711_10029794 | 3300025941 | Bacteria | 4604 |
| 383 | Ga0207711_10277038 | 3300025941 | Bacteria | 1544 |
| 384 | Ga0207711_10455616 | 3300025941 | Bacteria | 1191 |
| 385 | Ga0207661_10038601 | 3300025944 | Bacteria | 3744 |
| 386 | Ga0207661_10051516 | 3300025944 | Bacteria | 3285 |
| 387 | Ga0207661_10102387 | 3300025944 | Bacteria | 2407 |
| 388 | Ga0207661_10164037 | 3300025944 | Bacteria | 1929 |
| 389 | Ga0207679_10001226 | 3300025945 | Bacteria | 16305 |
| 390 | Ga0207679_10008147 | 3300025945 | Bacteria | 6667 |
| 391 | Ga0207679_10368489 | 3300025945 | Bacteria | 1257 |
| 392 | Ga0207679_10657260 | 3300025945 | Bacteria | 948 |
| 393 | Ga0207679_10791595 | 3300025945 | Bacteria | 864 |
| 394 | Ga0207679_11125821 | 3300025945 | Bacteria | 720 |
| 395 | Ga0207667_10005833 | 3300025949 | Bacteria | 15008 |
| 396 | Ga0207667_10007031 | 3300025949 | Bacteria | 13597 |
| 397 | Ga0207667_10170460 | 3300025949 | Bacteria | 2237 |
| 398 | Ga0207667_11275056 | 3300025949 | Bacteria | 712 |
| 399 | Ga0207651_10029148 | 3300025960 | Bacteria | 3493 |
| 400 | Ga0207651_10253837 | 3300025960 | Bacteria | 1440 |
| 401 | Ga0207651_10423125 | 3300025960 | Bacteria | 1138 |
| 402 | Ga0207712_10089823 | 3300025961 | Bacteria | 2259 |
| 403 | Ga0207712_10118774 | 3300025961 | Bacteria | 1997 |
| 404 | Ga0207668_10000029 | 3300025972 | Bacteria | 123784 |
| 405 | Ga0207668_10148409 | 3300025972 | Bacteria | 1812 |
| 406 | Ga0207668_10585121 | 3300025972 | Bacteria | 971 |
| 407 | Ga0207668_10607998 | 3300025972 | Bacteria | 953 |
| 408 | Ga0207640_10001181 | 3300025981 | Bacteria | 14279 |
| 409 | Ga0207640_10155332 | 3300025981 | Bacteria | 1686 |
| 410 | Ga0207640_10288210 | 3300025981 | Bacteria | 1293 |
| 411 | Ga0207640_10687074 | 3300025981 | Bacteria | 876 |
| 412 | Ga0207658_10044959 | 3300025986 | Bacteria | 3217 |
| 413 | Ga0207658_10058789 | 3300025986 | Bacteria | 2862 |
| 414 | Ga0207658_10075335 | 3300025986 | Bacteria | 2567 |
| 415 | Ga0207658_10080928 | 3300025986 | Bacteria | 2489 |
| 416 | Ga0207677_10016567 | 3300026023 | Bacteria | 4370 |
| 417 | Ga0207677_10134660 | 3300026023 | Bacteria | 1882 |
| 418 | Ga0207703_10004976 | 3300026035 | Bacteria | 10784 |
| 419 | Ga0207703_10012033 | 3300026035 | Bacteria | 6738 |
| 420 | Ga0207703_10014199 | 3300026035 | Bacteria | 6212 |
| 421 | Ga0207639_10001590 | 3300026041 | Bacteria | 15258 |
| 422 | Ga0207639_10609663 | 3300026041 | Bacteria | 1007 |
| 423 | Ga0207639_10635847 | 3300026041 | Bacteria | 986 |
| 424 | Ga0207639_11467371 | 3300026041 | Bacteria | 640 |
| 425 | Ga0207678_10003713 | 3300026067 | Bacteria | 13727 |
| 426 | Ga0207678_10017778 | 3300026067 | Bacteria | 6243 |
| 427 | Ga0207678_10026918 | 3300026067 | Bacteria | 5016 |
| 428 | Ga0207678_10126739 | 3300026067 | Bacteria | 2178 |
| 429 | Ga0207678_10131551 | 3300026067 | Bacteria | 2135 |
| 430 | Ga0207678_10254631 | 3300026067 | Bacteria | 1504 |
| 431 | Ga0207702_10000246 | 3300026078 | Bacteria | 63201 |
| 432 | Ga0207702_10104404 | 3300026078 | Bacteria | 2508 |
| 433 | Ga0207702_10297875 | 3300026078 | Bacteria | 1530 |
| 434 | Ga0207702_10363223 | 3300026078 | Bacteria | 1388 |
| 435 | Ga0207641_10000036 | 3300026088 | Bacteria | 213165 |
| 436 | Ga0207641_10040156 | 3300026088 | Bacteria | 3916 |
| 437 | Ga0207641_10406726 | 3300026088 | Bacteria | 1308 |
| 438 | Ga0207641_10430237 | 3300026088 | Bacteria | 1272 |
| 439 | Ga0207648_10506200 | 3300026089 | Bacteria | 1105 |
| 440 | Ga0207676_10186455 | 3300026095 | Bacteria | 1821 |
| 441 | Ga0207676_10460221 | 3300026095 | Bacteria | 1201 |
| 442 | Ga0207674_10009817 | 3300026116 | Bacteria | 10900 |
| 443 | Ga0207674_10048018 | 3300026116 | Bacteria | 4372 |
| 444 | Ga0207674_10971113 | 3300026116 | Bacteria | 818 |
| 445 | Ga0207683_10012478 | 3300026121 | Bacteria | 7250 |
| 446 | Ga0207683_10027998 | 3300026121 | Bacteria | 4871 |
| 447 | Ga0207683_10282213 | 3300026121 | Bacteria | 1518 |
| 448 | Ga0207698_10000759 | 3300026142 | Bacteria | 18757 |
| 449 | Ga0207698_10024082 | 3300026142 | Bacteria | 4266 |
| 450 | Ga0207698_10070313 | 3300026142 | Bacteria | 2773 |
| 451 | Ga0207698_10234705 | 3300026142 | Bacteria | 1667 |
| 452 | Ga0207698_10394762 | 3300026142 | Bacteria | 1320 |
| 453 | Ga0207698_10494010 | 3300026142 | Bacteria | 1190 |
| 454 | Ga0207698_11475287 | 3300026142 | Bacteria | 695 |
| 455 | Ga0209974_10056674 | 3300027876 | Bacteria | 1323 |
| 456 | Ga0207428_10874123 | 3300027907 | Bacteria | 636 |
| 457 | Ga0268266_10012378 | 3300028379 | Bacteria | 7375 |
| 458 | Ga0268266_10019539 | 3300028379 | Bacteria | 5774 |
| 459 | Ga0268266_10029745 | 3300028379 | Bacteria | 4641 |
| 460 | Ga0268266_10038097 | 3300028379 | Bacteria | 4094 |
| 461 | Ga0268266_10065905 | 3300028379 | Bacteria | 3131 |
| 462 | Ga0268266_10407987 | 3300028379 | Bacteria | 1286 |
| 463 | Ga0268265_10246843 | 3300028380 | Bacteria | 1579 |
| 464 | Ga0268265_10688882 | 3300028380 | Bacteria | 986 |
| 465 | Ga0268264_10007570 | 3300028381 | Bacteria | 9056 |
| 466 | Ga0268264_10026990 | 3300028381 | Bacteria | 4691 |
| 467 | Ga0268264_10120588 | 3300028381 | Bacteria | 2311 |
| 468 | Ga0268264_10132890 | 3300028381 | Bacteria | 2209 |
| 469 | Ga0268264_12320602 | 3300028381 | Bacteria | 543 |
| 470 | Ga0316178_1019046 | 3300030735 | Bacteria | 576 |
| 471 | Ga0265327_10026289 | 3300031251 | Bacteria | 3374 |
| 472 | Ga0307408_100019242 | 3300031548 | Bacteria | 4595 |
| 473 | Ga0307408_100078786 | 3300031548 | Bacteria | 2457 |
| 474 | Ga0307405_10173335 | 3300031731 | Bacteria | 1541 |
| 475 | Ga0307405_10790121 | 3300031731 | Bacteria | 794 |
| 476 | Ga0307413_10037496 | 3300031824 | Bacteria | 2800 |
| 477 | Ga0307413_10142862 | 3300031824 | Bacteria | 1656 |
| 478 | Ga0307413_10254331 | 3300031824 | Bacteria | 1305 |
| 479 | Ga0307413_10425741 | 3300031824 | Bacteria | 1047 |
| 480 | Ga0307413_10935868 | 3300031824 | Bacteria | 738 |
| 481 | Ga0307410_10000318 | 3300031852 | Bacteria | 18700 |
| 482 | Ga0307410_10033090 | 3300031852 | Bacteria | 3335 |
| 483 | Ga0307410_10038729 | 3300031852 | Bacteria | 3125 |
| 484 | Ga0307410_10184712 | 3300031852 | Bacteria | 1581 |
| 485 | Ga0307410_10242133 | 3300031852 | Bacteria | 1398 |
| 486 | Ga0307410_11257112 | 3300031852 | Bacteria | 646 |
| 487 | Ga0307406_10117751 | 3300031901 | Bacteria | 1841 |
| 488 | Ga0307406_10120499 | 3300031901 | Bacteria | 1823 |
| 489 | Ga0307406_10203884 | 3300031901 | Bacteria | 1458 |
| 490 | Ga0307412_10036091 | 3300031911 | Bacteria | 3164 |
| 491 | Ga0307412_10143732 | 3300031911 | Bacteria | 1751 |
| 492 | Ga0307412_10315175 | 3300031911 | Bacteria | 1242 |
| 493 | Ga0307412_10600551 | 3300031911 | Bacteria | 932 |
| 494 | Ga0307412_10683428 | 3300031911 | Bacteria | 879 |
| 495 | Ga0307409_100016988 | 3300031995 | Bacteria | 4835 |
| 496 | Ga0307409_100137087 | 3300031995 | Bacteria | 2102 |
| 497 | Ga0307409_100195101 | 3300031995 | Bacteria | 1806 |
| 498 | Ga0307409_100561639 | 3300031995 | Bacteria | 1122 |
| 499 | Ga0307409_100689919 | 3300031995 | Bacteria | 1019 |
| 500 | Ga0307416_100031399 | 3300032002 | Bacteria | 3999 |
| 501 | Ga0307416_100031584 | 3300032002 | Bacteria | 3989 |
| 502 | Ga0307416_100276263 | 3300032002 | Bacteria | 1653 |
| 503 | Ga0307416_100619393 | 3300032002 | Bacteria | 1164 |
| 504 | Ga0307416_101083653 | 3300032002 | Bacteria | 905 |
| 505 | Ga0307416_101119731 | 3300032002 | Bacteria | 892 |
| 506 | Ga0307414_10002184 | 3300032004 | Bacteria | 10204 |
| 507 | Ga0307414_10003044 | 3300032004 | Bacteria | 8894 |
| 508 | Ga0307414_10074760 | 3300032004 | Bacteria | 2456 |
| 509 | Ga0307414_10196687 | 3300032004 | Bacteria | 1636 |
| 510 | Ga0307411_10021174 | 3300032005 | Bacteria | 3798 |
| 511 | Ga0307411_10052358 | 3300032005 | Bacteria | 2668 |
| 512 | Ga0307411_10204897 | 3300032005 | Bacteria | 1518 |
| 513 | Ga0307415_100007926 | 3300032126 | Bacteria | 5846 |
| 514 | Ga0307415_100190779 | 3300032126 | Bacteria | 1617 |
| 515 | Ga0307415_101185178 | 3300032126 | Bacteria | 719 |
| 516 | Ga0373959_0098206 | 3300034820 | Bacteria | 694 |
