F472834

General Info

Members Datasets Scaffolds Average Seq Length
654 286 637 189

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10016952|Ga0075370_100169524
Length 222
Sequence MPGGLPDWHAHKPAGTNRRAQTAGFIAAADGDIVDRVRALIIVDMQNDFCEGGSLPVTGAAALAPAINEYLAGEPGYQHVVATKDYHIDPGDHFSDHPDFSSSWPVHCRAGSAGADFHPDLDTTPIEAIFRKGAYAAAYSGFEGVDEGGTPLLGWLRQRGVDEVDVVGVATDHCVRRTAEDAARAGFATRVLVDLVAGVAADSTEKALTEMRAAAIALVESS

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
8 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
9 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
10 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
11 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
12 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
13 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
14 2920879853 Kocuria salina CV6 Isolate Unclassified
15 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
16 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
17 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
175 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
176 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
177 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 1.38
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 10.7
Nodule 0.15
Rhizoplane 8.41
Rhizosphere 76.91
Stem 0
Stem Tuber 0
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003649 3300000549 Bacteria 2045
2 JGI24737J22298_10027915 3300001990 Bacteria 1777
3 JGI24735J21928_10053686 3300002067 Bacteria 1161
4 Ga0058862_12892104 3300004803 Bacteria 1311
5 Ga0070658_10009109 3300005327 Bacteria 7981
6 Ga0070658_10059767 3300005327 Bacteria 3104
7 Ga0070658_10062170 3300005327 Bacteria 3043
8 Ga0070683_100001861 3300005329 Bacteria 16469
9 Ga0070683_100037152 3300005329 Bacteria 4458
10 Ga0070683_100053804 3300005329 Bacteria 3731
11 Ga0070670_100647432 3300005331 Bacteria 948
12 Ga0070680_100000200 3300005336 Bacteria 39048
13 Ga0070680_100002368 3300005336 Bacteria 13929
14 Ga0070680_100230621 3300005336 Bacteria 1564
15 Ga0070682_100005518 3300005337 Bacteria 7041
16 Ga0068868_100264029 3300005338 Bacteria 1453
17 Ga0070660_100078056 3300005339 Bacteria 2596
18 Ga0070689_100629193 3300005340 Bacteria 932
19 Ga0070691_10346090 3300005341 Bacteria 824
20 Ga0070661_100105226 3300005344 Bacteria 2103
21 Ga0070692_10004188 3300005345 Bacteria 5981
22 Ga0070674_100086493 3300005356 Bacteria 2252
23 Ga0070674_100504136 3300005356 Bacteria 1008
24 Ga0070674_100547089 3300005356 Bacteria 971
25 Ga0070659_100862893 3300005366 Bacteria 790
26 Ga0070659_101010824 3300005366 Bacteria 730
27 Ga0070714_100013219 3300005435 Bacteria 6608
28 Ga0070714_100030191 3300005435 Bacteria 4510
29 Ga0070714_100061304 3300005435 Bacteria 3230
30 Ga0070713_100147932 3300005436 Bacteria 2087
31 Ga0070713_100572420 3300005436 Bacteria 1071
32 Ga0070711_100962760 3300005439 Bacteria 731
33 Ga0070663_100141707 3300005455 Bacteria 1836
34 Ga0070678_100058612 3300005456 Bacteria 2827
35 Ga0070678_100078733 3300005456 Bacteria 2491
36 Ga0070681_10000052 3300005458 Bacteria 81490
37 Ga0070681_10018251 3300005458 Bacteria 7011
38 Ga0070681_10443581 3300005458 Bacteria 1210
39 Ga0070685_10013113 3300005466 Bacteria 4364
40 Ga0070706_100336483 3300005467 Bacteria 1407
41 Ga0070707_100026218 3300005468 Bacteria 5533
42 Ga0070707_100747715 3300005468 Bacteria 941
43 Ga0070698_100036927 3300005471 Bacteria 5041
44 Ga0070698_100046720 3300005471 Bacteria 4427
45 Ga0070698_100099122 3300005471 Bacteria 2887
46 Ga0070698_100523986 3300005471 Bacteria 1124
47 Ga0070679_100000018 3300005530 Bacteria 127592
48 Ga0070679_100002885 3300005530 Bacteria 15616
49 Ga0070679_100005262 3300005530 Bacteria 11976
50 Ga0070679_100236659 3300005530 Bacteria 1785
51 Ga0070684_100006183 3300005535 Bacteria 9237
52 Ga0070684_100241877 3300005535 Bacteria 1649
53 Ga0070684_100323908 3300005535 Bacteria 1416
54 Ga0070697_100079495 3300005536 Bacteria 2700
55 Ga0068853_100058831 3300005539 Bacteria 3319
56 Ga0068853_100549682 3300005539 Bacteria 1094
57 Ga0070665_100001068 3300005548 Bacteria 34157
58 Ga0070665_100037527 3300005548 Bacteria 4873
59 Ga0070665_100042027 3300005548 Bacteria 4594
60 Ga0068855_100029299 3300005563 Bacteria 6583
61 Ga0068855_100104580 3300005563 Bacteria 3256
62 Ga0068855_100256471 3300005563 Bacteria 1949
63 Ga0070664_100122123 3300005564 Bacteria 2282
64 Ga0068857_100121496 3300005577 Bacteria 2352
65 Ga0068857_100958894 3300005577 Bacteria 822
66 Ga0068854_100007951 3300005578 Bacteria 6791
67 Ga0068856_100192569 3300005614 Bacteria 2053
68 Ga0068852_100186888 3300005616 Bacteria 1952
69 Ga0068852_100859276 3300005616 Bacteria 923
70 Ga0068864_100170335 3300005618 Bacteria 1985
71 Ga0068861_100614098 3300005719 Bacteria 1000
72 Ga0068863_100474198 3300005841 Bacteria 1230
73 Ga0068860_100160294 3300005843 Bacteria 2169
74 Ga0081455_10001499 3300005937 Bacteria 28830
75 Ga0081455_10003086 3300005937 Bacteria 19410
76 Ga0081455_10034777 3300005937 Bacteria 4511
77 Ga0070717_10519438 3300006028 Bacteria 1077
78 Ga0075365_10025619 3300006038 Bacteria 3735
79 Ga0075365_10044252 3300006038 Bacteria 2916
80 Ga0075365_10093087 3300006038 Bacteria 2055
81 Ga0075365_10205794 3300006038 Bacteria 1379
82 Ga0075365_10269179 3300006038 Bacteria 1198
83 Ga0075365_10329558 3300006038 Bacteria 1075
84 Ga0075365_10462154 3300006038 Bacteria 896
85 Ga0075365_10487753 3300006038 Bacteria 871
86 Ga0075368_10035503 3300006042 Bacteria 1945
87 Ga0075368_10054728 3300006042 Bacteria 1590
88 Ga0075368_10151036 3300006042 Bacteria 970
89 Ga0075363_100007205 3300006048 Bacteria 5098
90 Ga0075363_100217299 3300006048 Bacteria 1095
91 Ga0075363_100404336 3300006048 Bacteria 803
92 Ga0075364_10000945 3300006051 Bacteria 15320
93 Ga0075364_10002837 3300006051 Bacteria 9761
94 Ga0075364_10147829 3300006051 Bacteria 1583
95 Ga0075364_10725413 3300006051 Bacteria 678
96 Ga0075432_10007942 3300006058 Bacteria 3617
97 Ga0070712_100128683 3300006175 Bacteria 1916
98 Ga0070712_100813714 3300006175 Bacteria 802
99 Ga0075362_10024977 3300006177 Bacteria 2538
100 Ga0075367_10036960 3300006178 Bacteria 2834
101 Ga0075367_10075144 3300006178 Bacteria 2038
102 Ga0075367_10248375 3300006178 Bacteria 1116
103 Ga0075367_10434592 3300006178 Bacteria 831
104 Ga0075367_10627551 3300006178 Bacteria 683
105 Ga0075369_10065581 3300006186 Bacteria 1592
106 Ga0075369_10079636 3300006186 Bacteria 1451
107 Ga0075366_10018878 3300006195 Bacteria 3985
108 Ga0075366_10035211 3300006195 Bacteria 2952
109 Ga0075366_10171761 3300006195 Bacteria 1315
110 Ga0075370_10016952 3300006353 Bacteria 3929
111 Ga0075370_10195204 3300006353 Bacteria 1194
112 Ga0075370_10273588 3300006353 Bacteria 1003
113 Ga0068871_100135096 3300006358 Bacteria 2094
114 Ga0075428_100179639 3300006844 Bacteria 2291
115 Ga0075431_100011593 3300006847 Bacteria 8890
116 Ga0075429_100008808 3300006880 Bacteria 8775
117 Ga0099794_10297847 3300007265 Bacteria 835
118 Ga0105240_10008364 3300009093 Bacteria 14807
119 Ga0105240_10119011 3300009093 Bacteria 3183
120 Ga0111539_11236149 3300009094 Bacteria 867
121 Ga0111539_11316096 3300009094 Bacteria 838
122 Ga0105245_10009576 3300009098 Bacteria 8451
123 Ga0105245_10591887 3300009098 Bacteria 1135
124 Ga0105243_10026469 3300009148 Bacteria 4439
125 Ga0105243_10152214 3300009148 Bacteria 1985
126 Ga0105241_10011187 3300009174 Bacteria 6581
127 Ga0105242_10126874 3300009176 Bacteria 2197
128 Ga0105242_10194703 3300009176 Bacteria 1797
129 Ga0105248_10138883 3300009177 Bacteria 2741
130 Ga0105237_10013245 3300009545 Bacteria 8653
131 Ga0105237_11253721 3300009545 Bacteria 748
132 Ga0105238_10007039 3300009551 Bacteria 11246
133 Ga0105239_10003376 3300010375 Bacteria 19591
134 Ga0105239_10104410 3300010375 Bacteria 3137
135 Ga0105239_10454204 3300010375 Bacteria 1454
136 Ga0105246_10002553 3300011119 Bacteria 11006
137 Ga0105246_10100493 3300011119 Bacteria 2105
138 Ga0157369_10024307 3300013105 Bacteria 6743
139 Ga0157369_10814820 3300013105 Bacteria 959
140 Ga0157369_10928979 3300013105 Bacteria 892
141 Ga0157374_10179208 3300013296 Bacteria 2069
142 Ga0163162_10004012 3300013306 Bacteria 14126
143 Ga0157372_10003758 3300013307 Bacteria 16307
144 Ga0157372_10406357 3300013307 Bacteria 1587
145 Ga0157375_10034952 3300013308 Bacteria 4792
146 Ga0157375_10286940 3300013308 Bacteria 1809
147 Ga0157375_10941208 3300013308 Bacteria 1006
148 Ga0163163_10033431 3300014325 Bacteria 4974
149 Ga0163163_10082838 3300014325 Bacteria 3212
150 Ga0163163_11732226 3300014325 Bacteria 685
151 Ga0157380_10618189 3300014326 Bacteria 1075
152 Ga0157380_11269706 3300014326 Bacteria 783
153 Ga0157377_10095550 3300014745 Bacteria 1762
154 Ga0157379_10059305 3300014968 Bacteria 3422
155 Ga0157376_10269346 3300014969 Bacteria 1599
156 Ga0157376_10310812 3300014969 Bacteria 1495
157 Ga0157376_10506782 3300014969 Bacteria 1187
158 Ga0157376_10670324 3300014969 Bacteria 1039
159 Ga0163161_10021053 3300017792 Bacteria 4583
160 Ga0163161_10022665 3300017792 Bacteria 4423
161 Ga0197907_10836942 3300020069 Bacteria 3320
162 Ga0206356_11719020 3300020070 Bacteria 1179
163 Ga0206354_10736619 3300020081 Bacteria 1568