| 517 | Ga0373938_0076778 | 3300034957 | Bacteria | 808 |
| 518 | Ga0373929_0083490 | 3300035085 | Bacteria | 782 |
| 519 | Ga0373960_0082981 | 3300035121 | Bacteria | 1013 |
| 520 | Ga0373931_0345537 | 3300035691 | Bacteria | 930 |
| 521 | Ga0395899_0010088 | 3300037312 | Bacteria | 7242 |
| 522 | Ga0395899_0013975 | 3300037312 | Bacteria | 6131 |
| 523 | Ga0395899_0014720 | 3300037312 | Bacteria | 5970 |
| 524 | Ga0395899_0031251 | 3300037312 | Bacteria | 4002 |
| 525 | Ga0395899_0128790 | 3300037312 | Bacteria | 1809 |
| 526 | Ga0395899_0211250 | 3300037312 | Bacteria | 1348 |
| 527 | Ga0395899_0450918 | 3300037312 | Bacteria | 842 |
| 528 | Ga0395900_0006695 | 3300037418 | Bacteria | 11971 |
| 529 | Ga0395900_0011778 | 3300037418 | Bacteria | 8943 |
| 530 | Ga0395900_0018717 | 3300037418 | Bacteria | 7062 |
| 531 | Ga0395900_0027416 | 3300037418 | Bacteria | 5834 |
| 532 | Ga0395900_0030421 | 3300037418 | Bacteria | 5545 |
| 533 | Ga0395900_0037001 | 3300037418 | Bacteria | 5031 |
| 534 | Ga0395900_0091833 | 3300037418 | Bacteria | 3119 |
| 535 | Ga0395900_0091851 | 3300037418 | Bacteria | 3119 |
| 536 | Ga0395900_0144007 | 3300037418 | Bacteria | 2438 |
| 537 | Ga0395900_0145621 | 3300037418 | Bacteria | 2422 |
| 538 | Ga0395900_0168774 | 3300037418 | Bacteria | 2229 |
| 539 | Ga0395900_0238708 | 3300037418 | Bacteria | 1824 |
| 540 | Ga0395900_0302554 | 3300037418 | Bacteria | 1585 |
| 541 | Ga0395898_0035058 | 3300037466 | Bacteria | 4994 |
| 542 | Ga0395898_0064763 | 3300037466 | Bacteria | 3544 |
| 543 | Ga0395898_0089245 | 3300037466 | Bacteria | 2967 |
| 544 | Ga0395898_0161649 | 3300037466 | Bacteria | 2142 |
| 545 | Ga0395898_0398552 | 3300037466 | Bacteria | 1312 |
| 546 | Ga0395905_0000187 | 3300037471 | Bacteria | 98895 |
| 547 | Ga0395905_0000215 | 3300037471 | Bacteria | 89274 |
| 548 | Ga0395905_0008278 | 3300037471 | Bacteria | 10266 |
| 549 | Ga0395905_0017175 | 3300037471 | Bacteria | 6873 |
| 550 | Ga0395905_0034610 | 3300037471 | Bacteria | 4744 |
| 551 | Ga0395905_0122444 | 3300037471 | Bacteria | 2445 |
| 552 | Ga0395905_0266814 | 3300037471 | Bacteria | 1597 |
| 553 | Ga0395905_0300883 | 3300037471 | Bacteria | 1491 |
| 554 | Ga0395905_0341959 | 3300037471 | Bacteria | 1387 |
| 555 | Ga0395905_0347625 | 3300037471 | Bacteria | 1374 |
| 556 | Ga0395905_0367575 | 3300037471 | Bacteria | 1331 |
| 557 | Ga0395905_0586353 | 3300037471 | Bacteria | 1016 |
| 558 | Ga0395905_0628439 | 3300037471 | Bacteria | 976 |
| 559 | Ga0436364_0166654 | 3300037853 | Bacteria | 736 |
| 560 | Ga0395901_0000876 | 3300038443 | Bacteria | 33203 |
| 561 | Ga0395901_0001382 | 3300038443 | Bacteria | 25390 |
| 562 | Ga0395901_0104829 | 3300038443 | Bacteria | 2967 |
| 563 | Ga0395901_0129726 | 3300038443 | Bacteria | 2649 |
| 564 | Ga0395901_0188467 | 3300038443 | Bacteria | 2163 |
| 565 | Ga0395901_0240981 | 3300038443 | Bacteria | 1886 |
| 566 | Ga0395901_0317882 | 3300038443 | Bacteria | 1611 |
| 567 | Ga0395901_0436348 | 3300038443 | Bacteria | 1341 |
| 568 | Ga0395901_0465587 | 3300038443 | Bacteria | 1291 |
| 569 | Ga0395901_0795543 | 3300038443 | Bacteria | 935 |
| 570 | Ga0450909_056652 | 3300042185 | Bacteria | 616 |
| 571 | Ga0439464_0003664 | 3300042439 | Bacteria | 3897 |
| 572 | Ga0451577_0275756 | 3300042876 | Bacteria | 1523 |
| 573 | Ga0466961_0127827 | 3300044693 | Bacteria | 1593 |
| 574 | Ga0466963_0078624 | 3300044694 | Bacteria | 2230 |
| 575 | Ga0466964_0049526 | 3300044706 | Bacteria | 1720 |
| 576 | Ga0466971_0033232 | 3300044719 | Bacteria | 2311 |
| 577 | Ga0466970_0190225 | 3300044765 | Bacteria | 1140 |
| 578 | Ga0466957_0255467 | 3300044842 | Bacteria | 1166 |
| 579 | Ga0466959_0596947 | 3300045049 | Bacteria | 743 |
| 580 | Ga0466958_0258943 | 3300045836 | Bacteria | 1113 |
| 581 | Ga0466958_0336100 | 3300045836 | Bacteria | 971 |
| 582 | Ga0495620_0042146 | 3300046515 | Bacteria | 1996 |
| 583 | Ga0495643_0096292 | 3300046522 | Bacteria | 1521 |
| 584 | Ga0495663_0059024 | 3300046525 | Bacteria | 1203 |
| 585 | Ga0495663_0182087 | 3300046525 | Bacteria | 728 |
| 586 | Ga0495598_0001145 | 3300046537 | Bacteria | 5100 |
| 587 | Ga0495621_0044704 | 3300046539 | Bacteria | 1566 |
| 588 | Ga0495597_0019195 | 3300046542 | Bacteria | 3201 |
| 589 | Ga0495622_0001177 | 3300046557 | Bacteria | 13536 |
| 590 | Ga0495633_0015973 | 3300046558 | Bacteria | 3884 |
| 591 | Ga0495668_0020247 | 3300046616 | Bacteria | 3828 |
| 592 | Ga0495668_0038691 | 3300046616 | Bacteria | 2664 |
| 593 | Ga0495659_0002607 | 3300046664 | Bacteria | 5814 |
| 594 | Ga0495659_0065611 | 3300046664 | Bacteria | 1350 |
| 595 | Ga0495661_0334067 | 3300046665 | Bacteria | 750 |
| 596 | Ga0495588_0064987 | 3300046674 | Bacteria | 1893 |
| 597 | Ga0495669_0011541 | 3300046684 | Bacteria | 3753 |
| 598 | Ga0495669_0011559 | 3300046684 | Bacteria | 3751 |
| 599 | Ga0495669_0013564 | 3300046684 | Bacteria | 3475 |
| 600 | Ga0495669_0020477 | 3300046684 | Bacteria | 2864 |
| 601 | Ga0495669_0036507 | 3300046684 | Bacteria | 2172 |
| 602 | Ga0495669_0062378 | 3300046684 | Bacteria | 1689 |
| 603 | Ga0495670_0039869 | 3300046691 | Bacteria | 2343 |
| 604 | Ga0495670_0188136 | 3300046691 | Bacteria | 1091 |
| 605 | Ga0495636_0053983 | 3300047318 | Bacteria | 1688 |
| 606 | Ga0495683_0039357 | 3300047323 | Bacteria | 2390 |
| 607 | Ga0495593_0043396 | 3300047673 | Bacteria | 2410 |
| 608 | Ga0495602_0227309 | 3300048088 | Bacteria | 1404 |
| 609 | Ga0496101_0251701 | 3300048904 | Bacteria | 1376 |
| 610 | Ga0496102_0351826 | 3300048905 | Bacteria | 1387 |
| 611 | Ga0496103_0016288 | 3300048906 | Bacteria | 4437 |
| 612 | Ga0496105_0103044 | 3300048908 | Bacteria | 2357 |
| 613 | Ga0496106_0347103 | 3300048909 | Bacteria | 1192 |
| 614 | Ga0496107_0011923 | 3300048910 | Bacteria | 6070 |
| 615 | Ga0496108_0734008 | 3300048911 | Bacteria | 855 |
| 616 | Ga0496108_1179051 | 3300048911 | Bacteria | 648 |
| 617 | Ga0496108_1336756 | 3300048911 | Bacteria | 601 |
| 618 | Ga0496109_0040809 | 3300048912 | Bacteria | 4204 |
| 619 | Ga0496109_0346772 | 3300048912 | Bacteria | 1402 |
| 620 | Ga0496109_0451309 | 3300048912 | Bacteria | 1214 |
| 621 | Ga0496109_0697105 | 3300048912 | Bacteria | 953 |
| 622 | Ga0496110_0007383 | 3300048913 | Bacteria | 8773 |
| 623 | Ga0496110_0017892 | 3300048913 | Bacteria | 5933 |
| 624 | Ga0496111_0141209 | 3300048914 | Bacteria | 1784 |
| 625 | Ga0496111_0532492 | 3300048914 | Bacteria | 863 |
| 626 | Ga0496112_0247979 | 3300048915 | Bacteria | 1732 |
| 627 | Ga0496113_0138100 | 3300048916 | Bacteria | 1916 |
| 628 | Ga0496114_0566546 | 3300048917 | Bacteria | 1003 |
| 629 | Ga0496114_0680298 | 3300048917 | Bacteria | 903 |
| 630 | Ga0495682_0041995 | 3300049460 | Bacteria | 1676 |
| 631 | Ga0501036_0569406 | 3300049572 | Bacteria | 941 |
| 632 | Ga0501041_0115290 | 3300049577 | Bacteria | 1668 |
| 633 | Ga0501068_0091796 | 3300049584 | Bacteria | 1874 |
| 634 | Ga0501072_0115968 | 3300049588 | Bacteria | 2133 |
| 635 | Ga0501075_0132269 | 3300049591 | Bacteria | 1900 |
| 636 | Ga0501080_0262972 | 3300049742 | Bacteria | 1572 |
| 637 | Ga0495655_0075872 | 3300053083 | Bacteria | 950 |
| 638 | Ga0495655_0083155 | 3300053083 | Bacteria | 919 |
| 639 | Ga0500583_0130386 | 3300053092 | Bacteria | 1247 |
| 640 | Ga0500651_0057607 | 3300053093 | Bacteria | 2431 |
| 641 | Ga0500566_0013148 | 3300053094 | Bacteria | 4876 |
| 642 | Ga0500572_008898 | 3300053111 | Bacteria | 2360 |
| 643 | Ga0500595_047659 | 3300053119 | Bacteria | 1341 |
| 644 | Ga0500608_002496 | 3300053122 | Bacteria | 6705 |
| 645 | Ga0500614_009590 | 3300053123 | Bacteria | 2066 |
| 646 | Ga0500559_0014120 | 3300053136 | Bacteria | 3376 |
| 647 | Ga0500564_087854 | 3300053138 | Bacteria | 1387 |
| 648 | Ga0500590_078945 | 3300053148 | Bacteria | 1620 |
| 649 | Ga0500619_005334 | 3300053154 | Bacteria | 2857 |
| 650 | Ga0500636_0076147 | 3300053177 | Bacteria | 1940 |
| 651 | Ga0500637_0012520 | 3300053178 | Bacteria | 4422 |
| 652 | Ga0500596_012411 | 3300053735 | Bacteria | 1292 |
| 653 | Ga0466962_0067512 | 3300061719 | Bacteria | 1707 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005577 | Ga0068857_101136371 | Ga0068857_1011363712 | 151 |
| 2 | 3300025907 | Ga0207645_10623905 | Ga0207645_106239051 | 151 |
| 3 | 3300026116 | Ga0207674_10971113 | Ga0207674_109711132 | 152 |
| 4 | 3300037312 | Ga0395899_0211250 | Ga0395899_0211250_132_629 | 153 |
| 5 | 3300037418 | Ga0395900_0144007 | Ga0395900_0144007_469_966 | 153 |
| 6 | 3300037466 | Ga0395898_0161649 | Ga0395898_0161649_478_975 | 153 |
| 7 | 3300037471 | Ga0395905_0347625 | Ga0395905_0347625_791_1288 | 153 |
| 8 | 3300037471 | Ga0395905_0367575 | Ga0395905_0367575_44_541 | 153 |
| 9 | 3300038443 | Ga0395901_0317882 | Ga0395901_0317882_658_1155 | 153 |
| 10 | 3300042876 | Ga0451577_0275756 | Ga0451577_0275756_277_750 | 157 |
| 11 | iso_pu_bacteria | 2687453257 | 2688065957 | 158 |
| 12 | 3300020078 | Ga0206352_10340437 | Ga0206352_103404373 | 160 |
| 13 | 3300030735 | Ga0316178_1019046 | Ga0316178_10190461 | 160 |
| 14 | 3300013105 | Ga0157369_10511676 | Ga0157369_105116762 | 161 |
| 15 | 3300042185 | Ga0450909_056652 | Ga0450909_056652_71_556 | 161 |
| 16 | 3300002239 | JGI24034J26672_10016617 | JGI24034J26672_100166172 | 162 |
| 17 | 3300005327 | Ga0070658_10114206 | Ga0070658_101142063 | 162 |
| 18 | 3300005331 | Ga0070670_100050398 | Ga0070670_1000503981 | 162 |
| 19 | 3300005336 | Ga0070680_101024698 | Ga0070680_1010246981 | 162 |
| 20 | 3300005339 | Ga0070660_100340788 | Ga0070660_1003407882 | 162 |
| 21 | 3300005347 | Ga0070668_100000037 | Ga0070668_10000003774 | 162 |
| 22 | 3300005355 | Ga0070671_100002365 | Ga0070671_10000236514 | 162 |
| 23 | 3300005530 | Ga0070679_100117468 | Ga0070679_1001174683 | 162 |
| 24 | 3300005548 | Ga0070665_100016932 | Ga0070665_1000169326 | 162 |
| 25 | 3300005616 | Ga0068852_100675250 | Ga0068852_1006752501 | 162 |
| 26 | 3300005617 | Ga0068859_100173035 | Ga0068859_1001730354 | 162 |
| 27 | 3300005841 | Ga0068863_100000017 | Ga0068863_100000017251 | 162 |
| 28 | 3300005843 | Ga0068860_100022422 | Ga0068860_10002242211 | 162 |
| 29 | 3300005844 | Ga0068862_100072920 | Ga0068862_1000729204 | 162 |
| 30 | 3300006931 | Ga0097620_100173036 | Ga0097620_1001730364 | 162 |
| 31 | 3300009174 | Ga0105241_10524818 | Ga0105241_105248182 | 162 |
| 32 | 3300009551 | Ga0105238_10438848 | Ga0105238_104388481 | 162 |
| 33 | 3300009553 | Ga0105249_10008965 | Ga0105249_1000896510 | 162 |
| 34 | 3300013102 | Ga0157371_10523646 | Ga0157371_105236462 | 162 |
| 35 | 3300014497 | Ga0182008_10442835 | Ga0182008_104428351 | 162 |
| 36 | 3300025909 | Ga0207705_10098604 | Ga0207705_100986042 | 162 |
| 37 | 3300025911 | Ga0207654_10293372 | Ga0207654_102933722 | 162 |
| 38 | 3300025913 | Ga0207695_10217131 | Ga0207695_102171312 | 162 |
| 39 | 3300025919 | Ga0207657_10068704 | Ga0207657_100687042 | 162 |
| 40 | 3300025921 | Ga0207652_10411259 | Ga0207652_104112592 | 162 |
| 41 | 3300025925 | Ga0207650_11012034 | Ga0207650_110120341 | 162 |
| 42 | 3300025931 | Ga0207644_10000145 | Ga0207644_1000014571 | 162 |
| 43 | 3300025949 | Ga0207667_10170460 | Ga0207667_101704602 | 162 |
| 44 | 3300025961 | Ga0207712_10118774 | Ga0207712_101187744 | 162 |
| 45 | 3300025972 | Ga0207668_10000029 | Ga0207668_1000002998 | 162 |
| 46 | 3300025981 | Ga0207640_10288210 | Ga0207640_102882102 | 162 |
| 47 | 3300026067 | Ga0207678_10026918 | Ga0207678_100269185 | 162 |
| 48 | 3300026088 | Ga0207641_10000036 | Ga0207641_10000036245 | 162 |
| 49 | 3300028379 | Ga0268266_10019539 | Ga0268266_100195399 | 162 |
| 50 | 3300028380 | Ga0268265_10688882 | Ga0268265_106888821 | 162 |
| 51 | 3300028381 | Ga0268264_10007570 | Ga0268264_1000757010 | 162 |
| 52 | 3300037853 | Ga0436364_0166654 | Ga0436364_0166654_207_695 | 162 |
| 53 | 3300046515 | Ga0495620_0042146 | Ga0495620_0042146_535_1023 | 162 |
| 54 | 3300046522 | Ga0495643_0096292 | Ga0495643_0096292_323_811 | 162 |
| 55 | 3300046542 | Ga0495597_0019195 | Ga0495597_0019195_1111_1599 | 162 |
| 56 | 3300046557 | Ga0495622_0001177 | Ga0495622_0001177_11691_12179 | 162 |
| 57 | 3300046616 | Ga0495668_0020247 | Ga0495668_0020247_792_1280 | 162 |
| 58 | 3300047673 | Ga0495593_0043396 | Ga0495593_0043396_261_749 | 162 |
| 59 | 3300048088 | Ga0495602_0227309 | Ga0495602_0227309_320_808 | 162 |
| 60 | 3300049460 | Ga0495682_0041995 | Ga0495682_0041995_677_1165 | 162 |
| 61 | 3300053092 | Ga0500583_0130386 | Ga0500583_0130386_591_1079 | 162 |
| 62 | 3300053093 | Ga0500651_0057607 | Ga0500651_0057607_1900_2388 | 162 |
| 63 | 3300053094 | Ga0500566_0013148 | Ga0500566_0013148_3807_4295 | 162 |
| 64 | 3300053111 | Ga0500572_008898 | Ga0500572_008898_1488_1976 | 162 |
| 65 | 3300053119 | Ga0500595_047659 | Ga0500595_047659_664_1152 | 162 |
| 66 | 3300053122 | Ga0500608_002496 | Ga0500608_002496_2534_3022 | 162 |
| 67 | 3300053123 | Ga0500614_009590 | Ga0500614_009590_582_1070 | 162 |
| 68 | 3300053136 | Ga0500559_0014120 | Ga0500559_0014120_382_870 | 162 |
| 69 | 3300053138 | Ga0500564_087854 | Ga0500564_087854_52_540 | 162 |
| 70 | 3300053148 | Ga0500590_078945 | Ga0500590_078945_102_590 | 162 |
| 71 | 3300053154 | Ga0500619_005334 | Ga0500619_005334_1331_1819 | 162 |
| 72 | 3300053177 | Ga0500636_0076147 | Ga0500636_0076147_1128_1616 | 162 |
| 73 | 3300053178 | Ga0500637_0012520 | Ga0500637_0012520_3025_3513 | 162 |
| 74 | 3300053735 | Ga0500596_012411 | Ga0500596_012411_161_649 | 162 |
| 75 | 3300009551 | Ga0105238_10849902 | Ga0105238_108499021 | 163 |
| 76 | 3300013308 | Ga0157375_10704767 | Ga0157375_107047672 | 163 |
| 77 | 3300025940 | Ga0207691_11069788 | Ga0207691_110697881 | 163 |
| 78 | 3300028381 | Ga0268264_10026990 | Ga0268264_100269902 | 163 |
| 79 | 3300002075 | JGI24738J21930_10116179 | JGI24738J21930_101161791 | 164 |
| 80 | 3300005327 | Ga0070658_10175405 | Ga0070658_101754052 | 164 |
| 81 | 3300005328 | Ga0070676_10029039 | Ga0070676_100290394 | 164 |
| 82 | 3300005328 | Ga0070676_10043507 | Ga0070676_100435073 | 164 |
| 83 | 3300005330 | Ga0070690_100236886 | Ga0070690_1002368862 | 164 |
| 84 | 3300005335 | Ga0070666_10211058 | Ga0070666_102110582 | 164 |
| 85 | 3300005344 | Ga0070661_100728373 | Ga0070661_1007283732 | 164 |
| 86 | 3300005355 | Ga0070671_100309030 | Ga0070671_1003090302 | 164 |
| 87 | 3300005356 | Ga0070674_100049894 | Ga0070674_1000498944 | 164 |
| 88 | 3300005364 | Ga0070673_100050357 | Ga0070673_1000503573 | 164 |
| 89 | 3300005367 | Ga0070667_100111142 | Ga0070667_1001111422 | 164 |
| 90 | 3300005543 | Ga0070672_100451389 | Ga0070672_1004513892 | 164 |
| 91 | 3300005548 | Ga0070665_100145876 | Ga0070665_1001458762 | 164 |
| 92 | 3300005617 | Ga0068859_100031175 | Ga0068859_1000311754 | 164 |
| 93 | 3300005618 | Ga0068864_100033988 | Ga0068864_1000339886 | 164 |
| 94 | 3300005834 | Ga0068851_10146083 | Ga0068851_101460832 | 164 |
| 95 | 3300005841 | Ga0068863_100013325 | Ga0068863_1000133258 | 164 |
| 96 | 3300006358 | Ga0068871_100019088 | Ga0068871_1000190886 | 164 |
| 97 | 3300006881 | Ga0068865_100060644 | Ga0068865_1000606442 | 164 |
| 98 | 3300006931 | Ga0097620_100031175 | Ga0097620_1000311754 | 164 |
| 99 | 3300009093 | Ga0105240_11068412 | Ga0105240_110684122 | 164 |
| 100 | 3300009098 | Ga0105245_10025575 | Ga0105245_100255752 | 164 |
| 101 | 3300009101 | Ga0105247_10170224 | Ga0105247_101702242 | 164 |
| 102 | 3300009148 | Ga0105243_10093452 | Ga0105243_100934522 | 164 |
| 103 | 3300009177 | Ga0105248_10748816 | Ga0105248_107488162 | 164 |
| 104 | 3300009551 | Ga0105238_10108048 | Ga0105238_101080483 | 164 |
| 105 | 3300010375 | Ga0105239_10980578 | Ga0105239_109805782 | 164 |
| 106 | 3300013102 | Ga0157371_10032397 | Ga0157371_100323977 | 164 |
| 107 | 3300013296 | Ga0157374_10434808 | Ga0157374_104348082 | 164 |
| 108 | 3300013296 | Ga0157374_10735054 | Ga0157374_107350542 | 164 |
| 109 | 3300013307 | Ga0157372_11054279 | Ga0157372_110542792 | 164 |
| 110 | 3300025250 | Ga0209026_1030492 | Ga0209026_10304921 | 164 |
| 111 | 3300025907 | Ga0207645_10047302 | Ga0207645_100473024 | 164 |
| 112 | 3300025909 | Ga0207705_10304205 | Ga0207705_103042052 | 164 |
| 113 | 3300025924 | Ga0207694_10353013 | Ga0207694_103530132 | 164 |