164 Ga0206353_10232671 3300020082 Bacteria 1809
165 Ga0206353_11128717 3300020082 Bacteria 1294
166 Ga0213872_10080390 3300021361 Bacteria 1465
167 Ga0213875_10000249 3300021388 Bacteria 54258
168 Ga0224712_10008704 3300022467 Bacteria 3023
169 Ga0224712_10029128 3300022467 Bacteria 1980
170 Ga0224712_10259083 3300022467 Bacteria 805
171 Ga0207688_10034915 3300025901 Bacteria 2785
172 Ga0207647_10006988 3300025904 Bacteria 8183
173 Ga0207647_10027106 3300025904 Bacteria 3739
174 Ga0207647_10028751 3300025904 Bacteria 3607
175 Ga0207645_10614592 3300025907 Bacteria 738
176 Ga0207705_10038710 3300025909 Bacteria 3415
177 Ga0207705_10051832 3300025909 Bacteria 2953
178 Ga0207705_10119983 3300025909 Bacteria 1950
179 Ga0207684_10729692 3300025910 Bacteria 841
180 Ga0207684_10889354 3300025910 Bacteria 749
181 Ga0207654_10100280 3300025911 Bacteria 1783
182 Ga0207707_10000384 3300025912 Bacteria 46040
183 Ga0207707_10001025 3300025912 Bacteria 26798
184 Ga0207707_10316286 3300025912 Bacteria 1348
185 Ga0207695_10015897 3300025913 Bacteria 8839
186 Ga0207695_10045796 3300025913 Bacteria 4641
187 Ga0207671_10001468 3300025914 Bacteria 27232
188 Ga0207660_10000175 3300025917 Bacteria 41005
189 Ga0207660_10005894 3300025917 Bacteria 7960
190 Ga0207660_10148228 3300025917 Bacteria 1800
191 Ga0207657_10066054 3300025919 Bacteria 3081
192 Ga0207657_10083761 3300025919 Bacteria 2675
193 Ga0207657_10340038 3300025919 Bacteria 1185
194 Ga0207657_10380923 3300025919 Bacteria 1111
195 Ga0207649_10312773 3300025920 Bacteria 1152
196 Ga0207652_10000293 3300025921 Bacteria 51659
197 Ga0207652_10007355 3300025921 Bacteria 8878
198 Ga0207652_10017591 3300025921 Bacteria 5852
199 Ga0207652_10409740 3300025921 Bacteria 1223
200 Ga0207652_11187171 3300025921 Bacteria 665
201 Ga0207646_10067790 3300025922 Bacteria 3186
202 Ga0207646_10207338 3300025922 Bacteria 1770
203 Ga0207694_10003092 3300025924 Bacteria 13319
204 Ga0207659_10176548 3300025926 Bacteria 1689
205 Ga0207659_10604726 3300025926 Bacteria 935
206 Ga0207687_10019001 3300025927 Bacteria 4547
207 Ga0207687_10023514 3300025927 Bacteria 4109
208 Ga0207700_10147952 3300025928 Bacteria 1938
209 Ga0207700_10902657 3300025928 Bacteria 791
210 Ga0207664_10009318 3300025929 Bacteria 6884
211 Ga0207664_10246516 3300025929 Bacteria 1557
212 Ga0207706_10352982 3300025933 Bacteria 1278
213 Ga0207706_11022053 3300025933 Bacteria 694
214 Ga0207709_10216266 3300025935 Bacteria 1379
215 Ga0207709_10268818 3300025935 Bacteria 1254
216 Ga0207709_10526120 3300025935 Bacteria 926
217 Ga0207669_10258388 3300025937 Bacteria 1301
218 Ga0207669_10543825 3300025937 Bacteria 936
219 Ga0207691_10553797 3300025940 Bacteria 975
220 Ga0207711_10210578 3300025941 Bacteria 1776
221 Ga0207711_11156492 3300025941 Bacteria 715
222 Ga0207689_10040149 3300025942 Bacteria 3874
223 Ga0207661_10006769 3300025944 Bacteria 8116
224 Ga0207661_10025263 3300025944 Bacteria 4513
225 Ga0207661_10073705 3300025944 Bacteria 2797
226 Ga0207679_10015073 3300025945 Bacteria 5097
227 Ga0207667_10019039 3300025949 Bacteria 7674
228 Ga0207667_10389235 3300025949 Bacteria 1420
229 Ga0207667_10395376 3300025949 Bacteria 1407
230 Ga0207640_10403778 3300025981 Bacteria 1113
231 Ga0207640_10445651 3300025981 Bacteria 1066
232 Ga0207677_10106279 3300026023 Bacteria 2079
233 Ga0207639_10169153 3300026041 Bacteria 1849
234 Ga0207639_10397499 3300026041 Bacteria 1241
235 Ga0207678_10080490 3300026067 Bacteria 2789
236 Ga0207678_10434158 3300026067 Bacteria 1140
237 Ga0207708_10301567 3300026075 Bacteria 1303
238 Ga0207702_10050948 3300026078 Bacteria 3497
239 Ga0207702_10732939 3300026078 Bacteria 975
240 Ga0207641_10745002 3300026088 Bacteria 967
241 Ga0207648_10811747 3300026089 Bacteria 871
242 Ga0207676_10150381 3300026095 Bacteria 2004
243 Ga0207674_10034172 3300026116 Bacteria 5318
244 Ga0207674_10665394 3300026116 Bacteria 1006
245 Ga0207683_10021147 3300026121 Bacteria 5568
246 Ga0207683_10255276 3300026121 Bacteria 1600
247 Ga0207698_10521080 3300026142 Bacteria 1160
248 Ga0207698_11109974 3300026142 Bacteria 804
249 Ga0207428_10001546 3300027907 Bacteria 24048
250 Ga0207428_10316640 3300027907 Bacteria 1153
251 Ga0268266_10003912 3300028379 Bacteria 14476
252 Ga0268266_10068655 3300028379 Bacteria 3070
253 Ga0268266_10073140 3300028379 Bacteria 2974
254 Ga0268266_10508426 3300028379 Bacteria 1151
255 Ga0268264_10031083 3300028381 Bacteria 4378
256 Ga0268264_10135921 3300028381 Bacteria 2186
257 Ga0307515_10053283 3300028794 Bacteria 5974
258 Ga0265331_10089390 3300031250 Bacteria 1425
259 Ga0316579_10006137 3300031691 Bacteria 4883
260 Ga0307413_10914423 3300031824 Bacteria 746
261 Ga0307518_10100533 3300031838 Bacteria 2070
262 Ga0307410_10904420 3300031852 Bacteria 756
263 Ga0307406_10238420 3300031901 Bacteria 1363
264 Ga0307406_10907534 3300031901 Bacteria 750
265 Ga0307412_10997002 3300031911 Bacteria 740
266 Ga0307409_100348203 3300031995 Bacteria 1397
267 Ga0307416_100084232 3300032002 Bacteria 2701
268 Ga0307416_100601896 3300032002 Bacteria 1179
269 Ga0307416_101802163 3300032002 Bacteria 716
270 Ga0307414_10403703 3300032004 Bacteria 1188
271 Ga0307415_100395730 3300032126 Bacteria 1178
272 Ga0316583_10135817 3300032133 Bacteria 857
273 Ga0307507_10000013 3300033179 Bacteria 242708
274 Ga0307507_10031342 3300033179 Bacteria 5584
275 Ga0307507_10174856 3300033179 Bacteria 1550
276 Ga0373936_0191580 3300035113 Bacteria 900
277 Ga0373960_0063198 3300035121 Bacteria 1128
278 Ga0373937_0040759 3300036401 Bacteria 4234
279 Ga0373925_0357446 3300037068 Bacteria 1187
280 Ga0395899_0012741 3300037312 Bacteria 6442
281 Ga0395899_0200820 3300037312 Bacteria 1390
282 Ga0395900_0007584 3300037418 Bacteria 11205
283 Ga0395900_0019991 3300037418 Bacteria 6827
284 Ga0395898_0007168 3300037466 Bacteria 11838
285 Ga0395901_0013836 3300038443 Bacteria 8207
286 Ga0395901_0016154 3300038443 Bacteria 7603
287 Ga0395901_0607055 3300038443 Bacteria 1103
288 Ga0436365_1263051 3300039437 Bacteria 818
289 Ga0436365_1768712 3300039437 Bacteria 1593
290 Ga0436360_1006231 3300039438 Bacteria 3199
291 Ga0436361_1181514 3300039447 Bacteria 1637
292 Ga0439438_022198 3300041405 Bacteria 1763
293 Ga0439447_017678 3300041407 Bacteria 1939
294 Ga0451797_0236862 3300041453 Bacteria 749
295 Ga0451849_1028718 3300041505 Bacteria 820
296 Ga0451853_2720754 3300041512 Bacteria 1753
297 Ga0439448_0082929 3300042005 Bacteria 1078
298 Ga0439458_0076277 3300042157 Bacteria 851
299 Ga0439434_0003237 3300042435 Bacteria 4781
300 Ga0439464_0011028 3300042439 Bacteria 2390
301 Ga0466969_0010413 3300044656 Bacteria 4929
302 Ga0466969_0013126 3300044656 Bacteria 4364
303 Ga0466969_0138386 3300044656 Bacteria 1126
304 Ga0466972_0187581 3300044658 Bacteria 969
305 Ga0466972_0256819 3300044658 Bacteria 817
306 Ga0466972_0416015 3300044658 Bacteria 630
307 Ga0466965_0039562 3300044683 Bacteria 2318
308 Ga0466965_0054818 3300044683 Bacteria 1983
309 Ga0466965_0102466 3300044683 Bacteria 1465
310 Ga0466965_0144996 3300044683 Bacteria 1238
311 Ga0466965_0191333 3300044683 Bacteria 1082
312 Ga0466965_0256842 3300044683 Bacteria 938
313 Ga0466966_0047198 3300044684 Bacteria 2747
314 Ga0466966_0064110 3300044684 Bacteria 2314
315 Ga0466966_0252671 3300044684 Bacteria 1062
316 Ga0466961_0005509 3300044693 Bacteria 7985
317 Ga0466961_0013942 3300044693 Bacteria 5151
318 Ga0466961_0039362 3300044693 Bacteria 3031
319 Ga0466961_0140241 3300044693 Bacteria 1513
320 Ga0466961_0327656 3300044693 Bacteria 933
321 Ga0466961_0429699 3300044693 Bacteria 800
322 Ga0466961_0498613 3300044693 Bacteria 735
323 Ga0466963_0079207 3300044694 Bacteria 2223
324 Ga0466963_0084625 3300044694 Bacteria 2152
325 Ga0466963_0119599 3300044694 Bacteria 1812
326 Ga0466963_0202338 3300044694 Bacteria 1389
327 Ga0466963_0307899 3300044694 Bacteria 1114
328 Ga0466963_0368125 3300044694 Bacteria 1012
329 Ga0466963_0390639 3300044694 Bacteria 981
330 Ga0466963_0436183 3300044694 Bacteria 924
331 Ga0466963_0584664 3300044694 Bacteria 789
332 Ga0466963_0659194 3300044694 Bacteria 739
333 Ga0466964_0017258 3300044706 Bacteria 2762
334 Ga0466964_0022138 3300044706 Bacteria 2463
335 Ga0466964_0028561 3300044706 Bacteria 2198
336 Ga0466971_0016915 3300044719 Bacteria 3223
337 Ga0466971_0027398 3300044719 Bacteria 2552
338 Ga0466971_0032472 3300044719 Bacteria 2339
339 Ga0466971_0039677 3300044719 Bacteria 2113
340 Ga0466971_0048629 3300044719 Bacteria 1907
341 Ga0466971_0261482 3300044719 Bacteria 826
342 Ga0466968_0004609 3300044735 Bacteria 5157
343 Ga0466968_0204270 3300044735 Bacteria 926
344 Ga0466970_0000598 3300044765 Bacteria 17674
345 Ga0466970_0057386 3300044765 Bacteria 2082
346 Ga0466970_0067637 3300044765 Bacteria 1918
347 Ga0466970_0067946 3300044765 Bacteria 1914
348 Ga0466970_0080344 3300044765 Bacteria 1762
349 Ga0466970_0082680 3300044765 Bacteria 1737
350 Ga0466970_0096141 3300044765 Bacteria 1611
351 Ga0466970_0103656 3300044765 Bacteria 1550
352 Ga0466970_0105721 3300044765 Bacteria 1535
353 Ga0466970_0109523 3300044765 Bacteria 1508
354 Ga0466970_0109873 3300044765 Bacteria 1505
355 Ga0466970_0118129 3300044765 Bacteria 1451
356 Ga0466970_0422935 3300044765 Bacteria 762