| 114 | 3300025927 | Ga0207687_10159059 | Ga0207687_101590593 | 164 |
| 115 | 3300025927 | Ga0207687_10244056 | Ga0207687_102440562 | 164 |
| 116 | 3300025932 | Ga0207690_10162139 | Ga0207690_101621393 | 164 |
| 117 | 3300025933 | Ga0207706_10007351 | Ga0207706_100073513 | 164 |
| 118 | 3300025934 | Ga0207686_10158382 | Ga0207686_101583823 | 164 |
| 119 | 3300025937 | Ga0207669_10149697 | Ga0207669_101496973 | 164 |
| 120 | 3300025941 | Ga0207711_10277038 | Ga0207711_102770382 | 164 |
| 121 | 3300025945 | Ga0207679_10368489 | Ga0207679_103684892 | 164 |
| 122 | 3300025972 | Ga0207668_10607998 | Ga0207668_106079982 | 164 |
| 123 | 3300025986 | Ga0207658_10080928 | Ga0207658_100809282 | 164 |
| 124 | 3300026023 | Ga0207677_10134660 | Ga0207677_101346601 | 164 |
| 125 | 3300026078 | Ga0207702_10104404 | Ga0207702_101044043 | 164 |
| 126 | 3300026121 | Ga0207683_10012478 | Ga0207683_100124787 | 164 |
| 127 | 3300026142 | Ga0207698_10394762 | Ga0207698_103947622 | 164 |
| 128 | 3300028379 | Ga0268266_10407987 | Ga0268266_104079872 | 164 |
| 129 | 3300028381 | Ga0268264_12320602 | Ga0268264_123206021 | 164 |
| 130 | 3300034957 | Ga0373938_0076778 | Ga0373938_0076778_119_613 | 164 |
| 131 | 3300035691 | Ga0373931_0345537 | Ga0373931_0345537_34_528 | 164 |
| 132 | 3300037418 | Ga0395900_0027416 | Ga0395900_0027416_149_643 | 164 |
| 133 | 3300037466 | Ga0395898_0089245 | Ga0395898_0089245_918_1412 | 164 |
| 134 | 3300038443 | Ga0395901_0240981 | Ga0395901_0240981_1358_1852 | 164 |
| 135 | 3300048904 | Ga0496101_0251701 | Ga0496101_0251701_736_1230 | 164 |
| 136 | 3300048905 | Ga0496102_0351826 | Ga0496102_0351826_812_1306 | 164 |
| 137 | 3300048906 | Ga0496103_0016288 | Ga0496103_0016288_188_682 | 164 |
| 138 | 3300048908 | Ga0496105_0103044 | Ga0496105_0103044_1205_1699 | 164 |
| 139 | 3300048910 | Ga0496107_0011923 | Ga0496107_0011923_5478_5972 | 164 |
| 140 | 3300048911 | Ga0496108_1336756 | Ga0496108_1336756_90_584 | 164 |
| 141 | 3300048912 | Ga0496109_0346772 | Ga0496109_0346772_507_1001 | 164 |
| 142 | 3300048912 | Ga0496109_0451309 | Ga0496109_0451309_581_1075 | 164 |
| 143 | 3300048913 | Ga0496110_0017892 | Ga0496110_0017892_4934_5428 | 164 |
| 144 | 3300048914 | Ga0496111_0141209 | Ga0496111_0141209_253_747 | 164 |
| 145 | 3300048915 | Ga0496112_0247979 | Ga0496112_0247979_87_581 | 164 |
| 146 | 3300048916 | Ga0496113_0138100 | Ga0496113_0138100_1407_1901 | 164 |
| 147 | 3300048917 | Ga0496114_0566546 | Ga0496114_0566546_245_739 | 164 |
| 148 | 3300001915 | JGI24741J21665_1020694 | JGI24741J21665_10206942 | 165 |
| 149 | 3300001979 | JGI24740J21852_10010064 | JGI24740J21852_100100642 | 165 |
| 150 | 3300001979 | JGI24740J21852_10014842 | JGI24740J21852_100148422 | 165 |
| 151 | 3300001979 | JGI24740J21852_10051691 | JGI24740J21852_100516912 | 165 |
| 152 | 3300001989 | JGI24739J22299_10001236 | JGI24739J22299_100012368 | 165 |
| 153 | 3300001989 | JGI24739J22299_10012130 | JGI24739J22299_100121303 | 165 |
| 154 | 3300001990 | JGI24737J22298_10001280 | JGI24737J22298_100012808 | 165 |
| 155 | 3300001991 | JGI24743J22301_10010710 | JGI24743J22301_100107103 | 165 |
| 156 | 3300002067 | JGI24735J21928_10022144 | JGI24735J21928_100221443 | 165 |
| 157 | 3300002075 | JGI24738J21930_10004676 | JGI24738J21930_100046765 | 165 |
| 158 | 3300002075 | JGI24738J21930_10009394 | JGI24738J21930_100093943 | 165 |
| 159 | 3300002075 | JGI24738J21930_10077866 | JGI24738J21930_100778662 | 165 |
| 160 | 3300003203 | JGI25406J46586_10153179 | JGI25406J46586_101531791 | 165 |
| 161 | 3300005290 | Ga0065712_10068456 | Ga0065712_100684563 | 165 |
| 162 | 3300005290 | Ga0065712_10117367 | Ga0065712_101173672 | 165 |
| 163 | 3300005327 | Ga0070658_10001186 | Ga0070658_1000118625 | 165 |
| 164 | 3300005327 | Ga0070658_10010418 | Ga0070658_100104188 | 165 |
| 165 | 3300005327 | Ga0070658_10078315 | Ga0070658_100783152 | 165 |
| 166 | 3300005327 | Ga0070658_10164813 | Ga0070658_101648132 | 165 |
| 167 | 3300005328 | Ga0070676_10231108 | Ga0070676_102311082 | 165 |
| 168 | 3300005328 | Ga0070676_10255021 | Ga0070676_102550212 | 165 |
| 169 | 3300005328 | Ga0070676_10386038 | Ga0070676_103860382 | 165 |
| 170 | 3300005329 | Ga0070683_100004557 | Ga0070683_10000455713 | 165 |
| 171 | 3300005329 | Ga0070683_100009073 | Ga0070683_1000090738 | 165 |
| 172 | 3300005329 | Ga0070683_100092986 | Ga0070683_1000929863 | 165 |
| 173 | 3300005329 | Ga0070683_100105954 | Ga0070683_1001059543 | 165 |
| 174 | 3300005331 | Ga0070670_100002608 | Ga0070670_1000026089 | 165 |
| 175 | 3300005331 | Ga0070670_100021727 | Ga0070670_1000217278 | 165 |
| 176 | 3300005331 | Ga0070670_100037531 | Ga0070670_1000375315 | 165 |
| 177 | 3300005331 | Ga0070670_100056034 | Ga0070670_1000560343 | 165 |
| 178 | 3300005331 | Ga0070670_100122546 | Ga0070670_1001225462 | 165 |
| 179 | 3300005331 | Ga0070670_100540607 | Ga0070670_1005406072 | 165 |
| 180 | 3300005333 | Ga0070677_10030433 | Ga0070677_100304331 | 165 |
| 181 | 3300005333 | Ga0070677_10410202 | Ga0070677_104102022 | 165 |
| 182 | 3300005333 | Ga0070677_10472442 | Ga0070677_104724422 | 165 |
| 183 | 3300005334 | Ga0068869_100144463 | Ga0068869_1001444632 | 165 |
| 184 | 3300005335 | Ga0070666_10011522 | Ga0070666_100115222 | 165 |
| 185 | 3300005335 | Ga0070666_10013233 | Ga0070666_100132336 | 165 |
| 186 | 3300005335 | Ga0070666_10024213 | Ga0070666_100242135 | 165 |
| 187 | 3300005335 | Ga0070666_10029514 | Ga0070666_100295144 | 165 |
| 188 | 3300005335 | Ga0070666_10083930 | Ga0070666_100839303 | 165 |
| 189 | 3300005335 | Ga0070666_10400570 | Ga0070666_104005702 | 165 |
| 190 | 3300005337 | Ga0070682_100347852 | Ga0070682_1003478522 | 165 |
| 191 | 3300005338 | Ga0068868_100001432 | Ga0068868_10000143220 | 165 |
| 192 | 3300005338 | Ga0068868_100121714 | Ga0068868_1001217143 | 165 |
| 193 | 3300005338 | Ga0068868_100445123 | Ga0068868_1004451232 | 165 |
| 194 | 3300005338 | Ga0068868_100903308 | Ga0068868_1009033082 | 165 |
| 195 | 3300005339 | Ga0070660_100000707 | Ga0070660_10000070721 | 165 |
| 196 | 3300005339 | Ga0070660_100006342 | Ga0070660_1000063427 | 165 |
| 197 | 3300005339 | Ga0070660_100028508 | Ga0070660_1000285081 | 165 |
| 198 | 3300005339 | Ga0070660_100298811 | Ga0070660_1002988112 | 165 |
| 199 | 3300005343 | Ga0070687_100291325 | Ga0070687_1002913252 | 165 |
| 200 | 3300005344 | Ga0070661_100000101 | Ga0070661_10000010161 | 165 |
| 201 | 3300005344 | Ga0070661_100006080 | Ga0070661_1000060807 | 165 |
| 202 | 3300005344 | Ga0070661_100011558 | Ga0070661_1000115585 | 165 |
| 203 | 3300005344 | Ga0070661_100083601 | Ga0070661_1000836013 | 165 |
| 204 | 3300005344 | Ga0070661_100170313 | Ga0070661_1001703132 | 165 |
| 205 | 3300005344 | Ga0070661_100720474 | Ga0070661_1007204741 | 165 |
| 206 | 3300005345 | Ga0070692_10012745 | Ga0070692_100127455 | 165 |
| 207 | 3300005347 | Ga0070668_100746386 | Ga0070668_1007463862 | 165 |
| 208 | 3300005353 | Ga0070669_100037548 | Ga0070669_1000375482 | 165 |
| 209 | 3300005353 | Ga0070669_100159692 | Ga0070669_1001596923 | 165 |
| 210 | 3300005353 | Ga0070669_100184210 | Ga0070669_1001842103 | 165 |
| 211 | 3300005353 | Ga0070669_100307334 | Ga0070669_1003073341 | 165 |
| 212 | 3300005353 | Ga0070669_100942922 | Ga0070669_1009429221 | 165 |
| 213 | 3300005353 | Ga0070669_101109158 | Ga0070669_1011091582 | 165 |
| 214 | 3300005354 | Ga0070675_100001714 | Ga0070675_10000171414 | 165 |
| 215 | 3300005354 | Ga0070675_100031113 | Ga0070675_1000311135 | 165 |
| 216 | 3300005354 | Ga0070675_100041860 | Ga0070675_1000418605 | 165 |
| 217 | 3300005354 | Ga0070675_100152720 | Ga0070675_1001527202 | 165 |
| 218 | 3300005354 | Ga0070675_100627348 | Ga0070675_1006273482 | 165 |
| 219 | 3300005355 | Ga0070671_100002144 | Ga0070671_10000214411 | 165 |
| 220 | 3300005355 | Ga0070671_100086364 | Ga0070671_1000863644 | 165 |
| 221 | 3300005355 | Ga0070671_100202037 | Ga0070671_1002020372 | 165 |
| 222 | 3300005355 | Ga0070671_100256109 | Ga0070671_1002561092 | 165 |
| 223 | 3300005355 | Ga0070671_101446392 | Ga0070671_1014463921 | 165 |
| 224 | 3300005356 | Ga0070674_100043232 | Ga0070674_1000432324 | 165 |
| 225 | 3300005356 | Ga0070674_100141964 | Ga0070674_1001419642 | 165 |
| 226 | 3300005364 | Ga0070673_100000809 | Ga0070673_1000008098 | 165 |
| 227 | 3300005364 | Ga0070673_100014339 | Ga0070673_1000143395 | 165 |
| 228 | 3300005364 | Ga0070673_100026517 | Ga0070673_1000265177 | 165 |
| 229 | 3300005364 | Ga0070673_100037408 | Ga0070673_1000374082 | 165 |
| 230 | 3300005364 | Ga0070673_100313351 | Ga0070673_1003133512 | 165 |
| 231 | 3300005366 | Ga0070659_100000045 | Ga0070659_100000045100 | 165 |
| 232 | 3300005366 | Ga0070659_100029842 | Ga0070659_1000298426 | 165 |
| 233 | 3300005366 | Ga0070659_100080394 | Ga0070659_1000803942 | 165 |
| 234 | 3300005366 | Ga0070659_100441628 | Ga0070659_1004416282 | 165 |
| 235 | 3300005366 | Ga0070659_101234341 | Ga0070659_1012343411 | 165 |
| 236 | 3300005366 | Ga0070659_101480723 | Ga0070659_1014807231 | 165 |
| 237 | 3300005367 | Ga0070667_100021775 | Ga0070667_1000217756 | 165 |
| 238 | 3300005367 | Ga0070667_100026727 | Ga0070667_1000267276 | 165 |
| 239 | 3300005367 | Ga0070667_100159980 | Ga0070667_1001599802 | 165 |
| 240 | 3300005367 | Ga0070667_100877115 | Ga0070667_1008771151 | 165 |
| 241 | 3300005444 | Ga0070694_100825067 | Ga0070694_1008250671 | 165 |
| 242 | 3300005455 | Ga0070663_100001602 | Ga0070663_10000160211 | 165 |
| 243 | 3300005455 | Ga0070663_100030502 | Ga0070663_1000305024 | 165 |
| 244 | 3300005455 | Ga0070663_100447075 | Ga0070663_1004470752 | 165 |
| 245 | 3300005455 | Ga0070663_100684069 | Ga0070663_1006840691 | 165 |
| 246 | 3300005455 | Ga0070663_100945439 | Ga0070663_1009454391 | 165 |
| 247 | 3300005456 | Ga0070678_100022589 | Ga0070678_1000225892 | 165 |
| 248 | 3300005457 | Ga0070662_100000036 | Ga0070662_10000003621 | 165 |
| 249 | 3300005457 | Ga0070662_100006879 | Ga0070662_1000068798 | 165 |
| 250 | 3300005457 | Ga0070662_100028207 | Ga0070662_1000282073 | 165 |
| 251 | 3300005457 | Ga0070662_100114215 | Ga0070662_1001142153 | 165 |
| 252 | 3300005457 | Ga0070662_100268405 | Ga0070662_1002684052 | 165 |
| 253 | 3300005457 | Ga0070662_100307970 | Ga0070662_1003079702 | 165 |
| 254 | 3300005457 | Ga0070662_100366258 | Ga0070662_1003662582 | 165 |
| 255 | 3300005457 | Ga0070662_100408978 | Ga0070662_1004089782 | 165 |
| 256 | 3300005457 | Ga0070662_100462982 | Ga0070662_1004629822 | 165 |
| 257 | 3300005457 | Ga0070662_101220646 | Ga0070662_1012206461 | 165 |
| 258 | 3300005458 | Ga0070681_10079481 | Ga0070681_100794815 | 165 |
| 259 | 3300005458 | Ga0070681_10807015 | Ga0070681_108070152 | 165 |
| 260 | 3300005530 | Ga0070679_100256058 | Ga0070679_1002560582 | 165 |
| 261 | 3300005530 | Ga0070679_100442957 | Ga0070679_1004429571 | 165 |
| 262 | 3300005530 | Ga0070679_100560894 | Ga0070679_1005608942 | 165 |
| 263 | 3300005535 | Ga0070684_100141106 | Ga0070684_1001411062 | 165 |
| 264 | 3300005539 | Ga0068853_100000059 | Ga0068853_10000005971 | 165 |
| 265 | 3300005539 | Ga0068853_100063347 | Ga0068853_1000633474 | 165 |
| 266 | 3300005539 | Ga0068853_100571222 | Ga0068853_1005712222 | 165 |
| 267 | 3300005543 | Ga0070672_100000841 | Ga0070672_1000008418 | 165 |
| 268 | 3300005543 | Ga0070672_100017944 | Ga0070672_1000179443 | 165 |
| 269 | 3300005543 | Ga0070672_100116825 | Ga0070672_1001168254 | 165 |
| 270 | 3300005545 | Ga0070695_100304238 | Ga0070695_1003042382 | 165 |
| 271 | 3300005546 | Ga0070696_100215402 | Ga0070696_1002154023 | 165 |
| 272 | 3300005547 | Ga0070693_100002442 | Ga0070693_1000024429 | 165 |
| 273 | 3300005548 | Ga0070665_100009353 | Ga0070665_10000935310 | 165 |
| 274 | 3300005548 | Ga0070665_100018026 | Ga0070665_1000180268 | 165 |
| 275 | 3300005548 | Ga0070665_100022026 | Ga0070665_1000220268 | 165 |
| 276 | 3300005548 | Ga0070665_100106194 | Ga0070665_1001061942 | 165 |
| 277 | 3300005548 | Ga0070665_100241751 | Ga0070665_1002417512 | 165 |
| 278 | 3300005563 | Ga0068855_100003816 | Ga0068855_10000381618 | 165 |
| 279 | 3300005563 | Ga0068855_100051577 | Ga0068855_1000515772 | 165 |
| 280 | 3300005563 | Ga0068855_100325153 | Ga0068855_1003251533 | 165 |
| 281 | 3300005563 | Ga0068855_100411460 | Ga0068855_1004114602 | 165 |
| 282 | 3300005564 | Ga0070664_100000027 | Ga0070664_10000002721 | 165 |
| 283 | 3300005564 | Ga0070664_100001887 | Ga0070664_1000018878 | 165 |
| 284 | 3300005564 | Ga0070664_100023734 | Ga0070664_1000237344 | 165 |
| 285 | 3300005564 | Ga0070664_100118968 | Ga0070664_1001189682 | 165 |
| 286 | 3300005564 | Ga0070664_100430810 | Ga0070664_1004308102 | 165 |
| 287 | 3300005564 | Ga0070664_100757234 | Ga0070664_1007572342 | 165 |
| 288 | 3300005577 | Ga0068857_100021317 | Ga0068857_1000213172 | 165 |
| 289 | 3300005577 | Ga0068857_100035284 | Ga0068857_1000352842 | 165 |
| 290 | 3300005578 | Ga0068854_100002620 | Ga0068854_1000026209 | 165 |
| 291 | 3300005578 | Ga0068854_100006961 | Ga0068854_1000069614 | 165 |
| 292 | 3300005578 | Ga0068854_100010386 | Ga0068854_1000103865 | 165 |
| 293 | 3300005578 | Ga0068854_100589527 | Ga0068854_1005895272 | 165 |
| 294 | 3300005614 | Ga0068856_100000699 | Ga0068856_10000069921 | 165 |
| 295 | 3300005614 | Ga0068856_100060969 | Ga0068856_1000609696 | 165 |
| 296 | 3300005614 | Ga0068856_101249569 | Ga0068856_1012495691 | 165 |
| 297 | 3300005616 | Ga0068852_100000647 | Ga0068852_10000064721 | 165 |
| 298 | 3300005616 | Ga0068852_100019017 | Ga0068852_1000190175 | 165 |
| 299 | 3300005616 | Ga0068852_100054625 | Ga0068852_1000546253 | 165 |
| 300 | 3300005616 | Ga0068852_100229253 | Ga0068852_1002292531 | 165 |
| 301 | 3300005616 | Ga0068852_100297209 | Ga0068852_1002972093 | 165 |
| 302 | 3300005617 | Ga0068859_100034991 | Ga0068859_1000349912 | 165 |
| 303 | 3300005617 | Ga0068859_100116695 | Ga0068859_1001166954 | 165 |
| 304 | 3300005617 | Ga0068859_100620673 | Ga0068859_1006206732 | 165 |
| 305 | 3300005618 | Ga0068864_100013694 | Ga0068864_1000136945 | 165 |
| 306 | 3300005618 | Ga0068864_100018649 | Ga0068864_1000186497 | 165 |
| 307 | 3300005834 | Ga0068851_10015145 | Ga0068851_100151454 | 165 |
| 308 | 3300005834 | Ga0068851_10146969 | Ga0068851_101469692 | 165 |
| 309 | 3300005841 | Ga0068863_100293959 | Ga0068863_1002939593 | 165 |
| 310 | 3300005841 | Ga0068863_100371305 | Ga0068863_1003713052 | 165 |
| 311 | 3300005841 | Ga0068863_100452671 | Ga0068863_1004526712 | 165 |
| 312 | 3300005842 | Ga0068858_100001436 | Ga0068858_1000014366 | 165 |
| 313 | 3300005842 | Ga0068858_100011909 | Ga0068858_1000119094 | 165 |
| 314 | 3300005842 | Ga0068858_100105083 | Ga0068858_1001050834 | 165 |
| 315 | 3300005843 | Ga0068860_100280367 | Ga0068860_1002803672 | 165 |
| 316 | 3300005843 | Ga0068860_100396393 | Ga0068860_1003963932 | 165 |
| 317 | 3300005843 | Ga0068860_101109410 | Ga0068860_1011094102 | 165 |
| 318 | 3300005985 | Ga0081539_10281172 | Ga0081539_102811722 | 165 |
| 319 | 3300006058 | Ga0075432_10260207 | Ga0075432_102602072 | 165 |
| 320 | 3300006237 | Ga0097621_100738190 | Ga0097621_1007381902 | 165 |
| 321 | 3300006237 | Ga0097621_101962914 | Ga0097621_1019629141 | 165 |
| 322 | 3300006358 | Ga0068871_100607748 | Ga0068871_1006077482 | 165 |
| 323 | 3300006846 | Ga0075430_100158655 | Ga0075430_1001586552 | 165 |
| 324 | 3300006880 | Ga0075429_100478694 | Ga0075429_1004786942 | 165 |
| 325 | 3300006881 | Ga0068865_100061757 | Ga0068865_1000617574 | 165 |
| 326 | 3300006931 | Ga0097620_100034990 | Ga0097620_1000349902 | 165 |
| 327 | 3300006931 | Ga0097620_100116698 | Ga0097620_1001166984 | 165 |
| 328 | 3300006931 | Ga0097620_100620630 | Ga0097620_1006206302 | 165 |
| 329 | 3300009093 | Ga0105240_10010384 | Ga0105240_100103849 | 165 |
| 330 | 3300009094 | Ga0111539_11322747 | Ga0111539_113227472 | 165 |
| 331 | 3300009174 | Ga0105241_10622026 | Ga0105241_106220262 | 165 |
| 332 | 3300009177 | Ga0105248_10001529 | Ga0105248_1000152912 | 165 |
| 333 | 3300009177 | Ga0105248_10007926 | Ga0105248_100079268 | 165 |
| 334 | 3300009177 | Ga0105248_10577592 | Ga0105248_105775922 | 165 |
| 335 | 3300009177 | Ga0105248_12350139 | Ga0105248_123501391 | 165 |
| 336 | 3300009551 | Ga0105238_10053894 | Ga0105238_100538942 | 165 |
| 337 | 3300009551 | Ga0105238_10129953 | Ga0105238_101299533 | 165 |