357 Ga0466970_0482175 3300044765 Bacteria 713
358 Ga0466957_0004995 3300044842 Bacteria 7421
359 Ga0466957_0010934 3300044842 Bacteria 5220
360 Ga0466957_0094486 3300044842 Bacteria 1877
361 Ga0466957_0108701 3300044842 Bacteria 1756
362 Ga0466957_0112490 3300044842 Bacteria 1728
363 Ga0466957_0199758 3300044842 Bacteria 1313
364 Ga0466957_0246455 3300044842 Bacteria 1187
365 Ga0466957_0451582 3300044842 Bacteria 886
366 Ga0466957_0657757 3300044842 Bacteria 737
367 Ga0466960_0011351 3300044901 Bacteria 3724
368 Ga0466960_0047673 3300044901 Bacteria 2056
369 Ga0466960_0059583 3300044901 Bacteria 1868
370 Ga0466960_0099625 3300044901 Bacteria 1494
371 Ga0466960_0185414 3300044901 Bacteria 1130
372 Ga0466960_0286082 3300044901 Bacteria 925
373 Ga0466960_0315249 3300044901 Bacteria 884
374 Ga0466959_0003111 3300045049 Bacteria 10760
375 Ga0466959_0081157 3300045049 Bacteria 2337
376 Ga0466959_0155969 3300045049 Bacteria 1607
377 Ga0466959_0187167 3300045049 Bacteria 1446
378 Ga0466959_0308486 3300045049 Bacteria 1083
379 Ga0466959_0457487 3300045049 Bacteria 865
380 Ga0466959_0592106 3300045049 Bacteria 746
381 Ga0466958_0001868 3300045836 Bacteria 10287
382 Ga0466958_0036794 3300045836 Bacteria 2931
383 Ga0466958_0267605 3300045836 Bacteria 1094
384 Ga0466958_0287148 3300045836 Bacteria 1055
385 Ga0466958_0427933 3300045836 Bacteria 856
386 Ga0466967_0018913 3300045976 Bacteria 5524
387 Ga0466967_0036682 3300045976 Bacteria 4188
388 Ga0466967_0073143 3300045976 Bacteria 3074
389 Ga0466967_0152275 3300045976 Bacteria 2163
390 Ga0466967_0286121 3300045976 Bacteria 1582
391 Ga0466967_1018091 3300045976 Bacteria 825
392 Ga0466967_1487215 3300045976 Bacteria 675
393 Ga0495592_0017836 3300046454 Bacteria 5396
394 Ga0495629_0292340 3300046459 Bacteria 1117
395 Ga0495641_0023474 3300046461 Bacteria 3063
396 Ga0495651_0008132 3300046462 Bacteria 8044
397 Ga0495651_0101951 3300046462 Bacteria 2135
398 Ga0495651_0129807 3300046462 Bacteria 1841
399 Ga0495608_0129463 3300046511 Bacteria 1616
400 Ga0495628_0026610 3300046516 Bacteria 4713
401 Ga0495652_0000288 3300046529 Bacteria 59726
402 Ga0495652_0706550 3300046529 Bacteria 678
403 Ga0495645_0015629 3300046543 Bacteria 5400
404 Ga0495645_0039408 3300046543 Bacteria 3446
405 Ga0495657_0236767 3300046675 Bacteria 1103
406 Ga0495623_0360343 3300046679 Bacteria 790
407 Ga0495600_0010059 3300046809 Bacteria 5863
408 Ga0495600_0542599 3300046809 Bacteria 711
409 Ga0495581_0026637 3300047315 Bacteria 3352
410 Ga0495604_0023186 3300047317 Bacteria 4954
411 Ga0495680_0397094 3300047322 Bacteria 953
412 Ga0496100_0096006 3300048903 Bacteria 2033
413 Ga0496100_0104528 3300048903 Bacteria 1957
414 Ga0496100_0437049 3300048903 Bacteria 1001
415 Ga0496101_0009555 3300048904 Bacteria 6377
416 Ga0496101_0017044 3300048904 Bacteria 4919
417 Ga0496101_0135975 3300048904 Bacteria 1870
418 Ga0496101_0166374 3300048904 Bacteria 1693
419 Ga0496102_0010713 3300048905 Bacteria 7899
420 Ga0496102_0010935 3300048905 Bacteria 7817
421 Ga0496102_0013615 3300048905 Bacteria 7050
422 Ga0496102_0112516 3300048905 Bacteria 2539
423 Ga0496102_0436896 3300048905 Bacteria 1228
424 Ga0496102_0536950 3300048905 Bacteria 1092
425 Ga0496102_0962233 3300048905 Bacteria 775
426 Ga0496103_0014931 3300048906 Bacteria 4617
427 Ga0496103_0016740 3300048906 Bacteria 4379
428 Ga0496103_0256365 3300048906 Bacteria 1126
429 Ga0496104_0006653 3300048907 Bacteria 10172
430 Ga0496104_0112805 3300048907 Bacteria 2607
431 Ga0496105_0039705 3300048908 Bacteria 3880
432 Ga0496105_0065910 3300048908 Bacteria 2989
433 Ga0496105_0080110 3300048908 Bacteria 2697
434 Ga0496105_0785957 3300048908 Bacteria 725
435 Ga0496106_0075174 3300048909 Bacteria 2587
436 Ga0496106_0227992 3300048909 Bacteria 1487
437 Ga0496107_0081685 3300048910 Bacteria 2357
438 Ga0496108_0038651 3300048911 Bacteria 3976
439 Ga0496108_0084979 3300048911 Bacteria 2686
440 Ga0496108_0137794 3300048911 Bacteria 2101
441 Ga0496108_0279555 3300048911 Bacteria 1453
442 Ga0496109_0014537 3300048912 Bacteria 6847
443 Ga0496109_0026023 3300048912 Bacteria 5215
444 Ga0496109_0047889 3300048912 Bacteria 3888
445 Ga0496109_0079079 3300048912 Bacteria 3029
446 Ga0496109_0455677 3300048912 Bacteria 1208
447 Ga0496109_0494959 3300048912 Bacteria 1154
448 Ga0496110_0002615 3300048913 Bacteria 13555
449 Ga0496110_0142741 3300048913 Bacteria 2165
450 Ga0496110_0823482 3300048913 Bacteria 833
451 Ga0496111_0132118 3300048914 Bacteria 1848
452 Ga0496111_0155293 3300048914 Bacteria 1698
453 Ga0496111_0782721 3300048914 Bacteria 691
454 Ga0496112_0137544 3300048915 Bacteria 2413
455 Ga0496112_0199841 3300048915 Bacteria 1959
456 Ga0496113_0391331 3300048916 Bacteria 1116
457 Ga0496113_0656831 3300048916 Bacteria 838
458 Ga0496114_0006631 3300048917 Bacteria 9122
459 Ga0496114_0010389 3300048917 Bacteria 7408
460 Ga0496114_0011584 3300048917 Bacteria 7048
461 Ga0496114_0079688 3300048917 Bacteria 2765
462 Ga0496114_1042899 3300048917 Bacteria 701
463 Ga0496115_0183269 3300048918 Bacteria 1730
464 Ga0496115_0420337 3300048918 Bacteria 1083
465 Ga0496115_0733321 3300048918 Bacteria 774
466 Ga0501031_0008197 3300049568 Bacteria 6800
467 Ga0501031_0053932 3300049568 Bacteria 2620
468 Ga0501031_0063395 3300049568 Bacteria 2408
469 Ga0501031_0227359 3300049568 Bacteria 1214
470 Ga0501031_0519253 3300049568 Bacteria 768
471 Ga0501032_0017653 3300049569 Bacteria 5008
472 Ga0501032_0033128 3300049569 Bacteria 3542
473 Ga0501032_0092388 3300049569 Bacteria 2008
474 Ga0501033_0004737 3300049570 Bacteria 10884
475 Ga0501033_0011833 3300049570 Bacteria 6670
476 Ga0501033_0098023 3300049570 Bacteria 2141
477 Ga0501034_0001484 3300049571 Bacteria 30939
478 Ga0501034_0002497 3300049571 Bacteria 22075
479 Ga0501034_0018284 3300049571 Bacteria 7189
480 Ga0501034_0089958 3300049571 Bacteria 3068
481 Ga0501034_0163516 3300049571 Bacteria 2195
482 Ga0501036_0005938 3300049572 Bacteria 9891
483 Ga0501036_0027654 3300049572 Bacteria 4793
484 Ga0501036_0102797 3300049572 Bacteria 2417
485 Ga0501036_0256932 3300049572 Bacteria 1464
486 Ga0501036_0652248 3300049572 Bacteria 871
487 Ga0501037_0020944 3300049573 Bacteria 4830
488 Ga0501037_0037013 3300049573 Bacteria 3596
489 Ga0501037_0171522 3300049573 Bacteria 1542
490 Ga0501038_0095359 3300049574 Bacteria 2485
491 Ga0501039_0074437 3300049575 Bacteria 2639
492 Ga0501039_0110161 3300049575 Bacteria 2152
493 Ga0501039_0110793 3300049575 Bacteria 2146
494 Ga0501039_0361085 3300049575 Bacteria 1141
495 Ga0501039_0548076 3300049575 Bacteria 907
496 Ga0501040_0010997 3300049576 Bacteria 5918
497 Ga0501040_0250104 3300049576 Bacteria 1264
498 Ga0501040_0279249 3300049576 Bacteria 1193
499 Ga0501041_0137712 3300049577 Bacteria 1521
500 Ga0501041_0220817 3300049577 Bacteria 1189
501 Ga0501042_0074609 3300049578 Bacteria 2427
502 Ga0501042_0769405 3300049578 Bacteria 700
503 Ga0501043_0011528 3300049579 Bacteria 6920
504 Ga0501043_0105585 3300049579 Bacteria 2213
505 Ga0501043_0136560 3300049579 Bacteria 1921
506 Ga0501043_0759064 3300049579 Bacteria 704
507 Ga0501046_0000837 3300049580 Bacteria 29974
508 Ga0501046_0005031 3300049580 Bacteria 11866
509 Ga0501046_0233695 3300049580 Bacteria 1357
510 Ga0501047_0023163 3300049581 Bacteria 5962
511 Ga0501047_0398366 3300049581 Bacteria 1209
512 Ga0501047_0473909 3300049581 Bacteria 1080
513 Ga0501047_0764834 3300049581 Bacteria 781
514 Ga0501048_0025882 3300049582 Bacteria 4274
515 Ga0501048_0073647 3300049582 Bacteria 2410
516 Ga0501048_0546184 3300049582 Bacteria 831
517 Ga0501067_0001937 3300049583 Bacteria 11390
518 Ga0501067_0004724 3300049583 Bacteria 7539
519 Ga0501068_0004892 3300049584 Bacteria 7297
520 Ga0501068_0006818 3300049584 Bacteria 6316
521 Ga0501068_0088105 3300049584 Bacteria 1912
522 Ga0501068_0135011 3300049584 Bacteria 1544
523 Ga0501068_0162697 3300049584 Bacteria 1407
524 Ga0501068_0325974 3300049584 Bacteria 985
525 Ga0501069_0042144 3300049585 Bacteria 2524
526 Ga0501069_0096134 3300049585 Bacteria 1678
527 Ga0501070_0006214 3300049586 Bacteria 10168
528 Ga0501070_0006679 3300049586 Bacteria 9825
529 Ga0501070_0017209 3300049586 Bacteria 6068
530 Ga0501070_0156492 3300049586 Bacteria 1879
531 Ga0501070_0290520 3300049586 Bacteria 1332
532 Ga0501070_0308986 3300049586 Bacteria 1287
533 Ga0501070_0566084 3300049586 Bacteria 908
534 Ga0501070_0704071 3300049586 Bacteria 799
535 Ga0501070_0718865 3300049586 Bacteria 789
536 Ga0501070_0981438 3300049586 Bacteria 656
537 Ga0501071_0002975 3300049587 Bacteria 10474
538 Ga0501071_0015018 3300049587 Bacteria 5308
539 Ga0501072_0007827 3300049588 Bacteria 8116
540 Ga0501072_0016531 3300049588 Bacteria 5668
541 Ga0501072_0083824 3300049588 Bacteria 2527
542 Ga0501073_0006815 3300049589 Bacteria 8494
543 Ga0501073_0042090 3300049589 Bacteria 3225
544 Ga0501073_0104619 3300049589 Bacteria 1965
545 Ga0501074_0007789 3300049590 Bacteria 7755
546 Ga0501074_0020875 3300049590 Bacteria 4757
547 Ga0501074_0022682 3300049590 Bacteria 4563
548 Ga0501074_0124770 3300049590 Bacteria 1841
549 Ga0501075_0126956 3300049591 Bacteria 1942
550 Ga0501075_0559867 3300049591 Bacteria 872
551 Ga0501076_0011109 3300049592 Bacteria 6699
552 Ga0501077_0036670 3300049593 Bacteria 3124