| 338 | 3300009553 | Ga0105249_10773075 | Ga0105249_107730752 | 165 |
| 339 | 3300013100 | Ga0157373_10189860 | Ga0157373_101898603 | 165 |
| 340 | 3300013100 | Ga0157373_10684424 | Ga0157373_106844242 | 165 |
| 341 | 3300013102 | Ga0157371_10004543 | Ga0157371_1000454312 | 165 |
| 342 | 3300013102 | Ga0157371_10029097 | Ga0157371_100290975 | 165 |
| 343 | 3300013102 | Ga0157371_10489506 | Ga0157371_104895062 | 165 |
| 344 | 3300013104 | Ga0157370_10008454 | Ga0157370_1000845412 | 165 |
| 345 | 3300013104 | Ga0157370_10465274 | Ga0157370_104652742 | 165 |
| 346 | 3300013105 | Ga0157369_10099482 | Ga0157369_100994823 | 165 |
| 347 | 3300013105 | Ga0157369_10361778 | Ga0157369_103617782 | 165 |
| 348 | 3300013105 | Ga0157369_12183949 | Ga0157369_121839491 | 165 |
| 349 | 3300013296 | Ga0157374_10010355 | Ga0157374_100103554 | 165 |
| 350 | 3300013296 | Ga0157374_10040864 | Ga0157374_100408642 | 165 |
| 351 | 3300013297 | Ga0157378_10840045 | Ga0157378_108400452 | 165 |
| 352 | 3300013306 | Ga0163162_10012953 | Ga0163162_100129534 | 165 |
| 353 | 3300013306 | Ga0163162_10721395 | Ga0163162_107213952 | 165 |
| 354 | 3300013307 | Ga0157372_10009481 | Ga0157372_100094816 | 165 |
| 355 | 3300013307 | Ga0157372_10209612 | Ga0157372_102096123 | 165 |
| 356 | 3300013308 | Ga0157375_10050138 | Ga0157375_100501382 | 165 |
| 357 | 3300013308 | Ga0157375_10763645 | Ga0157375_107636452 | 165 |
| 358 | 3300013308 | Ga0157375_10781847 | Ga0157375_107818471 | 165 |
| 359 | 3300014325 | Ga0163163_10000187 | Ga0163163_1000018757 | 165 |
| 360 | 3300014326 | Ga0157380_11915642 | Ga0157380_119156422 | 165 |
| 361 | 3300014968 | Ga0157379_10095031 | Ga0157379_100950312 | 165 |
| 362 | 3300017792 | Ga0163161_10041659 | Ga0163161_100416594 | 165 |
| 363 | 3300025315 | Ga0207697_10028036 | Ga0207697_100280363 | 165 |
| 364 | 3300025315 | Ga0207697_10222505 | Ga0207697_102225051 | 165 |
| 365 | 3300025321 | Ga0207656_10016002 | Ga0207656_100160023 | 165 |
| 366 | 3300025321 | Ga0207656_10024806 | Ga0207656_100248064 | 165 |
| 367 | 3300025893 | Ga0207682_10328123 | Ga0207682_103281232 | 165 |
| 368 | 3300025893 | Ga0207682_10360451 | Ga0207682_103604511 | 165 |
| 369 | 3300025901 | Ga0207688_10583593 | Ga0207688_105835932 | 165 |
| 370 | 3300025903 | Ga0207680_10000896 | Ga0207680_100008969 | 165 |
| 371 | 3300025903 | Ga0207680_10001103 | Ga0207680_100011032 | 165 |
| 372 | 3300025903 | Ga0207680_10022675 | Ga0207680_100226752 | 165 |
| 373 | 3300025903 | Ga0207680_10319440 | Ga0207680_103194402 | 165 |
| 374 | 3300025903 | Ga0207680_10452914 | Ga0207680_104529142 | 165 |
| 375 | 3300025904 | Ga0207647_10016771 | Ga0207647_100167718 | 165 |
| 376 | 3300025904 | Ga0207647_10027617 | Ga0207647_100276175 | 165 |
| 377 | 3300025904 | Ga0207647_10046780 | Ga0207647_100467802 | 165 |
| 378 | 3300025904 | Ga0207647_10097430 | Ga0207647_100974302 | 165 |
| 379 | 3300025907 | Ga0207645_10224690 | Ga0207645_102246902 | 165 |
| 380 | 3300025907 | Ga0207645_10327103 | Ga0207645_103271032 | 165 |
| 381 | 3300025909 | Ga0207705_10000912 | Ga0207705_1000091229 | 165 |
| 382 | 3300025909 | Ga0207705_10042473 | Ga0207705_100424733 | 165 |
| 383 | 3300025909 | Ga0207705_10090003 | Ga0207705_100900032 | 165 |
| 384 | 3300025909 | Ga0207705_10160813 | Ga0207705_101608132 | 165 |
| 385 | 3300025909 | Ga0207705_10209519 | Ga0207705_102095193 | 165 |
| 386 | 3300025909 | Ga0207705_10372357 | Ga0207705_103723572 | 165 |
| 387 | 3300025909 | Ga0207705_10474475 | Ga0207705_104744752 | 165 |
| 388 | 3300025912 | Ga0207707_10233209 | Ga0207707_102332093 | 165 |
| 389 | 3300025912 | Ga0207707_10239796 | Ga0207707_102397962 | 165 |
| 390 | 3300025913 | Ga0207695_10004614 | Ga0207695_100046149 | 165 |
| 391 | 3300025917 | Ga0207660_10094066 | Ga0207660_100940663 | 165 |
| 392 | 3300025919 | Ga0207657_10000133 | Ga0207657_1000013382 | 165 |
| 393 | 3300025919 | Ga0207657_10003883 | Ga0207657_1000388312 | 165 |
| 394 | 3300025919 | Ga0207657_10005051 | Ga0207657_100050515 | 165 |
| 395 | 3300025919 | Ga0207657_10169942 | Ga0207657_101699422 | 165 |
| 396 | 3300025919 | Ga0207657_10261527 | Ga0207657_102615272 | 165 |
| 397 | 3300025919 | Ga0207657_10875150 | Ga0207657_108751502 | 165 |
| 398 | 3300025920 | Ga0207649_10000680 | Ga0207649_1000068011 | 165 |
| 399 | 3300025920 | Ga0207649_10014355 | Ga0207649_100143553 | 165 |
| 400 | 3300025920 | Ga0207649_10043625 | Ga0207649_100436253 | 165 |
| 401 | 3300025920 | Ga0207649_10075399 | Ga0207649_100753993 | 165 |
| 402 | 3300025920 | Ga0207649_10096230 | Ga0207649_100962302 | 165 |
| 403 | 3300025920 | Ga0207649_10243205 | Ga0207649_102432051 | 165 |
| 404 | 3300025920 | Ga0207649_10503584 | Ga0207649_105035842 | 165 |
| 405 | 3300025920 | Ga0207649_10577621 | Ga0207649_105776212 | 165 |
| 406 | 3300025921 | Ga0207652_10004117 | Ga0207652_1000411715 | 165 |
| 407 | 3300025921 | Ga0207652_10700728 | Ga0207652_107007281 | 165 |
| 408 | 3300025923 | Ga0207681_10061772 | Ga0207681_100617723 | 165 |
| 409 | 3300025923 | Ga0207681_10110624 | Ga0207681_101106243 | 165 |
| 410 | 3300025923 | Ga0207681_10155828 | Ga0207681_101558281 | 165 |
| 411 | 3300025923 | Ga0207681_10182466 | Ga0207681_101824662 | 165 |
| 412 | 3300025923 | Ga0207681_10254900 | Ga0207681_102549002 | 165 |
| 413 | 3300025923 | Ga0207681_10301952 | Ga0207681_103019522 | 165 |
| 414 | 3300025923 | Ga0207681_10389530 | Ga0207681_103895302 | 165 |
| 415 | 3300025923 | Ga0207681_11045414 | Ga0207681_110454141 | 165 |
| 416 | 3300025924 | Ga0207694_10031714 | Ga0207694_100317147 | 165 |
| 417 | 3300025925 | Ga0207650_10004757 | Ga0207650_1000475711 | 165 |
| 418 | 3300025925 | Ga0207650_10048011 | Ga0207650_100480114 | 165 |
| 419 | 3300025925 | Ga0207650_10088564 | Ga0207650_100885642 | 165 |
| 420 | 3300025925 | Ga0207650_10163718 | Ga0207650_101637182 | 165 |
| 421 | 3300025925 | Ga0207650_10492157 | Ga0207650_104921571 | 165 |
| 422 | 3300025926 | Ga0207659_10001712 | Ga0207659_1000171215 | 165 |
| 423 | 3300025926 | Ga0207659_10013351 | Ga0207659_100133512 | 165 |
| 424 | 3300025926 | Ga0207659_10070747 | Ga0207659_100707471 | 165 |
| 425 | 3300025926 | Ga0207659_10131259 | Ga0207659_101312592 | 165 |
| 426 | 3300025926 | Ga0207659_10255685 | Ga0207659_102556853 | 165 |
| 427 | 3300025926 | Ga0207659_10563406 | Ga0207659_105634062 | 165 |
| 428 | 3300025931 | Ga0207644_10028004 | Ga0207644_100280043 | 165 |
| 429 | 3300025931 | Ga0207644_10039094 | Ga0207644_100390942 | 165 |
| 430 | 3300025931 | Ga0207644_10048420 | Ga0207644_100484202 | 165 |
| 431 | 3300025931 | Ga0207644_10252557 | Ga0207644_102525572 | 165 |
| 432 | 3300025932 | Ga0207690_10000080 | Ga0207690_1000008071 | 165 |
| 433 | 3300025932 | Ga0207690_10122599 | Ga0207690_101225992 | 165 |
| 434 | 3300025932 | Ga0207690_10191170 | Ga0207690_101911702 | 165 |
| 435 | 3300025933 | Ga0207706_10000159 | Ga0207706_1000015982 | 165 |
| 436 | 3300025933 | Ga0207706_10005845 | Ga0207706_1000584511 | 165 |
| 437 | 3300025933 | Ga0207706_10012188 | Ga0207706_100121884 | 165 |
| 438 | 3300025933 | Ga0207706_10016374 | Ga0207706_100163746 | 165 |
| 439 | 3300025933 | Ga0207706_10022333 | Ga0207706_100223337 | 165 |
| 440 | 3300025933 | Ga0207706_10052604 | Ga0207706_100526044 | 165 |
| 441 | 3300025933 | Ga0207706_10065216 | Ga0207706_100652165 | 165 |
| 442 | 3300025933 | Ga0207706_10126577 | Ga0207706_101265774 | 165 |
| 443 | 3300025933 | Ga0207706_10823916 | Ga0207706_108239162 | 165 |
| 444 | 3300025936 | Ga0207670_10251706 | Ga0207670_102517062 | 165 |
| 445 | 3300025936 | Ga0207670_10397142 | Ga0207670_103971422 | 165 |
| 446 | 3300025937 | Ga0207669_10013884 | Ga0207669_100138843 | 165 |
| 447 | 3300025937 | Ga0207669_10086594 | Ga0207669_100865944 | 165 |
| 448 | 3300025940 | Ga0207691_10002529 | Ga0207691_100025299 | 165 |
| 449 | 3300025940 | Ga0207691_10248236 | Ga0207691_102482362 | 165 |
| 450 | 3300025940 | Ga0207691_10288558 | Ga0207691_102885583 | 165 |
| 451 | 3300025940 | Ga0207691_11215090 | Ga0207691_112150901 | 165 |
| 452 | 3300025941 | Ga0207711_10007466 | Ga0207711_100074664 | 165 |
| 453 | 3300025941 | Ga0207711_10019049 | Ga0207711_100190498 | 165 |
| 454 | 3300025941 | Ga0207711_10029794 | Ga0207711_100297944 | 165 |
| 455 | 3300025941 | Ga0207711_10455616 | Ga0207711_104556162 | 165 |
| 456 | 3300025944 | Ga0207661_10038601 | Ga0207661_100386012 | 165 |
| 457 | 3300025944 | Ga0207661_10051516 | Ga0207661_100515164 | 165 |
| 458 | 3300025944 | Ga0207661_10102387 | Ga0207661_101023872 | 165 |
| 459 | 3300025944 | Ga0207661_10164037 | Ga0207661_101640371 | 165 |
| 460 | 3300025945 | Ga0207679_10001226 | Ga0207679_100012262 | 165 |
| 461 | 3300025945 | Ga0207679_10008147 | Ga0207679_100081478 | 165 |
| 462 | 3300025945 | Ga0207679_10657260 | Ga0207679_106572602 | 165 |
| 463 | 3300025945 | Ga0207679_10791595 | Ga0207679_107915952 | 165 |
| 464 | 3300025945 | Ga0207679_11125821 | Ga0207679_111258212 | 165 |
| 465 | 3300025949 | Ga0207667_10005833 | Ga0207667_1000583312 | 165 |
| 466 | 3300025949 | Ga0207667_10007031 | Ga0207667_100070318 | 165 |
| 467 | 3300025949 | Ga0207667_11275056 | Ga0207667_112750562 | 165 |
| 468 | 3300025960 | Ga0207651_10029148 | Ga0207651_100291482 | 165 |
| 469 | 3300025960 | Ga0207651_10253837 | Ga0207651_102538372 | 165 |
| 470 | 3300025960 | Ga0207651_10423125 | Ga0207651_104231252 | 165 |
| 471 | 3300025961 | Ga0207712_10089823 | Ga0207712_100898232 | 165 |
| 472 | 3300025972 | Ga0207668_10148409 | Ga0207668_101484092 | 165 |
| 473 | 3300025972 | Ga0207668_10585121 | Ga0207668_105851212 | 165 |
| 474 | 3300025981 | Ga0207640_10001181 | Ga0207640_1000118110 | 165 |
| 475 | 3300025981 | Ga0207640_10155332 | Ga0207640_101553322 | 165 |
| 476 | 3300025981 | Ga0207640_10687074 | Ga0207640_106870742 | 165 |
| 477 | 3300025986 | Ga0207658_10044959 | Ga0207658_100449595 | 165 |
| 478 | 3300025986 | Ga0207658_10058789 | Ga0207658_100587894 | 165 |
| 479 | 3300025986 | Ga0207658_10075335 | Ga0207658_100753353 | 165 |
| 480 | 3300026023 | Ga0207677_10016567 | Ga0207677_100165672 | 165 |
| 481 | 3300026035 | Ga0207703_10004976 | Ga0207703_1000497611 | 165 |
| 482 | 3300026035 | Ga0207703_10012033 | Ga0207703_100120338 | 165 |
| 483 | 3300026035 | Ga0207703_10014199 | Ga0207703_100141994 | 165 |
| 484 | 3300026041 | Ga0207639_10001590 | Ga0207639_1000159012 | 165 |
| 485 | 3300026041 | Ga0207639_10609663 | Ga0207639_106096632 | 165 |
| 486 | 3300026041 | Ga0207639_10635847 | Ga0207639_106358472 | 165 |
| 487 | 3300026041 | Ga0207639_11467371 | Ga0207639_114673711 | 165 |
| 488 | 3300026067 | Ga0207678_10003713 | Ga0207678_1000371312 | 165 |
| 489 | 3300026067 | Ga0207678_10017778 | Ga0207678_100177786 | 165 |
| 490 | 3300026067 | Ga0207678_10126739 | Ga0207678_101267393 | 165 |
| 491 | 3300026067 | Ga0207678_10131551 | Ga0207678_101315512 | 165 |
| 492 | 3300026067 | Ga0207678_10254631 | Ga0207678_102546313 | 165 |
| 493 | 3300026078 | Ga0207702_10000246 | Ga0207702_100002469 | 165 |
| 494 | 3300026078 | Ga0207702_10297875 | Ga0207702_102978753 | 165 |
| 495 | 3300026078 | Ga0207702_10363223 | Ga0207702_103632232 | 165 |
| 496 | 3300026088 | Ga0207641_10040156 | Ga0207641_100401563 | 165 |
| 497 | 3300026088 | Ga0207641_10406726 | Ga0207641_104067262 | 165 |
| 498 | 3300026088 | Ga0207641_10430237 | Ga0207641_104302372 | 165 |
| 499 | 3300026089 | Ga0207648_10506200 | Ga0207648_105062002 | 165 |
| 500 | 3300026095 | Ga0207676_10186455 | Ga0207676_101864553 | 165 |
| 501 | 3300026095 | Ga0207676_10460221 | Ga0207676_104602211 | 165 |
| 502 | 3300026116 | Ga0207674_10009817 | Ga0207674_1000981711 | 165 |
| 503 | 3300026116 | Ga0207674_10048018 | Ga0207674_100480186 | 165 |
| 504 | 3300026121 | Ga0207683_10027998 | Ga0207683_100279982 | 165 |
| 505 | 3300026121 | Ga0207683_10282213 | Ga0207683_102822132 | 165 |
| 506 | 3300026142 | Ga0207698_10000759 | Ga0207698_1000075912 | 165 |
| 507 | 3300026142 | Ga0207698_10024082 | Ga0207698_100240826 | 165 |
| 508 | 3300026142 | Ga0207698_10070313 | Ga0207698_100703135 | 165 |
| 509 | 3300026142 | Ga0207698_10234705 | Ga0207698_102347053 | 165 |
| 510 | 3300026142 | Ga0207698_10494010 | Ga0207698_104940102 | 165 |
| 511 | 3300026142 | Ga0207698_11475287 | Ga0207698_114752871 | 165 |
| 512 | 3300027876 | Ga0209974_10056674 | Ga0209974_100566742 | 165 |
| 513 | 3300027907 | Ga0207428_10874123 | Ga0207428_108741231 | 165 |
| 514 | 3300028379 | Ga0268266_10012378 | Ga0268266_100123788 | 165 |
| 515 | 3300028379 | Ga0268266_10029745 | Ga0268266_100297452 | 165 |
| 516 | 3300028379 | Ga0268266_10038097 | Ga0268266_100380974 | 165 |
| 517 | 3300028379 | Ga0268266_10065905 | Ga0268266_100659052 | 165 |
| 518 | 3300028380 | Ga0268265_10246843 | Ga0268265_102468432 | 165 |
| 519 | 3300028381 | Ga0268264_10120588 | Ga0268264_101205883 | 165 |
| 520 | 3300028381 | Ga0268264_10132890 | Ga0268264_101328902 | 165 |
| 521 | 3300031251 | Ga0265327_10026289 | Ga0265327_100262893 | 165 |
| 522 | 3300031548 | Ga0307408_100019242 | Ga0307408_1000192426 | 165 |
| 523 | 3300031548 | Ga0307408_100078786 | Ga0307408_1000787863 | 165 |
| 524 | 3300031731 | Ga0307405_10173335 | Ga0307405_101733352 | 165 |
| 525 | 3300031731 | Ga0307405_10790121 | Ga0307405_107901212 | 165 |
| 526 | 3300031824 | Ga0307413_10037496 | Ga0307413_100374963 | 165 |
| 527 | 3300031824 | Ga0307413_10142862 | Ga0307413_101428622 | 165 |
| 528 | 3300031824 | Ga0307413_10254331 | Ga0307413_102543312 | 165 |
| 529 | 3300031824 | Ga0307413_10425741 | Ga0307413_104257412 | 165 |
| 530 | 3300031824 | Ga0307413_10935868 | Ga0307413_109358682 | 165 |
| 531 | 3300031852 | Ga0307410_10000318 | Ga0307410_1000031816 | 165 |
| 532 | 3300031852 | Ga0307410_10033090 | Ga0307410_100330904 | 165 |
| 533 | 3300031852 | Ga0307410_10038729 | Ga0307410_100387293 | 165 |
| 534 | 3300031852 | Ga0307410_10184712 | Ga0307410_101847122 | 165 |
| 535 | 3300031852 | Ga0307410_10242133 | Ga0307410_102421332 | 165 |
| 536 | 3300031852 | Ga0307410_11257112 | Ga0307410_112571122 | 165 |
| 537 | 3300031901 | Ga0307406_10117751 | Ga0307406_101177512 | 165 |
| 538 | 3300031901 | Ga0307406_10120499 | Ga0307406_101204992 | 165 |
| 539 | 3300031901 | Ga0307406_10203884 | Ga0307406_102038843 | 165 |
| 540 | 3300031911 | Ga0307412_10036091 | Ga0307412_100360912 | 165 |
| 541 | 3300031911 | Ga0307412_10143732 | Ga0307412_101437323 | 165 |
| 542 | 3300031911 | Ga0307412_10315175 | Ga0307412_103151751 | 165 |
| 543 | 3300031911 | Ga0307412_10600551 | Ga0307412_106005512 | 165 |
| 544 | 3300031911 | Ga0307412_10683428 | Ga0307412_106834282 | 165 |
| 545 | 3300031995 | Ga0307409_100016988 | Ga0307409_1000169881 | 165 |
| 546 | 3300031995 | Ga0307409_100137087 | Ga0307409_1001370873 | 165 |
| 547 | 3300031995 | Ga0307409_100195101 | Ga0307409_1001951012 | 165 |
| 548 | 3300031995 | Ga0307409_100561639 | Ga0307409_1005616392 | 165 |
| 549 | 3300031995 | Ga0307409_100689919 | Ga0307409_1006899192 | 165 |
| 550 | 3300032002 | Ga0307416_100031399 | Ga0307416_1000313993 | 165 |
| 551 | 3300032002 | Ga0307416_100031584 | Ga0307416_1000315845 | 165 |
| 552 | 3300032002 | Ga0307416_100276263 | Ga0307416_1002762632 | 165 |
| 553 | 3300032002 | Ga0307416_100619393 | Ga0307416_1006193932 | 165 |
| 554 | 3300032002 | Ga0307416_101083653 | Ga0307416_1010836532 | 165 |
| 555 | 3300032002 | Ga0307416_101119731 | Ga0307416_1011197312 | 165 |
| 556 | 3300032004 | Ga0307414_10002184 | Ga0307414_100021844 | 165 |
| 557 | 3300032004 | Ga0307414_10003044 | Ga0307414_100030443 | 165 |
| 558 | 3300032004 | Ga0307414_10074760 | Ga0307414_100747603 | 165 |
| 559 | 3300032004 | Ga0307414_10196687 | Ga0307414_101966872 | 165 |
| 560 | 3300032005 | Ga0307411_10021174 | Ga0307411_100211742 | 165 |
| 561 | 3300032005 | Ga0307411_10052358 | Ga0307411_100523584 | 165 |
| 562 | 3300032005 | Ga0307411_10204897 | Ga0307411_102048972 | 165 |
| 563 | 3300032126 | Ga0307415_100007926 | Ga0307415_1000079264 | 165 |
| 564 | 3300032126 | Ga0307415_100190779 | Ga0307415_1001907793 | 165 |
| 565 | 3300032126 | Ga0307415_101185178 | Ga0307415_1011851782 | 165 |
| 566 | 3300034820 | Ga0373959_0098206 | Ga0373959_0098206_107_604 | 165 |
| 567 | 3300035085 | Ga0373929_0083490 | Ga0373929_0083490_50_547 | 165 |