553 Ga0501077_0146406 3300049593 Bacteria 1498
554 Ga0501077_0645909 3300049593 Bacteria 680
555 Ga0501079_0011457 3300049741 Bacteria 6769
556 Ga0501079_0124946 3300049741 Bacteria 2001
557 Ga0501079_0205934 3300049741 Bacteria 1537
558 Ga0501080_0025987 3300049742 Bacteria 5440
559 Ga0501080_0054792 3300049742 Bacteria 3713
560 Ga0501080_0231368 3300049742 Bacteria 1689
561 Ga0501080_0536291 3300049742 Bacteria 1043
562 Ga0501081_0252683 3300049743 Bacteria 1287
563 Ga0501081_0820749 3300049743 Bacteria 700
564 Ga0501083_0012888 3300049744 Bacteria 5847
565 Ga0501083_0169964 3300049744 Bacteria 1425
566 Ga0501083_0189244 3300049744 Bacteria 1343
567 Ga0501035_0001886 3300049822 Bacteria 21100
568 Ga0501035_0583128 3300049822 Bacteria 913
569 Ga0501035_0679279 3300049822 Bacteria 832
570 Ga0501044_0001121 3300049823 Bacteria 31806
571 Ga0501044_0075942 3300049823 Bacteria 3411
572 Ga0501044_0196047 3300049823 Bacteria 1980
573 Ga0501044_0499505 3300049823 Bacteria 1118
574 Ga0501045_0105210 3300049824 Bacteria 2091
575 Ga0501045_0158404 3300049824 Bacteria 1685
576 Ga0501045_0537606 3300049824 Bacteria 867
577 nmdc:mga03683_128184_c1 3300050489 Bacteria 1133
578 nmdc:mga03n38_12316_c1 3300050490 Bacteria 3214
579 nmdc:mga03n38_177199_c1 3300050490 Bacteria 1090
580 nmdc:mga00v17_15065_c1 3300050491 Bacteria 4334
581 nmdc:mga00v17_164083_c1 3300050491 Bacteria 1431
582 nmdc:mga00v17_353775_c1 3300050491 Bacteria 955
583 nmdc:mga00v17_5897_c1 3300050491 Bacteria 6474
584 nmdc:mga00v17_97985_c1 3300050491 Bacteria 1848
585 nmdc:mga0yw44_123912_c1 3300050492 Bacteria 1667
586 nmdc:mga0yw44_126671_c1 3300050492 Bacteria 1650
587 nmdc:mga0yw44_150882_c1 3300050492 Bacteria 1516
588 nmdc:mga0yw44_338293_c1 3300050492 Bacteria 1012
589 nmdc:mga0yw44_34567_c1 3300050492 Bacteria 2963
590 nmdc:mga0yw44_471684_c1 3300050492 Bacteria 851
591 nmdc:mga0yw44_473171_c1 3300050492 Bacteria 850
592 nmdc:mga0yw44_56321_c1 3300050492 Bacteria 2395
593 nmdc:mga0yw44_6515_c1 3300050492 Bacteria 5651
594 nmdc:mga0k408_115650_c1 3300050493 Bacteria 1587
595 nmdc:mga0k408_84802_c1 3300050493 Bacteria 1859
596 nmdc:mga0k408_92394_c1 3300050493 Bacteria 1778
597 nmdc:mga06z11_185685_c1 3300050494 Bacteria 1201
598 nmdc:mga06z11_27408_c1 3300050494 Bacteria 2723
599 nmdc:mga06z11_446613_c1 3300050494 Bacteria 781
600 nmdc:mga06z11_463190_c1 3300050494 Bacteria 766
601 nmdc:mga06z11_473553_c1 3300050494 Bacteria 758
602 nmdc:mga07m45_2428_c1 3300050496 Bacteria 8741
603 nmdc:mga07m45_326277_c1 3300050496 Bacteria 892
604 nmdc:mga07m45_351197_c1 3300050496 Bacteria 857
605 nmdc:mga08y16_1162819_c1 3300050511 Bacteria 744
606 nmdc:mga0sz30_125764_c1 3300050516 Bacteria 1128
607 Ga0495601_0205890 3300053077 Bacteria 1285
608 Ga0495612_0005084 3300053078 Bacteria 5447
609 Ga0495655_0101016 3300053083 Bacteria 854
610 Ga0495595_0369619 3300053084 Bacteria 725
611 Ga0495619_0009810 3300053085 Bacteria 6036
612 Ga0500644_0000050 3300053088 Bacteria 71907
613 Ga0500641_0001127 3300053096 Bacteria 9490
614 Ga0500641_0040656 3300053096 Bacteria 1879
615 Ga0500556_0000726 3300053104 Bacteria 19847
616 Ga0500593_000179 3300053117 Bacteria 25713
617 Ga0500642_0111613 3300053130 Bacteria 1277
618 Ga0500568_0233386 3300053139 Bacteria 671
619 Ga0500573_0148649 3300053140 Bacteria 1285
620 Ga0500573_0240167 3300053140 Bacteria 940
621 Ga0501084_0034543 3300054114 Bacteria 4228
622 Ga0501084_0046597 3300054114 Bacteria 3632
623 Ga0501084_0047926 3300054114 Bacteria 3578
624 Ga0501084_1090111 3300054114 Bacteria 671
625 Ga0501082_0043978 3300060353 Bacteria 3852
626 Ga0501082_0481827 3300060353 Bacteria 1084
627 Ga0501082_0971994 3300060353 Bacteria 742
628 Ga0501082_1243899 3300060353 Bacteria 650
629 Ga0466962_0006470 3300061719 Bacteria 5622
630 Ga0466962_0008596 3300061719 Bacteria 4894
631 Ga0466962_0077845 3300061719 Bacteria 1585
632 Ga0466962_0107769 3300061719 Bacteria 1340
633 Ga0466962_0160343 3300061719 Bacteria 1093
634 Ga0530510_0159371 3300061734 Bacteria 1669
635 Ga0530510_0354933 3300061734 Bacteria 1102
636 Ga0530510_0469192 3300061734 Bacteria 953
637 Ga0530510_0798358 3300061734 Bacteria 720

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10003086 Ga0081455_100030868 141
2 3300037312 Ga0395899_0200820 Ga0395899_0200820_13_621 142
3 3300037466 Ga0395898_0007168 Ga0395898_0007168_9105_9713 142
4 3300038443 Ga0395901_0016154 Ga0395901_0016154_4617_5225 142
5 3300037312 Ga0395899_0012741 Ga0395899_0012741_1590_2198 143
6 3300037418 Ga0395900_0019991 Ga0395900_0019991_5966_6574 143
7 3300038443 Ga0395901_0013836 Ga0395901_0013836_6576_7184 143
8 3300021361 Ga0213872_10080390 Ga0213872_100803901 146
9 3300039438 Ga0436360_1006231 Ga0436360_1006231_1332_1955 146
10 3300039447 Ga0436361_1181514 Ga0436361_1181514_727_1350 146
11 3300007265 Ga0099794_10297847 Ga0099794_102978471 147
12 3300005341 Ga0070691_10346090 Ga0070691_103460902 148
13 3300005436 Ga0070713_100147932 Ga0070713_1001479322 156
14 3300005937 Ga0081455_10034777 Ga0081455_100347774 156
15 3300006175 Ga0070712_100813714 Ga0070712_1008137141 156
16 3300025928 Ga0207700_10147952 Ga0207700_101479522 156
17 3300037068 Ga0373925_0357446 Ga0373925_0357446_339_878 157
18 3300048915 Ga0496112_0137544 Ga0496112_0137544_1903_2397 157
19 3300061734 Ga0530510_0469192 Ga0530510_0469192_11_484 157
20 3300009094 Ga0111539_11236149 Ga0111539_112361492 162
21 3300005530 Ga0070679_100002885 Ga0070679_10000288513 163
22 3300025904 Ga0207647_10006988 Ga0207647_100069882 163
23 3300025912 Ga0207707_10316286 Ga0207707_103162861 163
24 3300025917 Ga0207660_10148228 Ga0207660_101482281 163
25 3300050494 nmdc:mga06z11_473553_c1 nmdc:mga06z11_473553_c1_15_593 163
26 3300005843 Ga0068860_100160294 Ga0068860_1001602941 164
27 3300028381 Ga0268264_10135921 Ga0268264_101359211 164
28 3300044842 Ga0466957_0451582 Ga0466957_0451582_367_861 164
29 3300049822 Ga0501035_0679279 Ga0501035_0679279_38_532 164
30 3300060353 Ga0501082_1243899 Ga0501082_1243899_137_631 164
31 3300049571 Ga0501034_0002497 Ga0501034_0002497_15432_16037 165
32 3300044842 Ga0466957_0199758 Ga0466957_0199758_47_547 166
33 3300006038 Ga0075365_10205794 Ga0075365_102057942 167
34 3300006038 Ga0075365_10269179 Ga0075365_102691792 167
35 3300006042 Ga0075368_10054728 Ga0075368_100547282 167
36 3300006178 Ga0075367_10434592 Ga0075367_104345921 167
37 3300006186 Ga0075369_10065581 Ga0075369_100655812 167
38 3300006195 Ga0075366_10171761 Ga0075366_101717612 167
39 3300006353 Ga0075370_10195204 Ga0075370_101952042 167
40 3300006353 Ga0075370_10273588 Ga0075370_102735881 167
41 3300036401 Ga0373937_0040759 Ga0373937_0040759_2507_3115 167
42 3300050492 nmdc:mga0yw44_126671_c1 nmdc:mga0yw44_126671_c1_601_1209 167
43 3300050492 nmdc:mga0yw44_150882_c1 nmdc:mga0yw44_150882_c1_748_1356 167
44 3300050493 nmdc:mga0k408_92394_c1 nmdc:mga0k408_92394_c1_131_739 167
45 3300050494 nmdc:mga06z11_185685_c1 nmdc:mga06z11_185685_c1_394_1002 167
46 3300050494 nmdc:mga06z11_446613_c1 nmdc:mga06z11_446613_c1_48_656 167
47 3300050496 nmdc:mga07m45_351197_c1 nmdc:mga07m45_351197_c1_51_659 167
48 3300050511 nmdc:mga08y16_1162819_c1 nmdc:mga08y16_1162819_c1_23_631 167
49 3300048905 Ga0496102_0962233 Ga0496102_0962233_39_611 168
50 3300026075 Ga0207708_10301567 Ga0207708_103015672 170
51 3300044656 Ga0466969_0010413 Ga0466969_0010413_141_716 170
52 3300044658 Ga0466972_0416015 Ga0466972_0416015_16_528 170
53 3300044765 Ga0466970_0000598 Ga0466970_0000598_11552_12127 170
54 3300061719 Ga0466962_0160343 Ga0466962_0160343_294_869 170
55 3300006038 Ga0075365_10044252 Ga0075365_100442523 171
56 3300006048 Ga0075363_100404336 Ga0075363_1004043362 171
57 3300006051 Ga0075364_10725413 Ga0075364_107254131 171
58 3300006177 Ga0075362_10024977 Ga0075362_100249772 171
59 3300006178 Ga0075367_10036960 Ga0075367_100369602 171
60 3300006195 Ga0075366_10035211 Ga0075366_100352112 171
61 3300050491 nmdc:mga00v17_353775_c1 nmdc:mga00v17_353775_c1_314_922 171
62 3300050492 nmdc:mga0yw44_56321_c1 nmdc:mga0yw44_56321_c1_73_681 171
63 3300050493 nmdc:mga0k408_115650_c1 nmdc:mga0k408_115650_c1_694_1302 171
64 3300005366 Ga0070659_101010824 Ga0070659_1010108241 172
65 3300006178 Ga0075367_10248375 Ga0075367_102483751 172
66 3300039437 Ga0436365_1768712 Ga0436365_1768712_704_1312 172
67 3300050492 nmdc:mga0yw44_338293_c1 nmdc:mga0yw44_338293_c1_171_779 172
68 3300006038 Ga0075365_10093087 Ga0075365_100930872 173
69 3300053096 Ga0500641_0001127 Ga0500641_0001127_2921_3529 173
70 3300005327 Ga0070658_10062170 Ga0070658_100621702 175
71 3300005455 Ga0070663_100141707 Ga0070663_1001417072 175
72 3300005539 Ga0068853_100058831 Ga0068853_1000588313 175
73 3300005548 Ga0070665_100042027 Ga0070665_1000420272 175
74 3300005563 Ga0068855_100104580 Ga0068855_1001045802 175
75 3300005578 Ga0068854_100007951 Ga0068854_1000079516 175
76 3300005614 Ga0068856_100192569 Ga0068856_1001925692 175
77 3300005616 Ga0068852_100186888 Ga0068852_1001868882 175
78 3300009093 Ga0105240_10119011 Ga0105240_101190113 175
79 3300009174 Ga0105241_10011187 Ga0105241_100111876 175
80 3300009545 Ga0105237_10013245 Ga0105237_100132459 175
81 3300009551 Ga0105238_10007039 Ga0105238_100070396 175
82 3300010375 Ga0105239_10104410 Ga0105239_101044103 175
83 3300020069 Ga0197907_10836942 Ga0197907_108369423 175
84 3300022467 Ga0224712_10008704 Ga0224712_100087041 175
85 3300025904 Ga0207647_10028751 Ga0207647_100287513 175
86 3300025909 Ga0207705_10119983 Ga0207705_101199832 175
87 3300025911 Ga0207654_10100280 Ga0207654_101002802 175
88 3300025913 Ga0207695_10015897 Ga0207695_100158976 175
89 3300025914 Ga0207671_10001468 Ga0207671_1000146820 175
90 3300025924 Ga0207694_10003092 Ga0207694_100030927 175
91 3300025949 Ga0207667_10395376 Ga0207667_103953762 175
92 3300025981 Ga0207640_10403778 Ga0207640_104037782 175
93 3300026041 Ga0207639_10169153 Ga0207639_101691532 175
94 3300026078 Ga0207702_10732939 Ga0207702_107329391 175
95 3300026142 Ga0207698_10521080 Ga0207698_105210802 175
96 3300028379 Ga0268266_10068655 Ga0268266_100686553 175
97 3300047315 Ga0495581_0026637 Ga0495581_0026637_1971_2540 175
98 3300038443 Ga0395901_0607055 Ga0395901_0607055_126_707 176
99 3300050496 nmdc:mga07m45_326277_c1 nmdc:mga07m45_326277_c1_69_623 176
100 3300044693 Ga0466961_0013942 Ga0466961_0013942_1686_2258 177
101 3300049575 Ga0501039_0361085 Ga0501039_0361085_215_766 177
102 3300005327 Ga0070658_10009109 Ga0070658_100091097 178
103 3300005331 Ga0070670_100647432 Ga0070670_1006474322 178
104 3300005336 Ga0070680_100002368 Ga0070680_1000023689 178
105 3300005338 Ga0068868_100264029 Ga0068868_1002640292 178
106 3300005340 Ga0070689_100629193 Ga0070689_1006291931 178
107 3300005356 Ga0070674_100504136 Ga0070674_1005041362 178
108 3300005456 Ga0070678_100078733 Ga0070678_1000787332 178
109 3300005458 Ga0070681_10018251 Ga0070681_100182512 178
110 3300005530 Ga0070679_100005262 Ga0070679_1000052625 178
111 3300005539 Ga0068853_100549682 Ga0068853_1005496822 178
112 3300005548 Ga0070665_100037527 Ga0070665_1000375274 178
113 3300005563 Ga0068855_100029299 Ga0068855_1000292994 178
114 3300005563 Ga0068855_100256471 Ga0068855_1002564713 178
115 3300005937 Ga0081455_10001499 Ga0081455_1000149915 178
116 3300006038 Ga0075365_10329558 Ga0075365_103295581 178
117 3300006042 Ga0075368_10151036 Ga0075368_101510361 178
118 3300006058 Ga0075432_10007942 Ga0075432_100079425 178
119 3300006186 Ga0075369_10079636 Ga0075369_100796362 178
120 3300006195 Ga0075366_10018878 Ga0075366_100188784 178
121 3300009093 Ga0105240_10008364 Ga0105240_100083648 178
122 3300009094 Ga0111539_11316096 Ga0111539_113160961 178
123 3300013105 Ga0157369_10814820 Ga0157369_108148202 178
124 3300013296 Ga0157374_10179208 Ga0157374_101792082 178
125 3300014969 Ga0157376_10269346 Ga0157376_102693462 178
126 3300014969 Ga0157376_10506782 Ga0157376_105067822 178
127 3300025909 Ga0207705_10038710 Ga0207705_100387102 178
128 3300025912 Ga0207707_10001025 Ga0207707_1000102525 178
129 3300025913 Ga0207695_10045796 Ga0207695_100457965 178
130 3300025917 Ga0207660_10005894 Ga0207660_100058946 178
131 3300025921 Ga0207652_10007355 Ga0207652_1000735510 178
132 3300025926 Ga0207659_10604726 Ga0207659_106047262 178
133 3300025937 Ga0207669_10543825 Ga0207669_105438252 178
134 3300025940 Ga0207691_10553797 Ga0207691_105537971 178
135 3300025942 Ga0207689_10040149 Ga0207689_100401495 178
136 3300025949 Ga0207667_10019039 Ga0207667_100190396 178
137 3300025949 Ga0207667_10389235 Ga0207667_103892352 178
138 3300025981 Ga0207640_10445651 Ga0207640_104456511 178
139 3300026023 Ga0207677_10106279 Ga0207677_101062792 178
140 3300026041 Ga0207639_10397499 Ga0207639_103974992 178
141 3300026121 Ga0207683_10255276 Ga0207683_102552762 178
142 3300027907 Ga0207428_10316640 Ga0207428_103166402 178
143 3300028379 Ga0268266_10073140 Ga0268266_100731402 178
144 3300031250 Ga0265331_10089390 Ga0265331_100893902 178
145 3300031901 Ga0307406_10907534 Ga0307406_109075341 178
146 3300035113 Ga0373936_0191580 Ga0373936_0191580_35_643 178
147 3300037418 Ga0395900_0007584 Ga0395900_0007584_6084_6692 178
148 3300049571 Ga0501034_0001484 Ga0501034_0001484_2342_2941 178
149 3300049573 Ga0501037_0171522 Ga0501037_0171522_316_915 178
150 3300049584 Ga0501068_0006818 Ga0501068_0006818_1099_1698 178
151 3300049586 Ga0501070_0156492 Ga0501070_0156492_93_692 178
152 3300050489 nmdc:mga03683_128184_c1 nmdc:mga03683_128184_c1_81_689 178
153 3300050492 nmdc:mga0yw44_471684_c1 nmdc:mga0yw44_471684_c1_173_781 178
154 3300050493 nmdc:mga0k408_84802_c1 nmdc:mga0k408_84802_c1_754_1362 178
155 3300050494 nmdc:mga06z11_463190_c1 nmdc:mga06z11_463190_c1_129_737 178
156 3300050516 nmdc:mga0sz30_125764_c1 nmdc:mga0sz30_125764_c1_10_618 178
157 3300026089 Ga0207648_10811747 Ga0207648_108117471 179
158 3300049743 Ga0501081_0820749 Ga0501081_0820749_129_683 179
159 iso_pu_bacteria 2795385472 2795796603 179
160 iso_pu_bacteria 2884693830 2884695656 179
161 iso_pu_bacteria 2895427314 2895438738 179
162 iso_pu_bacteria 2895442618 2895445637 179
163 3300026142 Ga0207698_11109974 Ga0207698_111099742 180
164 3300028794 Ga0307515_10053283 Ga0307515_100532837 180
165 3300044683 Ga0466965_0191333 Ga0466965_0191333_258_809 180
166 3300044684 Ga0466966_0047198 Ga0466966_0047198_855_1406 180
167 3300044693 Ga0466961_0005509 Ga0466961_0005509_3627_4178 180
168 3300044694 Ga0466963_0079207 Ga0466963_0079207_1396_1947 180
169 3300044694 Ga0466963_0436183 Ga0466963_0436183_78_629 180
170 3300044735 Ga0466968_0004609 Ga0466968_0004609_912_1463 180
171 3300044842 Ga0466957_0010934 Ga0466957_0010934_2715_3266 180
172 3300045049 Ga0466959_0003111 Ga0466959_0003111_9502_10053 180
173 3300045836 Ga0466958_0001868 Ga0466958_0001868_887_1438 180
174 iso_pu_bacteria 2857481737 2857483255 180
175 iso_pu_bacteria 2984576629 2984577243 180
176 iso_pu_bacteria 2990256926 2990260654 180
177 3300013105 Ga0157369_10928979 Ga0157369_109289791 181
178 3300025941 Ga0207711_11156492 Ga0207711_111564921 181
179 3300045976 Ga0466967_0152275 Ga0466967_0152275_1459_2028 181
180 3300048905 Ga0496102_0536950 Ga0496102_0536950_503_1078 181
181 3300048906 Ga0496103_0256365 Ga0496103_0256365_19_594 181
182 3300048911 Ga0496108_0084979 Ga0496108_0084979_769_1344 181
183 3300048911 Ga0496108_0279555 Ga0496108_0279555_767_1342 181
184 3300048912 Ga0496109_0026023 Ga0496109_0026023_4528_5103 181
185 3300048912 Ga0496109_0079079 Ga0496109_0079079_1939_2514 181
186 3300048915 Ga0496112_0199841 Ga0496112_0199841_128_703 181
187 3300048916 Ga0496113_0656831 Ga0496113_0656831_231_806 181
188 3300048917 Ga0496114_0010389 Ga0496114_0010389_2848_3423 181
189 iso_pu_bacteria 2643221567 2643853562 181
190 iso_pu_bacteria 2643221624 2644137530 181
191 iso_pu_bacteria 2920879853 2920882171 181
192 3300002067 JGI24735J21928_10053686 JGI24735J21928_100536861 182
193 3300005435 Ga0070714_100013219 Ga0070714_1000132193 182
194 3300006028 Ga0070717_10519438 Ga0070717_105194382 182
195 3300009098 Ga0105245_10591887 Ga0105245_105918872 182
196 3300025919 Ga0207657_10340038 Ga0207657_103400382 182
197 3300025921 Ga0207652_10017591 Ga0207652_100175913 182
198 3300025927 Ga0207687_10019001 Ga0207687_100190016 182
199 3300025929 Ga0207664_10009318 Ga0207664_100093187 182
200 3300039437 Ga0436365_1263051 Ga0436365_1263051_43_612 182
201 3300044684 Ga0466966_0252671 Ga0466966_0252671_423_992 182
202 3300044694 Ga0466963_0390639 Ga0466963_0390639_290_859 182
203 3300044694 Ga0466963_0659194 Ga0466963_0659194_20_589 182
204 3300048903 Ga0496100_0096006 Ga0496100_0096006_1064_1639 182
205 3300048904 Ga0496101_0135975 Ga0496101_0135975_517_1092 182
206 3300048907 Ga0496104_0006653 Ga0496104_0006653_1070_1645 182
207 3300048908 Ga0496105_0039705 Ga0496105_0039705_2003_2578 182
208 3300048911 Ga0496108_0038651 Ga0496108_0038651_3013_3588 182
209 3300048912 Ga0496109_0014537 Ga0496109_0014537_392_967 182
210 3300048913 Ga0496110_0142741 Ga0496110_0142741_793_1368 182
211 3300048917 Ga0496114_0006631 Ga0496114_0006631_7430_8005 182
212 3300048918 Ga0496115_0183269 Ga0496115_0183269_782_1357 182
213 3300001990 JGI24737J22298_10027915 JGI24737J22298_100279152 183
214 3300005327 Ga0070658_10059767 Ga0070658_100597674 183
215 3300005329 Ga0070683_100001861 Ga0070683_10000186121 183
216 3300005329 Ga0070683_100053804 Ga0070683_1000538043 183
217 3300005336 Ga0070680_100000200 Ga0070680_10000020041 183
218 3300005337 Ga0070682_100005518 Ga0070682_10000551810 183
219 3300005345 Ga0070692_10004188 Ga0070692_100041882 183
220 3300005356 Ga0070674_100086493 Ga0070674_1000864932 183
221 3300005435 Ga0070714_100061304 Ga0070714_1000613044 183
222 3300005456 Ga0070678_100058612 Ga0070678_1000586123 183
223 3300005458 Ga0070681_10000052 Ga0070681_1000005230 183
224 3300005466 Ga0070685_10013113 Ga0070685_100131132 183
225 3300005471 Ga0070698_100523986 Ga0070698_1005239861 183
226 3300005530 Ga0070679_100000018 Ga0070679_10000001874 183
227 3300005535 Ga0070684_100006183 Ga0070684_1000061836 183
228 3300005577 Ga0068857_100121496 Ga0068857_1001214963 183
229 3300005618 Ga0068864_100170335 Ga0068864_1001703352 183
230 3300005841 Ga0068863_100474198 Ga0068863_1004741982 183
231 3300006178 Ga0075367_10627551 Ga0075367_106275511 183
232 3300006358 Ga0068871_100135096 Ga0068871_1001350963 183
233 3300009098 Ga0105245_10009576 Ga0105245_100095769 183
234 3300009148 Ga0105243_10026469 Ga0105243_100264692 183
235 3300009148 Ga0105243_10152214 Ga0105243_101522142 183
236 3300009176 Ga0105242_10194703 Ga0105242_101947032 183
237 3300009177 Ga0105248_10138883 Ga0105248_101388832 183
238 3300010375 Ga0105239_10003376 Ga0105239_1000337612 183
239 3300011119 Ga0105246_10002553 Ga0105246_1000255310 183
240 3300013105 Ga0157369_10024307 Ga0157369_100243073 183
241 3300013306 Ga0163162_10004012 Ga0163162_1000401212 183
242 3300013307 Ga0157372_10003758 Ga0157372_1000375812 183
243 3300013308 Ga0157375_10034952 Ga0157375_100349523 183
244 3300014325 Ga0163163_10033431 Ga0163163_100334311 183
245 3300014745 Ga0157377_10095550 Ga0157377_100955502 183
246 3300014968 Ga0157379_10059305 Ga0157379_100593052 183
247 3300014969 Ga0157376_10310812 Ga0157376_103108122 183
248 3300014969 Ga0157376_10670324 Ga0157376_106703241 183
249 3300025904 Ga0207647_10027106 Ga0207647_100271061 183
250 3300025907 Ga0207645_10614592 Ga0207645_106145922 183
251 3300025909 Ga0207705_10051832 Ga0207705_100518324 183
252 3300025912 Ga0207707_10000384 Ga0207707_1000038412 183
253 3300025917 Ga0207660_10000175 Ga0207660_1000017542 183
254 3300025919 Ga0207657_10066054 Ga0207657_100660542 183
255 3300025921 Ga0207652_10000293 Ga0207652_1000029318 183
256 3300025926 Ga0207659_10176548 Ga0207659_101765482 183
257 3300025927 Ga0207687_10023514 Ga0207687_100235142 183
258 3300025935 Ga0207709_10268818 Ga0207709_102688182 183
259 3300025941 Ga0207711_10210578 Ga0207711_102105782 183
260 3300025944 Ga0207661_10006769 Ga0207661_100067697 183
261 3300025944 Ga0207661_10073705 Ga0207661_100737053 183
262 3300026067 Ga0207678_10080490 Ga0207678_100804903 183
263 3300026078 Ga0207702_10050948 Ga0207702_100509485 183
264 3300026088 Ga0207641_10745002 Ga0207641_107450022 183
265 3300026095 Ga0207676_10150381 Ga0207676_101503812 183
266 3300026116 Ga0207674_10034172 Ga0207674_100341727 183
267 3300026121 Ga0207683_10021147 Ga0207683_100211472 183
268 3300028379 Ga0268266_10508426 Ga0268266_105084262 183
269 3300028381 Ga0268264_10031083 Ga0268264_100310836 183
270 3300031838 Ga0307518_10100533 Ga0307518_101005332 183
271 3300033179 Ga0307507_10031342 Ga0307507_100313422 183
272 3300033179 Ga0307507_10174856 Ga0307507_101748563 183
273 3300035121 Ga0373960_0063198 Ga0373960_0063198_383_958 183
274 3300042005 Ga0439448_0082929 Ga0439448_0082929_401_976 183
275 3300044693 Ga0466961_0327656 Ga0466961_0327656_142_705 183
276 3300044706 Ga0466964_0017258 Ga0466964_0017258_378_953 183
277 3300044765 Ga0466970_0105721 Ga0466970_0105721_428_997 183
278 3300045049 Ga0466959_0155969 Ga0466959_0155969_927_1496 183
279 3300045049 Ga0466959_0187167 Ga0466959_0187167_171_734 183
280 3300045049 Ga0466959_0457487 Ga0466959_0457487_131_700 183
281 3300048904 Ga0496101_0166374 Ga0496101_0166374_712_1287 183
282 3300048905 Ga0496102_0010713 Ga0496102_0010713_3450_4025 183
283 3300048905 Ga0496102_0436896 Ga0496102_0436896_603_1178 183
284 3300048906 Ga0496103_0016740 Ga0496103_0016740_3750_4325 183
285 3300048908 Ga0496105_0785957 Ga0496105_0785957_16_585 183
286 3300048910 Ga0496107_0081685 Ga0496107_0081685_179_754 183
287 3300048911 Ga0496108_0137794 Ga0496108_0137794_1045_1620 183
288 3300048912 Ga0496109_0047889 Ga0496109_0047889_555_1130 183
289 3300048913 Ga0496110_0002615 Ga0496110_0002615_3884_4459 183
290 3300049569 Ga0501032_0033128 Ga0501032_0033128_696_1256 183
291 3300049570 Ga0501033_0011833 Ga0501033_0011833_3170_3730 183
292 3300049571 Ga0501034_0089958 Ga0501034_0089958_90_650 183
293 3300049579 Ga0501043_0136560 Ga0501043_0136560_872_1432 183
294 3300049581 Ga0501047_0023163 Ga0501047_0023163_3302_3862 183
295 3300049586 Ga0501070_0718865 Ga0501070_0718865_197_766 183
296 3300049822 Ga0501035_0001886 Ga0501035_0001886_20413_20973 183
297 3300049823 Ga0501044_0001121 Ga0501044_0001121_20413_20973 183
298 3300050492 nmdc:mga0yw44_6515_c1 nmdc:mga0yw44_6515_c1_4670_5245 183
299 3300005439 Ga0070711_100962760 Ga0070711_1009627601 184
300 3300005467 Ga0070706_100336483 Ga0070706_1003364831 184
301 3300005471 Ga0070698_100036927 Ga0070698_1000369276 184
302 3300005471 Ga0070698_100046720 Ga0070698_1000467203 184
303 3300005536 Ga0070697_100079495 Ga0070697_1000794953 184
304 3300006051 Ga0075364_10000945 Ga0075364_100009452 184
305 3300006175 Ga0070712_100128683 Ga0070712_1001286833 184
306 3300006353 Ga0075370_10016952 Ga0075370_100169524 184
307 3300021388 Ga0213875_10000249 Ga0213875_1000024930 184
308 3300025910 Ga0207684_10889354 Ga0207684_108893541 184
309 3300025922 Ga0207646_10207338 Ga0207646_102073383 184
310 3300025929 Ga0207664_10246516 Ga0207664_102465163 184
311 3300050490 nmdc:mga03n38_177199_c1 nmdc:mga03n38_177199_c1_314_982 184
312 3300050491 nmdc:mga00v17_5897_c1 nmdc:mga00v17_5897_c1_1834_2502 184
313 3300053130 Ga0500642_0111613 Ga0500642_0111613_559_1131 184
314 3300005435 Ga0070714_100030191 Ga0070714_1000301912 185
315 3300005468 Ga0070707_100026218 Ga0070707_1000262182 185
316 3300005548 Ga0070665_100001068 Ga0070665_10000106811 185
317 3300013308 Ga0157375_10941208 Ga0157375_109412082 185
318 3300020081 Ga0206354_10736619 Ga0206354_107366192 185
319 3300020082 Ga0206353_10232671 Ga0206353_102326712 185
320 3300025910 Ga0207684_10729692 Ga0207684_107296922 185
321 3300025922 Ga0207646_10067790 Ga0207646_100677904 185
322 3300028379 Ga0268266_10003912 Ga0268266_100039124 185
323 3300031911 Ga0307412_10997002 Ga0307412_109970021 185
324 3300032002 Ga0307416_100084232 Ga0307416_1000842322 185
325 3300033179 Ga0307507_10000013 Ga0307507_10000013213 185
326 3300044656 Ga0466969_0013126 Ga0466969_0013126_3366_3935 185
327 3300044656 Ga0466969_0138386 Ga0466969_0138386_390_959 185
328 3300044684 Ga0466966_0064110 Ga0466966_0064110_1199_1768 185
329 3300044693 Ga0466961_0039362 Ga0466961_0039362_1268_1837 185
330 3300044693 Ga0466961_0140241 Ga0466961_0140241_478_1047 185
331 3300044694 Ga0466963_0584664 Ga0466963_0584664_10_579 185
332 3300044719 Ga0466971_0016915 Ga0466971_0016915_1281_1850 185
333 3300044719 Ga0466971_0027398 Ga0466971_0027398_1539_2108 185
334 3300044719 Ga0466971_0261482 Ga0466971_0261482_116_694 185
335 3300044765 Ga0466970_0096141 Ga0466970_0096141_185_754 185
336 3300044765 Ga0466970_0118129 Ga0466970_0118129_410_979 185
337 3300044842 Ga0466957_0246455 Ga0466957_0246455_30_599 185
338 3300044842 Ga0466957_0657757 Ga0466957_0657757_125_694 185
339 3300045049 Ga0466959_0081157 Ga0466959_0081157_469_1038 185
340 3300045836 Ga0466958_0287148 Ga0466958_0287148_438_1007 185
341 3300045836 Ga0466958_0427933 Ga0466958_0427933_184_753 185
342 3300046459 Ga0495629_0292340 Ga0495629_0292340_39_650 185
343 3300046461 Ga0495641_0023474 Ga0495641_0023474_152_751 185
344 3300046511 Ga0495608_0129463 Ga0495608_0129463_958_1548 185
345 3300046543 Ga0495645_0039408 Ga0495645_0039408_1796_2380 185
346 3300048903 Ga0496100_0104528 Ga0496100_0104528_1163_1774 185
347 3300048904 Ga0496101_0017044 Ga0496101_0017044_3578_4168 185
348 3300048905 Ga0496102_0010935 Ga0496102_0010935_54_644 185
349 3300048905 Ga0496102_0112516 Ga0496102_0112516_1435_2025 185
350 3300048906 Ga0496103_0014931 Ga0496103_0014931_1486_2076 185
351 3300048909 Ga0496106_0227992 Ga0496106_0227992_782_1372 185
352 3300048918 Ga0496115_0420337 Ga0496115_0420337_267_857 185
353 3300061719 Ga0466962_0006470 Ga0466962_0006470_1495_2064 185
354 3300061719 Ga0466962_0107769 Ga0466962_0107769_760_1329 185
355 3300005329 Ga0070683_100037152 Ga0070683_1000371521 186
356 3300005535 Ga0070684_100323908 Ga0070684_1003239081 186
357 3300022467 Ga0224712_10029128 Ga0224712_100291281 186
358 3300025944 Ga0207661_10025263 Ga0207661_100252635 186
359 3300046454 Ga0495592_0017836 Ga0495592_0017836_2819_3391 186
360 3300046462 Ga0495651_0008132 Ga0495651_0008132_4191_4763 186
361 3300046462 Ga0495651_0129807 Ga0495651_0129807_498_1067 186
362 3300046516 Ga0495628_0026610 Ga0495628_0026610_2259_2831 186
363 3300046529 Ga0495652_0000288 Ga0495652_0000288_27704_28276 186
364 3300046543 Ga0495645_0015629 Ga0495645_0015629_2961_3533 186
365 3300046809 Ga0495600_0010059 Ga0495600_0010059_2355_2927 186
366 3300047317 Ga0495604_0023186 Ga0495604_0023186_2986_3558 186
367 3300049571 Ga0501034_0018284 Ga0501034_0018284_3642_4217 186
368 3300049571 Ga0501034_0163516 Ga0501034_0163516_1565_2140 186
369 3300049572 Ga0501036_0256932 Ga0501036_0256932_244_819 186
370 3300049572 Ga0501036_0652248 Ga0501036_0652248_101_676 186
371 3300049575 Ga0501039_0110793 Ga0501039_0110793_1011_1586 186
372 3300049579 Ga0501043_0105585 Ga0501043_0105585_682_1257 186
373 3300049581 Ga0501047_0473909 Ga0501047_0473909_203_778 186
374 3300049583 Ga0501067_0001937 Ga0501067_0001937_4558_5133 186
375 3300049583 Ga0501067_0004724 Ga0501067_0004724_5156_5731 186
376 3300049584 Ga0501068_0004892 Ga0501068_0004892_3988_4563 186
377 3300049584 Ga0501068_0135011 Ga0501068_0135011_915_1490 186
378 3300049586 Ga0501070_0017209 Ga0501070_0017209_2739_3314 186
379 3300049586 Ga0501070_0290520 Ga0501070_0290520_691_1266 186
380 3300049587 Ga0501071_0015018 Ga0501071_0015018_2994_3569 186
381 3300049588 Ga0501072_0007827 Ga0501072_0007827_4516_5091 186
382 3300049588 Ga0501072_0016531 Ga0501072_0016531_679_1254 186
383 3300049589 Ga0501073_0006815 Ga0501073_0006815_4766_5341 186
384 3300049589 Ga0501073_0042090 Ga0501073_0042090_691_1266 186
385 3300049590 Ga0501074_0007789 Ga0501074_0007789_3154_3729 186
386 3300049590 Ga0501074_0020875 Ga0501074_0020875_3178_3753 186
387 3300049593 Ga0501077_0036670 Ga0501077_0036670_2248_2823 186
388 3300049593 Ga0501077_0146406 Ga0501077_0146406_264_839 186
389 3300049741 Ga0501079_0011457 Ga0501079_0011457_3602_4177 186
390 3300049741 Ga0501079_0205934 Ga0501079_0205934_877_1452 186
391 3300049742 Ga0501080_0025987 Ga0501080_0025987_2739_3314 186
392 3300049742 Ga0501080_0054792 Ga0501080_0054792_352_927 186
393 3300049744 Ga0501083_0012888 Ga0501083_0012888_1971_2546 186
394 3300049744 Ga0501083_0169964 Ga0501083_0169964_341_916 186
395 3300049823 Ga0501044_0499505 Ga0501044_0499505_175_750 186
396 3300053140 Ga0500573_0240167 Ga0500573_0240167_266_838 186
397 3300054114 Ga0501084_0034543 Ga0501084_0034543_2579_3154 186
398 3300054114 Ga0501084_0046597 Ga0501084_0046597_1938_2513 186
399 3300060353 Ga0501082_0043978 Ga0501082_0043978_2220_2795 186
400 3300060353 Ga0501082_0481827 Ga0501082_0481827_428_1003 186
401 3300005436 Ga0070713_100572420 Ga0070713_1005724202 187
402 3300025928 Ga0207700_10902657 Ga0207700_109026571 187
403 3300046462 Ga0495651_0101951 Ga0495651_0101951_994_1569 187
404 3300046679 Ga0495623_0360343 Ga0495623_0360343_19_594 187
405 3300053077 Ga0495601_0205890 Ga0495601_0205890_420_995 187
406 3300053078 Ga0495612_0005084 Ga0495612_0005084_2021_2596 187
407 3300053085 Ga0495619_0009810 Ga0495619_0009810_3771_4346 187
408 iso_pu_bacteria 2773857762 2774393849 187
409 iso_pu_bacteria 2808606439 2809195278 187
410 iso_pu_bacteria 2811994878 2812350155 187
411 iso_pu_bacteria 2891968417 2891972224 187
412 iso_pu_bacteria 8054609563 8054610542 187
413 3300005468 Ga0070707_100747715 Ga0070707_1007477151 189
414 3300005471 Ga0070698_100099122 Ga0070698_1000991223 189
415 3300006038 Ga0075365_10487753 Ga0075365_104877532 190
416 3300048914 Ga0496111_0782721 Ga0496111_0782721_73_645 190
417 3300048917 Ga0496114_1042899 Ga0496114_1042899_32_604 190
418 3300000549 LJQas_1003649 LJQas_10036492 191
419 3300004803 Ga0058862_12892104 Ga0058862_128921042 191
420 3300005336 Ga0070680_100230621 Ga0070680_1002306212 191
421 3300005339 Ga0070660_100078056 Ga0070660_1000780562 191
422 3300005344 Ga0070661_100105226 Ga0070661_1001052263 191
423 3300005356 Ga0070674_100547089 Ga0070674_1005470892 191
424 3300005366 Ga0070659_100862893 Ga0070659_1008628931 191
425 3300005458 Ga0070681_10443581 Ga0070681_104435811 191
426 3300005530 Ga0070679_100236659 Ga0070679_1002366592 191
427 3300005535 Ga0070684_100241877 Ga0070684_1002418773 191
428 3300005564 Ga0070664_100122123 Ga0070664_1001221233 191
429 3300005577 Ga0068857_100958894 Ga0068857_1009588942 191
430 3300005616 Ga0068852_100859276 Ga0068852_1008592762 191
431 3300005719 Ga0068861_100614098 Ga0068861_1006140981 191
432 3300006038 Ga0075365_10025619 Ga0075365_100256192 191
433 3300006038 Ga0075365_10462154 Ga0075365_104621542 191
434 3300006042 Ga0075368_10035503 Ga0075368_100355032 191
435 3300006048 Ga0075363_100007205 Ga0075363_1000072055 191
436 3300006048 Ga0075363_100217299 Ga0075363_1002172992 191
437 3300006051 Ga0075364_10002837 Ga0075364_1000283710 191
438 3300006051 Ga0075364_10147829 Ga0075364_101478292 191
439 3300006178 Ga0075367_10075144 Ga0075367_100751442 191
440 3300006844 Ga0075428_100179639 Ga0075428_1001796392 191
441 3300006847 Ga0075431_100011593 Ga0075431_1000115936 191
442 3300006880 Ga0075429_100008808 Ga0075429_1000088087 191
443 3300009176 Ga0105242_10126874 Ga0105242_101268742 191
444 3300009545 Ga0105237_11253721 Ga0105237_112537212 191
445 3300010375 Ga0105239_10454204 Ga0105239_104542042 191
446 3300011119 Ga0105246_10100493 Ga0105246_101004934 191
447 3300013307 Ga0157372_10406357 Ga0157372_104063572 191
448 3300013308 Ga0157375_10286940 Ga0157375_102869402 191
449 3300014325 Ga0163163_10082838 Ga0163163_100828385 191
450 3300014325 Ga0163163_11732226 Ga0163163_117322261 191
451 3300014326 Ga0157380_10618189 Ga0157380_106181892 191
452 3300014326 Ga0157380_11269706 Ga0157380_112697062 191
453 3300017792 Ga0163161_10021053 Ga0163161_100210536 191
454 3300017792 Ga0163161_10022665 Ga0163161_100226653 191
455 3300020070 Ga0206356_11719020 Ga0206356_117190201 191
456 3300020082 Ga0206353_11128717 Ga0206353_111287172 191
457 3300022467 Ga0224712_10259083 Ga0224712_102590831 191
458 3300025901 Ga0207688_10034915 Ga0207688_100349154 191
459 3300025919 Ga0207657_10083761 Ga0207657_100837612 191
460 3300025919 Ga0207657_10380923 Ga0207657_103809231 191
461 3300025920 Ga0207649_10312773 Ga0207649_103127732 191
462 3300025921 Ga0207652_10409740 Ga0207652_104097402 191
463 3300025921 Ga0207652_11187171 Ga0207652_111871711 191
464 3300025933 Ga0207706_10352982 Ga0207706_103529822 191
465 3300025933 Ga0207706_11022053 Ga0207706_110220531 191
466 3300025935 Ga0207709_10216266 Ga0207709_102162662 191
467 3300025935 Ga0207709_10526120 Ga0207709_105261202 191
468 3300025937 Ga0207669_10258388 Ga0207669_102583882 191
469 3300025945 Ga0207679_10015073 Ga0207679_100150735 191
470 3300026067 Ga0207678_10434158 Ga0207678_104341582 191
471 3300026116 Ga0207674_10665394 Ga0207674_106653942 191
472 3300027907 Ga0207428_10001546 Ga0207428_1000154621 191
473 3300031691 Ga0316579_10006137 Ga0316579_100061376 191
474 3300031824 Ga0307413_10914423 Ga0307413_109144231 191
475 3300031852 Ga0307410_10904420 Ga0307410_109044201 191
476 3300031901 Ga0307406_10238420 Ga0307406_102384202 191
477 3300031995 Ga0307409_100348203 Ga0307409_1003482032 191
478 3300032002 Ga0307416_100601896 Ga0307416_1006018963 191
479 3300032002 Ga0307416_101802163 Ga0307416_1018021631 191
480 3300032004 Ga0307414_10403703 Ga0307414_104037032 191
481 3300032126 Ga0307415_100395730 Ga0307415_1003957302 191
482 3300032133 Ga0316583_10135817 Ga0316583_101358171 191
483 3300041405 Ga0439438_022198 Ga0439438_022198_48_623 191
484 3300041407 Ga0439447_017678 Ga0439447_017678_1088_1663 191
485 3300041453 Ga0451797_0236862 Ga0451797_0236862_115_690 191
486 3300041505 Ga0451849_1028718 Ga0451849_1028718_78_653 191
487 3300041512 Ga0451853_2720754 Ga0451853_2720754_247_822 191
488 3300042157 Ga0439458_0076277 Ga0439458_0076277_88_663 191
489 3300042435 Ga0439434_0003237 Ga0439434_0003237_1843_2418 191
490 3300042439 Ga0439464_0011028 Ga0439464_0011028_1707_2282 191
491 3300044658 Ga0466972_0187581 Ga0466972_0187581_334_909 191
492 3300044658 Ga0466972_0256819 Ga0466972_0256819_23_598 191
493 3300044683 Ga0466965_0039562 Ga0466965_0039562_687_1262 191
494 3300044683 Ga0466965_0054818 Ga0466965_0054818_904_1479 191
495 3300044683 Ga0466965_0102466 Ga0466965_0102466_441_1016 191
496 3300044683 Ga0466965_0144996 Ga0466965_0144996_14_589 191
497 3300044683 Ga0466965_0256842 Ga0466965_0256842_297_872 191
498 3300044693 Ga0466961_0429699 Ga0466961_0429699_82_657 191
499 3300044693 Ga0466961_0498613 Ga0466961_0498613_21_596 191
500 3300044694 Ga0466963_0084625 Ga0466963_0084625_1373_1948 191
501 3300044694 Ga0466963_0119599 Ga0466963_0119599_1035_1610 191
502 3300044694 Ga0466963_0202338 Ga0466963_0202338_99_674 191
503 3300044694 Ga0466963_0307899 Ga0466963_0307899_401_982 191
504 3300044694 Ga0466963_0368125 Ga0466963_0368125_318_893 191
505 3300044706 Ga0466964_0022138 Ga0466964_0022138_1524_2099 191
506 3300044706 Ga0466964_0028561 Ga0466964_0028561_141_716 191
507 3300044719 Ga0466971_0032472 Ga0466971_0032472_813_1388 191
508 3300044719 Ga0466971_0039677 Ga0466971_0039677_1283_1858 191
509 3300044719 Ga0466971_0048629 Ga0466971_0048629_378_953 191
510 3300044735 Ga0466968_0204270 Ga0466968_0204270_206_781 191
511 3300044765 Ga0466970_0057386 Ga0466970_0057386_1138_1713 191
512 3300044765 Ga0466970_0067637 Ga0466970_0067637_1235_1810 191
513 3300044765 Ga0466970_0067946 Ga0466970_0067946_1208_1783 191
514 3300044765 Ga0466970_0080344 Ga0466970_0080344_1095_1670 191
515 3300044765 Ga0466970_0082680 Ga0466970_0082680_1064_1639 191
516 3300044765 Ga0466970_0103656 Ga0466970_0103656_244_819 191
517 3300044765 Ga0466970_0109523 Ga0466970_0109523_760_1335 191
518 3300044765 Ga0466970_0109873 Ga0466970_0109873_626_1201 191
519 3300044765 Ga0466970_0422935 Ga0466970_0422935_44_622 191
520 3300044765 Ga0466970_0482175 Ga0466970_0482175_52_675 191
521 3300044842 Ga0466957_0004995 Ga0466957_0004995_3056_3631 191
522 3300044842 Ga0466957_0094486 Ga0466957_0094486_866_1441 191
523 3300044842 Ga0466957_0108701 Ga0466957_0108701_670_1245 191
524 3300044842 Ga0466957_0112490 Ga0466957_0112490_542_1117 191
525 3300044901 Ga0466960_0011351 Ga0466960_0011351_1863_2438 191
526 3300044901 Ga0466960_0047673 Ga0466960_0047673_174_749 191
527 3300044901 Ga0466960_0059583 Ga0466960_0059583_430_1005 191
528 3300044901 Ga0466960_0099625 Ga0466960_0099625_146_721 191
529 3300044901 Ga0466960_0185414 Ga0466960_0185414_119_694 191
530 3300044901 Ga0466960_0286082 Ga0466960_0286082_301_879 191
531 3300044901 Ga0466960_0315249 Ga0466960_0315249_223_798 191
532 3300045049 Ga0466959_0308486 Ga0466959_0308486_195_770 191
533 3300045049 Ga0466959_0592106 Ga0466959_0592106_53_628 191
534 3300045836 Ga0466958_0036794 Ga0466958_0036794_111_686 191
535 3300045836 Ga0466958_0267605 Ga0466958_0267605_43_618 191
536 3300045976 Ga0466967_0018913 Ga0466967_0018913_238_813 191
537 3300045976 Ga0466967_0036682 Ga0466967_0036682_18_593 191
538 3300045976 Ga0466967_0073143 Ga0466967_0073143_689_1264 191
539 3300045976 Ga0466967_0286121 Ga0466967_0286121_120_695 191
540 3300045976 Ga0466967_1018091 Ga0466967_1018091_186_764 191
541 3300045976 Ga0466967_1487215 Ga0466967_1487215_58_633 191
542 3300046529 Ga0495652_0706550 Ga0495652_0706550_80_655 191
543 3300046675 Ga0495657_0236767 Ga0495657_0236767_517_1092 191
544 3300046809 Ga0495600_0542599 Ga0495600_0542599_18_593 191
545 3300047322 Ga0495680_0397094 Ga0495680_0397094_73_648 191
546 3300048903 Ga0496100_0437049 Ga0496100_0437049_282_857 191
547 3300048904 Ga0496101_0009555 Ga0496101_0009555_5247_5822 191
548 3300048905 Ga0496102_0013615 Ga0496102_0013615_4494_5069 191
549 3300048907 Ga0496104_0112805 Ga0496104_0112805_1202_1777 191
550 3300048908 Ga0496105_0065910 Ga0496105_0065910_881_1456 191
551 3300048908 Ga0496105_0080110 Ga0496105_0080110_106_681 191
552 3300048909 Ga0496106_0075174 Ga0496106_0075174_166_741 191
553 3300048912 Ga0496109_0455677 Ga0496109_0455677_78_653 191
554 3300048912 Ga0496109_0494959 Ga0496109_0494959_378_953 191
555 3300048913 Ga0496110_0823482 Ga0496110_0823482_98_673 191
556 3300048914 Ga0496111_0132118 Ga0496111_0132118_938_1513 191
557 3300048914 Ga0496111_0155293 Ga0496111_0155293_1052_1627 191
558 3300048916 Ga0496113_0391331 Ga0496113_0391331_200_775 191
559 3300048917 Ga0496114_0011584 Ga0496114_0011584_1033_1608 191
560 3300048917 Ga0496114_0079688 Ga0496114_0079688_1243_1818 191
561 3300048918 Ga0496115_0733321 Ga0496115_0733321_107_703 191
562 3300049568 Ga0501031_0008197 Ga0501031_0008197_4506_5081 191
563 3300049568 Ga0501031_0053932 Ga0501031_0053932_1123_1698 191
564 3300049568 Ga0501031_0063395 Ga0501031_0063395_1157_1732 191
565 3300049568 Ga0501031_0227359 Ga0501031_0227359_624_1199 191
566 3300049568 Ga0501031_0519253 Ga0501031_0519253_37_612 191
567 3300049569 Ga0501032_0017653 Ga0501032_0017653_2718_3293 191
568 3300049569 Ga0501032_0092388 Ga0501032_0092388_461_1036 191
569 3300049570 Ga0501033_0004737 Ga0501033_0004737_6209_6784 191
570 3300049570 Ga0501033_0098023 Ga0501033_0098023_832_1407 191
571 3300049572 Ga0501036_0005938 Ga0501036_0005938_1557_2132 191
572 3300049572 Ga0501036_0027654 Ga0501036_0027654_2658_3233 191
573 3300049572 Ga0501036_0102797 Ga0501036_0102797_55_630 191
574 3300049573 Ga0501037_0020944 Ga0501037_0020944_3108_3683 191
575 3300049573 Ga0501037_0037013 Ga0501037_0037013_1701_2276 191
576 3300049574 Ga0501038_0095359 Ga0501038_0095359_1096_1671 191
577 3300049575 Ga0501039_0074437 Ga0501039_0074437_528_1103 191
578 3300049575 Ga0501039_0110161 Ga0501039_0110161_375_950 191
579 3300049575 Ga0501039_0548076 Ga0501039_0548076_39_614 191
580 3300049576 Ga0501040_0010997 Ga0501040_0010997_4193_4768 191
581 3300049576 Ga0501040_0250104 Ga0501040_0250104_371_946 191
582 3300049576 Ga0501040_0279249 Ga0501040_0279249_524_1099 191
583 3300049577 Ga0501041_0137712 Ga0501041_0137712_388_963 191
584 3300049577 Ga0501041_0220817 Ga0501041_0220817_406_981 191
585 3300049578 Ga0501042_0074609 Ga0501042_0074609_733_1308 191
586 3300049578 Ga0501042_0769405 Ga0501042_0769405_53_628 191
587 3300049579 Ga0501043_0011528 Ga0501043_0011528_6131_6706 191
588 3300049579 Ga0501043_0759064 Ga0501043_0759064_57_632 191
589 3300049580 Ga0501046_0000837 Ga0501046_0000837_7873_8448 191
590 3300049580 Ga0501046_0005031 Ga0501046_0005031_7058_7633 191
591 3300049580 Ga0501046_0233695 Ga0501046_0233695_389_964 191
592 3300049581 Ga0501047_0398366 Ga0501047_0398366_30_605 191
593 3300049581 Ga0501047_0764834 Ga0501047_0764834_177_752 191
594 3300049582 Ga0501048_0025882 Ga0501048_0025882_1113_1688 191
595 3300049582 Ga0501048_0073647 Ga0501048_0073647_53_628 191
596 3300049582 Ga0501048_0546184 Ga0501048_0546184_68_643 191
597 3300049584 Ga0501068_0088105 Ga0501068_0088105_813_1388 191
598 3300049584 Ga0501068_0162697 Ga0501068_0162697_308_883 191
599 3300049584 Ga0501068_0325974 Ga0501068_0325974_41_616 191
600 3300049585 Ga0501069_0042144 Ga0501069_0042144_269_844 191
601 3300049585 Ga0501069_0096134 Ga0501069_0096134_1059_1643 191
602 3300049586 Ga0501070_0006214 Ga0501070_0006214_8491_9066 191
603 3300049586 Ga0501070_0006679 Ga0501070_0006679_8577_9152 191
604 3300049586 Ga0501070_0308986 Ga0501070_0308986_237_812 191
605 3300049586 Ga0501070_0566084 Ga0501070_0566084_280_855 191
606 3300049586 Ga0501070_0704071 Ga0501070_0704071_179_754 191
607 3300049586 Ga0501070_0981438 Ga0501070_0981438_53_628 191
608 3300049587 Ga0501071_0002975 Ga0501071_0002975_1003_1578 191
609 3300049588 Ga0501072_0083824 Ga0501072_0083824_827_1402 191
610 3300049589 Ga0501073_0104619 Ga0501073_0104619_1144_1719 191
611 3300049590 Ga0501074_0022682 Ga0501074_0022682_2871_3446 191
612 3300049590 Ga0501074_0124770 Ga0501074_0124770_178_753 191
613 3300049591 Ga0501075_0126956 Ga0501075_0126956_595_1170 191
614 3300049591 Ga0501075_0559867 Ga0501075_0559867_183_758 191
615 3300049592 Ga0501076_0011109 Ga0501076_0011109_1070_1645 191
616 3300049593 Ga0501077_0645909 Ga0501077_0645909_27_602 191
617 3300049741 Ga0501079_0124946 Ga0501079_0124946_1089_1664 191
618 3300049742 Ga0501080_0231368 Ga0501080_0231368_853_1428 191
619 3300049742 Ga0501080_0536291 Ga0501080_0536291_114_689 191
620 3300049743 Ga0501081_0252683 Ga0501081_0252683_341_916 191
621 3300049744 Ga0501083_0189244 Ga0501083_0189244_424_999 191
622 3300049822 Ga0501035_0583128 Ga0501035_0583128_294_869 191
623 3300049823 Ga0501044_0075942 Ga0501044_0075942_2154_2729 191
624 3300049823 Ga0501044_0196047 Ga0501044_0196047_1136_1711 191
625 3300049824 Ga0501045_0105210 Ga0501045_0105210_400_975 191
626 3300049824 Ga0501045_0158404 Ga0501045_0158404_633_1208 191
627 3300049824 Ga0501045_0537606 Ga0501045_0537606_81_656 191
628 3300050490 nmdc:mga03n38_12316_c1 nmdc:mga03n38_12316_c1_1967_2548 191
629 3300050491 nmdc:mga00v17_15065_c1 nmdc:mga00v17_15065_c1_1584_2165 191
630 3300050491 nmdc:mga00v17_164083_c1 nmdc:mga00v17_164083_c1_648_1223 191
631 3300050491 nmdc:mga00v17_97985_c1 nmdc:mga00v17_97985_c1_611_1195 191
632 3300050492 nmdc:mga0yw44_123912_c1 nmdc:mga0yw44_123912_c1_758_1333 191
633 3300050492 nmdc:mga0yw44_34567_c1 nmdc:mga0yw44_34567_c1_2198_2773 191
634 3300050492 nmdc:mga0yw44_473171_c1 nmdc:mga0yw44_473171_c1_193_777 191
635 3300050494 nmdc:mga06z11_27408_c1 nmdc:mga06z11_27408_c1_1516_2097 191
636 3300050496 nmdc:mga07m45_2428_c1 nmdc:mga07m45_2428_c1_814_1395 191
637 3300053083 Ga0495655_0101016 Ga0495655_0101016_264_839 191
638 3300053084 Ga0495595_0369619 Ga0495595_0369619_61_648 191
639 3300053088 Ga0500644_0000050 Ga0500644_0000050_46234_46809 191
640 3300053096 Ga0500641_0040656 Ga0500641_0040656_69_653 191
641 3300053104 Ga0500556_0000726 Ga0500556_0000726_11095_11691 191
642 3300053117 Ga0500593_000179 Ga0500593_000179_7276_7872 191
643 3300053139 Ga0500568_0233386 Ga0500568_0233386_50_646 191
644 3300053140 Ga0500573_0148649 Ga0500573_0148649_599_1174 191
645 3300054114 Ga0501084_0047926 Ga0501084_0047926_1126_1701 191
646 3300054114 Ga0501084_1090111 Ga0501084_1090111_44_619 191
647 3300060353 Ga0501082_0971994 Ga0501082_0971994_43_618 191
648 3300061719 Ga0466962_0008596 Ga0466962_0008596_277_852 191
649 3300061719 Ga0466962_0077845 Ga0466962_0077845_92_667 191
650 3300061734 Ga0530510_0159371 Ga0530510_0159371_382_957 191
651 3300061734 Ga0530510_0354933 Ga0530510_0354933_18_593 191
652 3300061734 Ga0530510_0798358 Ga0530510_0798358_94_669 191
653 iso_pu_bacteria 2643221615 2644091754 191
654 iso_pu_bacteria 2643221657 2644321557 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

38

222

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.9868 3 191
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.9658 3 191
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8874 1 191
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.8801 2 191
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8733 1 191
ID Description Score Start End Superfamily
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9868 3 191 3.40.50.850
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9658 3 191 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8875 1 191 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8733 1 191 3.40.50.850
3r2jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8723 2 191 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A536IXX4-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9951 98 190 GO:0016787
GO:0019363
GO:0046872
AF-K0EP89-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9924 2 190 GO:0016787
GO:0019363
GO:0046872
AF-A0A561SMJ7-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9905 3 191 GO:0016787
GO:0019363
GO:0046872
AF-A0A2U8U8I1-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9897 2 190 GO:0016787
GO:0019363
GO:0046872
AF-A0A6G9Y899-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9897 1 190 GO:0016787
GO:0019363
GO:0046872

Feature Viewer

pLDDT pTM Quality
97.79 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map