| 568 | 3300035121 | Ga0373960_0082981 | Ga0373960_0082981_125_622 | 165 |
| 569 | 3300037312 | Ga0395899_0010088 | Ga0395899_0010088_239_736 | 165 |
| 570 | 3300037312 | Ga0395899_0013975 | Ga0395899_0013975_229_726 | 165 |
| 571 | 3300037312 | Ga0395899_0014720 | Ga0395899_0014720_3950_4447 | 165 |
| 572 | 3300037312 | Ga0395899_0031251 | Ga0395899_0031251_379_876 | 165 |
| 573 | 3300037312 | Ga0395899_0128790 | Ga0395899_0128790_866_1363 | 165 |
| 574 | 3300037312 | Ga0395899_0450918 | Ga0395899_0450918_182_679 | 165 |
| 575 | 3300037418 | Ga0395900_0006695 | Ga0395900_0006695_4461_4961 | 165 |
| 576 | 3300037418 | Ga0395900_0011778 | Ga0395900_0011778_8028_8525 | 165 |
| 577 | 3300037418 | Ga0395900_0018717 | Ga0395900_0018717_3712_4209 | 165 |
| 578 | 3300037418 | Ga0395900_0030421 | Ga0395900_0030421_4822_5319 | 165 |
| 579 | 3300037418 | Ga0395900_0037001 | Ga0395900_0037001_3666_4163 | 165 |
| 580 | 3300037418 | Ga0395900_0091833 | Ga0395900_0091833_1513_2010 | 165 |
| 581 | 3300037418 | Ga0395900_0091851 | Ga0395900_0091851_1034_1534 | 165 |
| 582 | 3300037418 | Ga0395900_0145621 | Ga0395900_0145621_1532_2029 | 165 |
| 583 | 3300037418 | Ga0395900_0168774 | Ga0395900_0168774_1455_1952 | 165 |
| 584 | 3300037418 | Ga0395900_0238708 | Ga0395900_0238708_596_1093 | 165 |
| 585 | 3300037418 | Ga0395900_0302554 | Ga0395900_0302554_790_1287 | 165 |
| 586 | 3300037466 | Ga0395898_0035058 | Ga0395898_0035058_2628_3125 | 165 |
| 587 | 3300037466 | Ga0395898_0064763 | Ga0395898_0064763_379_876 | 165 |
| 588 | 3300037466 | Ga0395898_0398552 | Ga0395898_0398552_120_617 | 165 |
| 589 | 3300037471 | Ga0395905_0000187 | Ga0395905_0000187_35408_35905 | 165 |
| 590 | 3300037471 | Ga0395905_0000215 | Ga0395905_0000215_43653_44150 | 165 |
| 591 | 3300037471 | Ga0395905_0008278 | Ga0395905_0008278_8701_9198 | 165 |
| 592 | 3300037471 | Ga0395905_0017175 | Ga0395905_0017175_4741_5241 | 165 |
| 593 | 3300037471 | Ga0395905_0034610 | Ga0395905_0034610_56_553 | 165 |
| 594 | 3300037471 | Ga0395905_0122444 | Ga0395905_0122444_1029_1526 | 165 |
| 595 | 3300037471 | Ga0395905_0266814 | Ga0395905_0266814_507_1004 | 165 |
| 596 | 3300037471 | Ga0395905_0300883 | Ga0395905_0300883_948_1445 | 165 |
| 597 | 3300037471 | Ga0395905_0341959 | Ga0395905_0341959_98_595 | 165 |
| 598 | 3300037471 | Ga0395905_0586353 | Ga0395905_0586353_189_686 | 165 |
| 599 | 3300037471 | Ga0395905_0628439 | Ga0395905_0628439_86_586 | 165 |
| 600 | 3300038443 | Ga0395901_0000876 | Ga0395901_0000876_27945_28442 | 165 |
| 601 | 3300038443 | Ga0395901_0001382 | Ga0395901_0001382_11290_11787 | 165 |
| 602 | 3300038443 | Ga0395901_0104829 | Ga0395901_0104829_578_1078 | 165 |
| 603 | 3300038443 | Ga0395901_0129726 | Ga0395901_0129726_307_807 | 165 |
| 604 | 3300038443 | Ga0395901_0188467 | Ga0395901_0188467_879_1376 | 165 |
| 605 | 3300038443 | Ga0395901_0436348 | Ga0395901_0436348_406_903 | 165 |
| 606 | 3300038443 | Ga0395901_0465587 | Ga0395901_0465587_450_947 | 165 |
| 607 | 3300038443 | Ga0395901_0795543 | Ga0395901_0795543_350_847 | 165 |
| 608 | 3300042439 | Ga0439464_0003664 | Ga0439464_0003664_797_1294 | 165 |
| 609 | 3300044693 | Ga0466961_0127827 | Ga0466961_0127827_11_508 | 165 |
| 610 | 3300044694 | Ga0466963_0078624 | Ga0466963_0078624_831_1328 | 165 |
| 611 | 3300044706 | Ga0466964_0049526 | Ga0466964_0049526_318_815 | 165 |
| 612 | 3300044719 | Ga0466971_0033232 | Ga0466971_0033232_903_1400 | 165 |
| 613 | 3300044765 | Ga0466970_0190225 | Ga0466970_0190225_35_532 | 165 |
| 614 | 3300044842 | Ga0466957_0255467 | Ga0466957_0255467_324_821 | 165 |
| 615 | 3300045049 | Ga0466959_0596947 | Ga0466959_0596947_146_643 | 165 |
| 616 | 3300045836 | Ga0466958_0258943 | Ga0466958_0258943_78_575 | 165 |
| 617 | 3300045836 | Ga0466958_0336100 | Ga0466958_0336100_185_682 | 165 |
| 618 | 3300046525 | Ga0495663_0059024 | Ga0495663_0059024_59_556 | 165 |
| 619 | 3300046525 | Ga0495663_0182087 | Ga0495663_0182087_53_550 | 165 |
| 620 | 3300046537 | Ga0495598_0001145 | Ga0495598_0001145_3374_3874 | 165 |
| 621 | 3300046539 | Ga0495621_0044704 | Ga0495621_0044704_24_524 | 165 |
| 622 | 3300046558 | Ga0495633_0015973 | Ga0495633_0015973_465_965 | 165 |
| 623 | 3300046616 | Ga0495668_0038691 | Ga0495668_0038691_1399_1896 | 165 |
| 624 | 3300046664 | Ga0495659_0002607 | Ga0495659_0002607_1293_1793 | 165 |
| 625 | 3300046664 | Ga0495659_0065611 | Ga0495659_0065611_77_577 | 165 |
| 626 | 3300046665 | Ga0495661_0334067 | Ga0495661_0334067_74_571 | 165 |
| 627 | 3300046674 | Ga0495588_0064987 | Ga0495588_0064987_974_1471 | 165 |
| 628 | 3300046684 | Ga0495669_0011541 | Ga0495669_0011541_1725_2222 | 165 |
| 629 | 3300046684 | Ga0495669_0011559 | Ga0495669_0011559_2213_2710 | 165 |
| 630 | 3300046684 | Ga0495669_0013564 | Ga0495669_0013564_192_692 | 165 |
| 631 | 3300046684 | Ga0495669_0020477 | Ga0495669_0020477_2064_2561 | 165 |
| 632 | 3300046684 | Ga0495669_0036507 | Ga0495669_0036507_1629_2126 | 165 |
| 633 | 3300046684 | Ga0495669_0062378 | Ga0495669_0062378_556_1053 | 165 |
| 634 | 3300046691 | Ga0495670_0039869 | Ga0495670_0039869_1643_2143 | 165 |
| 635 | 3300046691 | Ga0495670_0188136 | Ga0495670_0188136_552_1052 | 165 |
| 636 | 3300047318 | Ga0495636_0053983 | Ga0495636_0053983_810_1307 | 165 |
| 637 | 3300047323 | Ga0495683_0039357 | Ga0495683_0039357_160_657 | 165 |
| 638 | 3300048909 | Ga0496106_0347103 | Ga0496106_0347103_309_806 | 165 |
| 639 | 3300048911 | Ga0496108_0734008 | Ga0496108_0734008_315_812 | 165 |
| 640 | 3300048911 | Ga0496108_1179051 | Ga0496108_1179051_127_624 | 165 |
| 641 | 3300048912 | Ga0496109_0040809 | Ga0496109_0040809_480_977 | 165 |
| 642 | 3300048912 | Ga0496109_0697105 | Ga0496109_0697105_246_743 | 165 |
| 643 | 3300048913 | Ga0496110_0007383 | Ga0496110_0007383_3199_3696 | 165 |
| 644 | 3300048914 | Ga0496111_0532492 | Ga0496111_0532492_122_619 | 165 |
| 645 | 3300048917 | Ga0496114_0680298 | Ga0496114_0680298_302_799 | 165 |
| 646 | 3300049572 | Ga0501036_0569406 | Ga0501036_0569406_180_746 | 165 |
| 647 | 3300049577 | Ga0501041_0115290 | Ga0501041_0115290_252_818 | 165 |
| 648 | 3300049584 | Ga0501068_0091796 | Ga0501068_0091796_1328_1825 | 165 |
| 649 | 3300049588 | Ga0501072_0115968 | Ga0501072_0115968_102_668 | 165 |
| 650 | 3300049591 | Ga0501075_0132269 | Ga0501075_0132269_1076_1642 | 165 |
| 651 | 3300049742 | Ga0501080_0262972 | Ga0501080_0262972_93_659 | 165 |
| 652 | 3300053083 | Ga0495655_0075872 | Ga0495655_0075872_74_571 | 165 |
| 653 | 3300053083 | Ga0495655_0083155 | Ga0495655_0083155_261_758 | 165 |
| 654 | 3300061719 | Ga0466962_0067512 | Ga0466962_0067512_322_819 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u69-assembly2.cif.gz_D | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.946 | 4 | 157 |
| 1u69-assembly1.cif.gz_A | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9308 | 4 | 157 |
| 1u69-assembly2.cif.gz_D | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9273 | 4 | 157 |
| 1u69-assembly3.cif.gz_C | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9245 | 4 | 157 |
| 1u69-assembly1.cif.gz_A | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9137 | 4 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1u69D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9388 | 4 | 157 | 3.10.180.10 |
| 1u69D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9198 | 4 | 157 | 3.10.180.10 |
| af_Q2G1U2_73_132_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8778 | 75 | 120 | 3.30.720.110 |
| af_P16681_7_147_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7221 | 9 | 116 | 3.10.180.10 |
| af_I1N1R1_19_162_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7046 | 5 | 120 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3P670-F1-model_v4 | deleted | 1.001 | 83 | 159 |
|
| AF-A0A534H6Z1-F1-model_v4 | VOC family protein | 0.9983 | 80 | 161 |
|
| AF-K1YPH7-F1-model_v4 | PhnB-like domain-containing protein | 0.9971 | 98 | 159 |
|
| AF-A0A7W0WRQ8-F1-model_v4 | VOC family protein | 0.9934 | 85 | 159 |
|
| AF-A0A435UWU8-F1-model_v4 | deleted | 0.991 | 78 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar