F472834
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 654 | 286 | 637 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10016952|Ga0075370_100169524 |
| Length | 222 |
| Sequence | MPGGLPDWHAHKPAGTNRRAQTAGFIAAADGDIVDRVRALIIVDMQNDFCEGGSLPVTGAAALAPAINEYLAGEPGYQHVVATKDYHIDPGDHFSDHPDFSSSWPVHCRAGSAGADFHPDLDTTPIEAIFRKGAYAAAYSGFEGVDEGGTPLLGWLRQRGVDEVDVVGVATDHCVRRTAEDAARAGFATRVLVDLVAGVAADSTEKALTEMRAAAIALVESS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 2 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 3 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 4 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 5 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 6 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 7 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 8 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 9 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 10 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 11 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 12 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 13 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 14 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 15 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 16 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 17 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 162 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 175 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 176 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 182 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 192 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 262 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 263 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 266 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 277 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 278 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 279 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 286 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.02 |
| Metatranscriptomes | 1.38 |
| Isolates | 2.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0 |
| Endosphere | 10.7 |
| Nodule | 0.15 |
| Rhizoplane | 8.41 |
| Rhizosphere | 76.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1003649 | 3300000549 | Bacteria | 2045 |
| 2 | JGI24737J22298_10027915 | 3300001990 | Bacteria | 1777 |
| 3 | JGI24735J21928_10053686 | 3300002067 | Bacteria | 1161 |
| 4 | Ga0058862_12892104 | 3300004803 | Bacteria | 1311 |
| 5 | Ga0070658_10009109 | 3300005327 | Bacteria | 7981 |
| 6 | Ga0070658_10059767 | 3300005327 | Bacteria | 3104 |
| 7 | Ga0070658_10062170 | 3300005327 | Bacteria | 3043 |
| 8 | Ga0070683_100001861 | 3300005329 | Bacteria | 16469 |
| 9 | Ga0070683_100037152 | 3300005329 | Bacteria | 4458 |
| 10 | Ga0070683_100053804 | 3300005329 | Bacteria | 3731 |
| 11 | Ga0070670_100647432 | 3300005331 | Bacteria | 948 |
| 12 | Ga0070680_100000200 | 3300005336 | Bacteria | 39048 |
| 13 | Ga0070680_100002368 | 3300005336 | Bacteria | 13929 |
| 14 | Ga0070680_100230621 | 3300005336 | Bacteria | 1564 |
| 15 | Ga0070682_100005518 | 3300005337 | Bacteria | 7041 |
| 16 | Ga0068868_100264029 | 3300005338 | Bacteria | 1453 |
| 17 | Ga0070660_100078056 | 3300005339 | Bacteria | 2596 |
| 18 | Ga0070689_100629193 | 3300005340 | Bacteria | 932 |
| 19 | Ga0070691_10346090 | 3300005341 | Bacteria | 824 |
| 20 | Ga0070661_100105226 | 3300005344 | Bacteria | 2103 |
| 21 | Ga0070692_10004188 | 3300005345 | Bacteria | 5981 |
| 22 | Ga0070674_100086493 | 3300005356 | Bacteria | 2252 |
| 23 | Ga0070674_100504136 | 3300005356 | Bacteria | 1008 |
| 24 | Ga0070674_100547089 | 3300005356 | Bacteria | 971 |
| 25 | Ga0070659_100862893 | 3300005366 | Bacteria | 790 |
| 26 | Ga0070659_101010824 | 3300005366 | Bacteria | 730 |
| 27 | Ga0070714_100013219 | 3300005435 | Bacteria | 6608 |
| 28 | Ga0070714_100030191 | 3300005435 | Bacteria | 4510 |
| 29 | Ga0070714_100061304 | 3300005435 | Bacteria | 3230 |
| 30 | Ga0070713_100147932 | 3300005436 | Bacteria | 2087 |
| 31 | Ga0070713_100572420 | 3300005436 | Bacteria | 1071 |
| 32 | Ga0070711_100962760 | 3300005439 | Bacteria | 731 |
| 33 | Ga0070663_100141707 | 3300005455 | Bacteria | 1836 |
| 34 | Ga0070678_100058612 | 3300005456 | Bacteria | 2827 |
| 35 | Ga0070678_100078733 | 3300005456 | Bacteria | 2491 |
| 36 | Ga0070681_10000052 | 3300005458 | Bacteria | 81490 |
| 37 | Ga0070681_10018251 | 3300005458 | Bacteria | 7011 |
| 38 | Ga0070681_10443581 | 3300005458 | Bacteria | 1210 |
| 39 | Ga0070685_10013113 | 3300005466 | Bacteria | 4364 |
| 40 | Ga0070706_100336483 | 3300005467 | Bacteria | 1407 |
| 41 | Ga0070707_100026218 | 3300005468 | Bacteria | 5533 |
| 42 | Ga0070707_100747715 | 3300005468 | Bacteria | 941 |
| 43 | Ga0070698_100036927 | 3300005471 | Bacteria | 5041 |
| 44 | Ga0070698_100046720 | 3300005471 | Bacteria | 4427 |
| 45 | Ga0070698_100099122 | 3300005471 | Bacteria | 2887 |
| 46 | Ga0070698_100523986 | 3300005471 | Bacteria | 1124 |
| 47 | Ga0070679_100000018 | 3300005530 | Bacteria | 127592 |
| 48 | Ga0070679_100002885 | 3300005530 | Bacteria | 15616 |
| 49 | Ga0070679_100005262 | 3300005530 | Bacteria | 11976 |
| 50 | Ga0070679_100236659 | 3300005530 | Bacteria | 1785 |
| 51 | Ga0070684_100006183 | 3300005535 | Bacteria | 9237 |
| 52 | Ga0070684_100241877 | 3300005535 | Bacteria | 1649 |
| 53 | Ga0070684_100323908 | 3300005535 | Bacteria | 1416 |
| 54 | Ga0070697_100079495 | 3300005536 | Bacteria | 2700 |
| 55 | Ga0068853_100058831 | 3300005539 | Bacteria | 3319 |
| 56 | Ga0068853_100549682 | 3300005539 | Bacteria | 1094 |
| 57 | Ga0070665_100001068 | 3300005548 | Bacteria | 34157 |
| 58 | Ga0070665_100037527 | 3300005548 | Bacteria | 4873 |
| 59 | Ga0070665_100042027 | 3300005548 | Bacteria | 4594 |
| 60 | Ga0068855_100029299 | 3300005563 | Bacteria | 6583 |
| 61 | Ga0068855_100104580 | 3300005563 | Bacteria | 3256 |
| 62 | Ga0068855_100256471 | 3300005563 | Bacteria | 1949 |
| 63 | Ga0070664_100122123 | 3300005564 | Bacteria | 2282 |
| 64 | Ga0068857_100121496 | 3300005577 | Bacteria | 2352 |
| 65 | Ga0068857_100958894 | 3300005577 | Bacteria | 822 |
| 66 | Ga0068854_100007951 | 3300005578 | Bacteria | 6791 |
| 67 | Ga0068856_100192569 | 3300005614 | Bacteria | 2053 |
| 68 | Ga0068852_100186888 | 3300005616 | Bacteria | 1952 |
| 69 | Ga0068852_100859276 | 3300005616 | Bacteria | 923 |
| 70 | Ga0068864_100170335 | 3300005618 | Bacteria | 1985 |
| 71 | Ga0068861_100614098 | 3300005719 | Bacteria | 1000 |
| 72 | Ga0068863_100474198 | 3300005841 | Bacteria | 1230 |
| 73 | Ga0068860_100160294 | 3300005843 | Bacteria | 2169 |
| 74 | Ga0081455_10001499 | 3300005937 | Bacteria | 28830 |
| 75 | Ga0081455_10003086 | 3300005937 | Bacteria | 19410 |
| 76 | Ga0081455_10034777 | 3300005937 | Bacteria | 4511 |
| 77 | Ga0070717_10519438 | 3300006028 | Bacteria | 1077 |
| 78 | Ga0075365_10025619 | 3300006038 | Bacteria | 3735 |
| 79 | Ga0075365_10044252 | 3300006038 | Bacteria | 2916 |
| 80 | Ga0075365_10093087 | 3300006038 | Bacteria | 2055 |
| 81 | Ga0075365_10205794 | 3300006038 | Bacteria | 1379 |
| 82 | Ga0075365_10269179 | 3300006038 | Bacteria | 1198 |
| 83 | Ga0075365_10329558 | 3300006038 | Bacteria | 1075 |
| 84 | Ga0075365_10462154 | 3300006038 | Bacteria | 896 |
| 85 | Ga0075365_10487753 | 3300006038 | Bacteria | 871 |
| 86 | Ga0075368_10035503 | 3300006042 | Bacteria | 1945 |
| 87 | Ga0075368_10054728 | 3300006042 | Bacteria | 1590 |
| 88 | Ga0075368_10151036 | 3300006042 | Bacteria | 970 |
| 89 | Ga0075363_100007205 | 3300006048 | Bacteria | 5098 |
| 90 | Ga0075363_100217299 | 3300006048 | Bacteria | 1095 |
| 91 | Ga0075363_100404336 | 3300006048 | Bacteria | 803 |
| 92 | Ga0075364_10000945 | 3300006051 | Bacteria | 15320 |
| 93 | Ga0075364_10002837 | 3300006051 | Bacteria | 9761 |
| 94 | Ga0075364_10147829 | 3300006051 | Bacteria | 1583 |
| 95 | Ga0075364_10725413 | 3300006051 | Bacteria | 678 |
| 96 | Ga0075432_10007942 | 3300006058 | Bacteria | 3617 |
| 97 | Ga0070712_100128683 | 3300006175 | Bacteria | 1916 |
| 98 | Ga0070712_100813714 | 3300006175 | Bacteria | 802 |
| 99 | Ga0075362_10024977 | 3300006177 | Bacteria | 2538 |
| 100 | Ga0075367_10036960 | 3300006178 | Bacteria | 2834 |
| 101 | Ga0075367_10075144 | 3300006178 | Bacteria | 2038 |
| 102 | Ga0075367_10248375 | 3300006178 | Bacteria | 1116 |
| 103 | Ga0075367_10434592 | 3300006178 | Bacteria | 831 |
| 104 | Ga0075367_10627551 | 3300006178 | Bacteria | 683 |
| 105 | Ga0075369_10065581 | 3300006186 | Bacteria | 1592 |
| 106 | Ga0075369_10079636 | 3300006186 | Bacteria | 1451 |
| 107 | Ga0075366_10018878 | 3300006195 | Bacteria | 3985 |
| 108 | Ga0075366_10035211 | 3300006195 | Bacteria | 2952 |
| 109 | Ga0075366_10171761 | 3300006195 | Bacteria | 1315 |
| 110 | Ga0075370_10016952 | 3300006353 | Bacteria | 3929 |
| 111 | Ga0075370_10195204 | 3300006353 | Bacteria | 1194 |
| 112 | Ga0075370_10273588 | 3300006353 | Bacteria | 1003 |
| 113 | Ga0068871_100135096 | 3300006358 | Bacteria | 2094 |
| 114 | Ga0075428_100179639 | 3300006844 | Bacteria | 2291 |
| 115 | Ga0075431_100011593 | 3300006847 | Bacteria | 8890 |
| 116 | Ga0075429_100008808 | 3300006880 | Bacteria | 8775 |
| 117 | Ga0099794_10297847 | 3300007265 | Bacteria | 835 |
| 118 | Ga0105240_10008364 | 3300009093 | Bacteria | 14807 |
| 119 | Ga0105240_10119011 | 3300009093 | Bacteria | 3183 |
| 120 | Ga0111539_11236149 | 3300009094 | Bacteria | 867 |
| 121 | Ga0111539_11316096 | 3300009094 | Bacteria | 838 |
| 122 | Ga0105245_10009576 | 3300009098 | Bacteria | 8451 |
| 123 | Ga0105245_10591887 | 3300009098 | Bacteria | 1135 |
| 124 | Ga0105243_10026469 | 3300009148 | Bacteria | 4439 |
| 125 | Ga0105243_10152214 | 3300009148 | Bacteria | 1985 |
| 126 | Ga0105241_10011187 | 3300009174 | Bacteria | 6581 |
| 127 | Ga0105242_10126874 | 3300009176 | Bacteria | 2197 |
| 128 | Ga0105242_10194703 | 3300009176 | Bacteria | 1797 |
| 129 | Ga0105248_10138883 | 3300009177 | Bacteria | 2741 |
| 130 | Ga0105237_10013245 | 3300009545 | Bacteria | 8653 |
| 131 | Ga0105237_11253721 | 3300009545 | Bacteria | 748 |
| 132 | Ga0105238_10007039 | 3300009551 | Bacteria | 11246 |
| 133 | Ga0105239_10003376 | 3300010375 | Bacteria | 19591 |
| 134 | Ga0105239_10104410 | 3300010375 | Bacteria | 3137 |
| 135 | Ga0105239_10454204 | 3300010375 | Bacteria | 1454 |
| 136 | Ga0105246_10002553 | 3300011119 | Bacteria | 11006 |
| 137 | Ga0105246_10100493 | 3300011119 | Bacteria | 2105 |
| 138 | Ga0157369_10024307 | 3300013105 | Bacteria | 6743 |
| 139 | Ga0157369_10814820 | 3300013105 | Bacteria | 959 |
| 140 | Ga0157369_10928979 | 3300013105 | Bacteria | 892 |
| 141 | Ga0157374_10179208 | 3300013296 | Bacteria | 2069 |
| 142 | Ga0163162_10004012 | 3300013306 | Bacteria | 14126 |
| 143 | Ga0157372_10003758 | 3300013307 | Bacteria | 16307 |
| 144 | Ga0157372_10406357 | 3300013307 | Bacteria | 1587 |
| 145 | Ga0157375_10034952 | 3300013308 | Bacteria | 4792 |
| 146 | Ga0157375_10286940 | 3300013308 | Bacteria | 1809 |
| 147 | Ga0157375_10941208 | 3300013308 | Bacteria | 1006 |
| 148 | Ga0163163_10033431 | 3300014325 | Bacteria | 4974 |
| 149 | Ga0163163_10082838 | 3300014325 | Bacteria | 3212 |
| 150 | Ga0163163_11732226 | 3300014325 | Bacteria | 685 |
| 151 | Ga0157380_10618189 | 3300014326 | Bacteria | 1075 |
| 152 | Ga0157380_11269706 | 3300014326 | Bacteria | 783 |
| 153 | Ga0157377_10095550 | 3300014745 | Bacteria | 1762 |
| 154 | Ga0157379_10059305 | 3300014968 | Bacteria | 3422 |
| 155 | Ga0157376_10269346 | 3300014969 | Bacteria | 1599 |
| 156 | Ga0157376_10310812 | 3300014969 | Bacteria | 1495 |
| 157 | Ga0157376_10506782 | 3300014969 | Bacteria | 1187 |
| 158 | Ga0157376_10670324 | 3300014969 | Bacteria | 1039 |
| 159 | Ga0163161_10021053 | 3300017792 | Bacteria | 4583 |
| 160 | Ga0163161_10022665 | 3300017792 | Bacteria | 4423 |
| 161 | Ga0197907_10836942 | 3300020069 | Bacteria | 3320 |
| 162 | Ga0206356_11719020 | 3300020070 | Bacteria | 1179 |
| 163 | Ga0206354_10736619 | 3300020081 | Bacteria | 1568 |
| 164 | Ga0206353_10232671 | 3300020082 | Bacteria | 1809 |
| 165 | Ga0206353_11128717 | 3300020082 | Bacteria | 1294 |
| 166 | Ga0213872_10080390 | 3300021361 | Bacteria | 1465 |
| 167 | Ga0213875_10000249 | 3300021388 | Bacteria | 54258 |
| 168 | Ga0224712_10008704 | 3300022467 | Bacteria | 3023 |
| 169 | Ga0224712_10029128 | 3300022467 | Bacteria | 1980 |
| 170 | Ga0224712_10259083 | 3300022467 | Bacteria | 805 |
| 171 | Ga0207688_10034915 | 3300025901 | Bacteria | 2785 |
| 172 | Ga0207647_10006988 | 3300025904 | Bacteria | 8183 |
| 173 | Ga0207647_10027106 | 3300025904 | Bacteria | 3739 |
| 174 | Ga0207647_10028751 | 3300025904 | Bacteria | 3607 |
| 175 | Ga0207645_10614592 | 3300025907 | Bacteria | 738 |
| 176 | Ga0207705_10038710 | 3300025909 | Bacteria | 3415 |
| 177 | Ga0207705_10051832 | 3300025909 | Bacteria | 2953 |
| 178 | Ga0207705_10119983 | 3300025909 | Bacteria | 1950 |
| 179 | Ga0207684_10729692 | 3300025910 | Bacteria | 841 |
| 180 | Ga0207684_10889354 | 3300025910 | Bacteria | 749 |
| 181 | Ga0207654_10100280 | 3300025911 | Bacteria | 1783 |
| 182 | Ga0207707_10000384 | 3300025912 | Bacteria | 46040 |
| 183 | Ga0207707_10001025 | 3300025912 | Bacteria | 26798 |
| 184 | Ga0207707_10316286 | 3300025912 | Bacteria | 1348 |
| 185 | Ga0207695_10015897 | 3300025913 | Bacteria | 8839 |
| 186 | Ga0207695_10045796 | 3300025913 | Bacteria | 4641 |
| 187 | Ga0207671_10001468 | 3300025914 | Bacteria | 27232 |
| 188 | Ga0207660_10000175 | 3300025917 | Bacteria | 41005 |
| 189 | Ga0207660_10005894 | 3300025917 | Bacteria | 7960 |
| 190 | Ga0207660_10148228 | 3300025917 | Bacteria | 1800 |
| 191 | Ga0207657_10066054 | 3300025919 | Bacteria | 3081 |
| 192 | Ga0207657_10083761 | 3300025919 | Bacteria | 2675 |
| 193 | Ga0207657_10340038 | 3300025919 | Bacteria | 1185 |
| 194 | Ga0207657_10380923 | 3300025919 | Bacteria | 1111 |
| 195 | Ga0207649_10312773 | 3300025920 | Bacteria | 1152 |
| 196 | Ga0207652_10000293 | 3300025921 | Bacteria | 51659 |
| 197 | Ga0207652_10007355 | 3300025921 | Bacteria | 8878 |
| 198 | Ga0207652_10017591 | 3300025921 | Bacteria | 5852 |
| 199 | Ga0207652_10409740 | 3300025921 | Bacteria | 1223 |
| 200 | Ga0207652_11187171 | 3300025921 | Bacteria | 665 |
| 201 | Ga0207646_10067790 | 3300025922 | Bacteria | 3186 |
| 202 | Ga0207646_10207338 | 3300025922 | Bacteria | 1770 |
| 203 | Ga0207694_10003092 | 3300025924 | Bacteria | 13319 |
| 204 | Ga0207659_10176548 | 3300025926 | Bacteria | 1689 |
| 205 | Ga0207659_10604726 | 3300025926 | Bacteria | 935 |
| 206 | Ga0207687_10019001 | 3300025927 | Bacteria | 4547 |
| 207 | Ga0207687_10023514 | 3300025927 | Bacteria | 4109 |
| 208 | Ga0207700_10147952 | 3300025928 | Bacteria | 1938 |
| 209 | Ga0207700_10902657 | 3300025928 | Bacteria | 791 |
| 210 | Ga0207664_10009318 | 3300025929 | Bacteria | 6884 |
| 211 | Ga0207664_10246516 | 3300025929 | Bacteria | 1557 |
| 212 | Ga0207706_10352982 | 3300025933 | Bacteria | 1278 |
| 213 | Ga0207706_11022053 | 3300025933 | Bacteria | 694 |
| 214 | Ga0207709_10216266 | 3300025935 | Bacteria | 1379 |
| 215 | Ga0207709_10268818 | 3300025935 | Bacteria | 1254 |
| 216 | Ga0207709_10526120 | 3300025935 | Bacteria | 926 |
| 217 | Ga0207669_10258388 | 3300025937 | Bacteria | 1301 |
| 218 | Ga0207669_10543825 | 3300025937 | Bacteria | 936 |
| 219 | Ga0207691_10553797 | 3300025940 | Bacteria | 975 |
| 220 | Ga0207711_10210578 | 3300025941 | Bacteria | 1776 |
| 221 | Ga0207711_11156492 | 3300025941 | Bacteria | 715 |
| 222 | Ga0207689_10040149 | 3300025942 | Bacteria | 3874 |
| 223 | Ga0207661_10006769 | 3300025944 | Bacteria | 8116 |
| 224 | Ga0207661_10025263 | 3300025944 | Bacteria | 4513 |
| 225 | Ga0207661_10073705 | 3300025944 | Bacteria | 2797 |
| 226 | Ga0207679_10015073 | 3300025945 | Bacteria | 5097 |
| 227 | Ga0207667_10019039 | 3300025949 | Bacteria | 7674 |
| 228 | Ga0207667_10389235 | 3300025949 | Bacteria | 1420 |
| 229 | Ga0207667_10395376 | 3300025949 | Bacteria | 1407 |
| 230 | Ga0207640_10403778 | 3300025981 | Bacteria | 1113 |
| 231 | Ga0207640_10445651 | 3300025981 | Bacteria | 1066 |
| 232 | Ga0207677_10106279 | 3300026023 | Bacteria | 2079 |
| 233 | Ga0207639_10169153 | 3300026041 | Bacteria | 1849 |
| 234 | Ga0207639_10397499 | 3300026041 | Bacteria | 1241 |
| 235 | Ga0207678_10080490 | 3300026067 | Bacteria | 2789 |
| 236 | Ga0207678_10434158 | 3300026067 | Bacteria | 1140 |
| 237 | Ga0207708_10301567 | 3300026075 | Bacteria | 1303 |
| 238 | Ga0207702_10050948 | 3300026078 | Bacteria | 3497 |
| 239 | Ga0207702_10732939 | 3300026078 | Bacteria | 975 |
| 240 | Ga0207641_10745002 | 3300026088 | Bacteria | 967 |
| 241 | Ga0207648_10811747 | 3300026089 | Bacteria | 871 |
| 242 | Ga0207676_10150381 | 3300026095 | Bacteria | 2004 |
| 243 | Ga0207674_10034172 | 3300026116 | Bacteria | 5318 |
| 244 | Ga0207674_10665394 | 3300026116 | Bacteria | 1006 |
| 245 | Ga0207683_10021147 | 3300026121 | Bacteria | 5568 |
| 246 | Ga0207683_10255276 | 3300026121 | Bacteria | 1600 |
| 247 | Ga0207698_10521080 | 3300026142 | Bacteria | 1160 |
| 248 | Ga0207698_11109974 | 3300026142 | Bacteria | 804 |
| 249 | Ga0207428_10001546 | 3300027907 | Bacteria | 24048 |
| 250 | Ga0207428_10316640 | 3300027907 | Bacteria | 1153 |
| 251 | Ga0268266_10003912 | 3300028379 | Bacteria | 14476 |
| 252 | Ga0268266_10068655 | 3300028379 | Bacteria | 3070 |
| 253 | Ga0268266_10073140 | 3300028379 | Bacteria | 2974 |
| 254 | Ga0268266_10508426 | 3300028379 | Bacteria | 1151 |
| 255 | Ga0268264_10031083 | 3300028381 | Bacteria | 4378 |
| 256 | Ga0268264_10135921 | 3300028381 | Bacteria | 2186 |
| 257 | Ga0307515_10053283 | 3300028794 | Bacteria | 5974 |
| 258 | Ga0265331_10089390 | 3300031250 | Bacteria | 1425 |
| 259 | Ga0316579_10006137 | 3300031691 | Bacteria | 4883 |
| 260 | Ga0307413_10914423 | 3300031824 | Bacteria | 746 |
| 261 | Ga0307518_10100533 | 3300031838 | Bacteria | 2070 |
| 262 | Ga0307410_10904420 | 3300031852 | Bacteria | 756 |
| 263 | Ga0307406_10238420 | 3300031901 | Bacteria | 1363 |
| 264 | Ga0307406_10907534 | 3300031901 | Bacteria | 750 |
| 265 | Ga0307412_10997002 | 3300031911 | Bacteria | 740 |
| 266 | Ga0307409_100348203 | 3300031995 | Bacteria | 1397 |
| 267 | Ga0307416_100084232 | 3300032002 | Bacteria | 2701 |
| 268 | Ga0307416_100601896 | 3300032002 | Bacteria | 1179 |
| 269 | Ga0307416_101802163 | 3300032002 | Bacteria | 716 |
| 270 | Ga0307414_10403703 | 3300032004 | Bacteria | 1188 |
| 271 | Ga0307415_100395730 | 3300032126 | Bacteria | 1178 |
| 272 | Ga0316583_10135817 | 3300032133 | Bacteria | 857 |
| 273 | Ga0307507_10000013 | 3300033179 | Bacteria | 242708 |
| 274 | Ga0307507_10031342 | 3300033179 | Bacteria | 5584 |
| 275 | Ga0307507_10174856 | 3300033179 | Bacteria | 1550 |
| 276 | Ga0373936_0191580 | 3300035113 | Bacteria | 900 |
| 277 | Ga0373960_0063198 | 3300035121 | Bacteria | 1128 |
| 278 | Ga0373937_0040759 | 3300036401 | Bacteria | 4234 |
| 279 | Ga0373925_0357446 | 3300037068 | Bacteria | 1187 |
| 280 | Ga0395899_0012741 | 3300037312 | Bacteria | 6442 |
| 281 | Ga0395899_0200820 | 3300037312 | Bacteria | 1390 |
| 282 | Ga0395900_0007584 | 3300037418 | Bacteria | 11205 |
| 283 | Ga0395900_0019991 | 3300037418 | Bacteria | 6827 |
| 284 | Ga0395898_0007168 | 3300037466 | Bacteria | 11838 |
| 285 | Ga0395901_0013836 | 3300038443 | Bacteria | 8207 |
| 286 | Ga0395901_0016154 | 3300038443 | Bacteria | 7603 |
| 287 | Ga0395901_0607055 | 3300038443 | Bacteria | 1103 |
| 288 | Ga0436365_1263051 | 3300039437 | Bacteria | 818 |
| 289 | Ga0436365_1768712 | 3300039437 | Bacteria | 1593 |
| 290 | Ga0436360_1006231 | 3300039438 | Bacteria | 3199 |
| 291 | Ga0436361_1181514 | 3300039447 | Bacteria | 1637 |
| 292 | Ga0439438_022198 | 3300041405 | Bacteria | 1763 |
| 293 | Ga0439447_017678 | 3300041407 | Bacteria | 1939 |
| 294 | Ga0451797_0236862 | 3300041453 | Bacteria | 749 |
| 295 | Ga0451849_1028718 | 3300041505 | Bacteria | 820 |
| 296 | Ga0451853_2720754 | 3300041512 | Bacteria | 1753 |
| 297 | Ga0439448_0082929 | 3300042005 | Bacteria | 1078 |
| 298 | Ga0439458_0076277 | 3300042157 | Bacteria | 851 |
| 299 | Ga0439434_0003237 | 3300042435 | Bacteria | 4781 |
| 300 | Ga0439464_0011028 | 3300042439 | Bacteria | 2390 |
| 301 | Ga0466969_0010413 | 3300044656 | Bacteria | 4929 |
| 302 | Ga0466969_0013126 | 3300044656 | Bacteria | 4364 |
| 303 | Ga0466969_0138386 | 3300044656 | Bacteria | 1126 |
| 304 | Ga0466972_0187581 | 3300044658 | Bacteria | 969 |
| 305 | Ga0466972_0256819 | 3300044658 | Bacteria | 817 |
| 306 | Ga0466972_0416015 | 3300044658 | Bacteria | 630 |
| 307 | Ga0466965_0039562 | 3300044683 | Bacteria | 2318 |
| 308 | Ga0466965_0054818 | 3300044683 | Bacteria | 1983 |
| 309 | Ga0466965_0102466 | 3300044683 | Bacteria | 1465 |
| 310 | Ga0466965_0144996 | 3300044683 | Bacteria | 1238 |
| 311 | Ga0466965_0191333 | 3300044683 | Bacteria | 1082 |
| 312 | Ga0466965_0256842 | 3300044683 | Bacteria | 938 |
| 313 | Ga0466966_0047198 | 3300044684 | Bacteria | 2747 |
| 314 | Ga0466966_0064110 | 3300044684 | Bacteria | 2314 |
| 315 | Ga0466966_0252671 | 3300044684 | Bacteria | 1062 |
| 316 | Ga0466961_0005509 | 3300044693 | Bacteria | 7985 |
| 317 | Ga0466961_0013942 | 3300044693 | Bacteria | 5151 |
| 318 | Ga0466961_0039362 | 3300044693 | Bacteria | 3031 |
| 319 | Ga0466961_0140241 | 3300044693 | Bacteria | 1513 |
| 320 | Ga0466961_0327656 | 3300044693 | Bacteria | 933 |
| 321 | Ga0466961_0429699 | 3300044693 | Bacteria | 800 |
| 322 | Ga0466961_0498613 | 3300044693 | Bacteria | 735 |
| 323 | Ga0466963_0079207 | 3300044694 | Bacteria | 2223 |
| 324 | Ga0466963_0084625 | 3300044694 | Bacteria | 2152 |
| 325 | Ga0466963_0119599 | 3300044694 | Bacteria | 1812 |
| 326 | Ga0466963_0202338 | 3300044694 | Bacteria | 1389 |
| 327 | Ga0466963_0307899 | 3300044694 | Bacteria | 1114 |
| 328 | Ga0466963_0368125 | 3300044694 | Bacteria | 1012 |
| 329 | Ga0466963_0390639 | 3300044694 | Bacteria | 981 |
| 330 | Ga0466963_0436183 | 3300044694 | Bacteria | 924 |
| 331 | Ga0466963_0584664 | 3300044694 | Bacteria | 789 |
| 332 | Ga0466963_0659194 | 3300044694 | Bacteria | 739 |
| 333 | Ga0466964_0017258 | 3300044706 | Bacteria | 2762 |
| 334 | Ga0466964_0022138 | 3300044706 | Bacteria | 2463 |
| 335 | Ga0466964_0028561 | 3300044706 | Bacteria | 2198 |
| 336 | Ga0466971_0016915 | 3300044719 | Bacteria | 3223 |
| 337 | Ga0466971_0027398 | 3300044719 | Bacteria | 2552 |
| 338 | Ga0466971_0032472 | 3300044719 | Bacteria | 2339 |
| 339 | Ga0466971_0039677 | 3300044719 | Bacteria | 2113 |
| 340 | Ga0466971_0048629 | 3300044719 | Bacteria | 1907 |
| 341 | Ga0466971_0261482 | 3300044719 | Bacteria | 826 |
| 342 | Ga0466968_0004609 | 3300044735 | Bacteria | 5157 |
| 343 | Ga0466968_0204270 | 3300044735 | Bacteria | 926 |
| 344 | Ga0466970_0000598 | 3300044765 | Bacteria | 17674 |
| 345 | Ga0466970_0057386 | 3300044765 | Bacteria | 2082 |
| 346 | Ga0466970_0067637 | 3300044765 | Bacteria | 1918 |
| 347 | Ga0466970_0067946 | 3300044765 | Bacteria | 1914 |
| 348 | Ga0466970_0080344 | 3300044765 | Bacteria | 1762 |
| 349 | Ga0466970_0082680 | 3300044765 | Bacteria | 1737 |
| 350 | Ga0466970_0096141 | 3300044765 | Bacteria | 1611 |
| 351 | Ga0466970_0103656 | 3300044765 | Bacteria | 1550 |
| 352 | Ga0466970_0105721 | 3300044765 | Bacteria | 1535 |
| 353 | Ga0466970_0109523 | 3300044765 | Bacteria | 1508 |
| 354 | Ga0466970_0109873 | 3300044765 | Bacteria | 1505 |
| 355 | Ga0466970_0118129 | 3300044765 | Bacteria | 1451 |
| 356 | Ga0466970_0422935 | 3300044765 | Bacteria | 762 |
| 357 | Ga0466970_0482175 | 3300044765 | Bacteria | 713 |
| 358 | Ga0466957_0004995 | 3300044842 | Bacteria | 7421 |
| 359 | Ga0466957_0010934 | 3300044842 | Bacteria | 5220 |
| 360 | Ga0466957_0094486 | 3300044842 | Bacteria | 1877 |
| 361 | Ga0466957_0108701 | 3300044842 | Bacteria | 1756 |
| 362 | Ga0466957_0112490 | 3300044842 | Bacteria | 1728 |
| 363 | Ga0466957_0199758 | 3300044842 | Bacteria | 1313 |
| 364 | Ga0466957_0246455 | 3300044842 | Bacteria | 1187 |
| 365 | Ga0466957_0451582 | 3300044842 | Bacteria | 886 |
| 366 | Ga0466957_0657757 | 3300044842 | Bacteria | 737 |
| 367 | Ga0466960_0011351 | 3300044901 | Bacteria | 3724 |
| 368 | Ga0466960_0047673 | 3300044901 | Bacteria | 2056 |
| 369 | Ga0466960_0059583 | 3300044901 | Bacteria | 1868 |
| 370 | Ga0466960_0099625 | 3300044901 | Bacteria | 1494 |
| 371 | Ga0466960_0185414 | 3300044901 | Bacteria | 1130 |
| 372 | Ga0466960_0286082 | 3300044901 | Bacteria | 925 |
| 373 | Ga0466960_0315249 | 3300044901 | Bacteria | 884 |
| 374 | Ga0466959_0003111 | 3300045049 | Bacteria | 10760 |
| 375 | Ga0466959_0081157 | 3300045049 | Bacteria | 2337 |
| 376 | Ga0466959_0155969 | 3300045049 | Bacteria | 1607 |
| 377 | Ga0466959_0187167 | 3300045049 | Bacteria | 1446 |
| 378 | Ga0466959_0308486 | 3300045049 | Bacteria | 1083 |
| 379 | Ga0466959_0457487 | 3300045049 | Bacteria | 865 |
| 380 | Ga0466959_0592106 | 3300045049 | Bacteria | 746 |
| 381 | Ga0466958_0001868 | 3300045836 | Bacteria | 10287 |
| 382 | Ga0466958_0036794 | 3300045836 | Bacteria | 2931 |
| 383 | Ga0466958_0267605 | 3300045836 | Bacteria | 1094 |
| 384 | Ga0466958_0287148 | 3300045836 | Bacteria | 1055 |
| 385 | Ga0466958_0427933 | 3300045836 | Bacteria | 856 |
| 386 | Ga0466967_0018913 | 3300045976 | Bacteria | 5524 |
| 387 | Ga0466967_0036682 | 3300045976 | Bacteria | 4188 |
| 388 | Ga0466967_0073143 | 3300045976 | Bacteria | 3074 |
| 389 | Ga0466967_0152275 | 3300045976 | Bacteria | 2163 |
| 390 | Ga0466967_0286121 | 3300045976 | Bacteria | 1582 |
| 391 | Ga0466967_1018091 | 3300045976 | Bacteria | 825 |
| 392 | Ga0466967_1487215 | 3300045976 | Bacteria | 675 |
| 393 | Ga0495592_0017836 | 3300046454 | Bacteria | 5396 |
| 394 | Ga0495629_0292340 | 3300046459 | Bacteria | 1117 |
| 395 | Ga0495641_0023474 | 3300046461 | Bacteria | 3063 |
| 396 | Ga0495651_0008132 | 3300046462 | Bacteria | 8044 |
| 397 | Ga0495651_0101951 | 3300046462 | Bacteria | 2135 |
| 398 | Ga0495651_0129807 | 3300046462 | Bacteria | 1841 |
| 399 | Ga0495608_0129463 | 3300046511 | Bacteria | 1616 |
| 400 | Ga0495628_0026610 | 3300046516 | Bacteria | 4713 |
| 401 | Ga0495652_0000288 | 3300046529 | Bacteria | 59726 |
| 402 | Ga0495652_0706550 | 3300046529 | Bacteria | 678 |
| 403 | Ga0495645_0015629 | 3300046543 | Bacteria | 5400 |
| 404 | Ga0495645_0039408 | 3300046543 | Bacteria | 3446 |
| 405 | Ga0495657_0236767 | 3300046675 | Bacteria | 1103 |
| 406 | Ga0495623_0360343 | 3300046679 | Bacteria | 790 |
| 407 | Ga0495600_0010059 | 3300046809 | Bacteria | 5863 |
| 408 | Ga0495600_0542599 | 3300046809 | Bacteria | 711 |
| 409 | Ga0495581_0026637 | 3300047315 | Bacteria | 3352 |
| 410 | Ga0495604_0023186 | 3300047317 | Bacteria | 4954 |
| 411 | Ga0495680_0397094 | 3300047322 | Bacteria | 953 |
| 412 | Ga0496100_0096006 | 3300048903 | Bacteria | 2033 |
| 413 | Ga0496100_0104528 | 3300048903 | Bacteria | 1957 |
| 414 | Ga0496100_0437049 | 3300048903 | Bacteria | 1001 |
| 415 | Ga0496101_0009555 | 3300048904 | Bacteria | 6377 |
| 416 | Ga0496101_0017044 | 3300048904 | Bacteria | 4919 |
| 417 | Ga0496101_0135975 | 3300048904 | Bacteria | 1870 |
| 418 | Ga0496101_0166374 | 3300048904 | Bacteria | 1693 |
| 419 | Ga0496102_0010713 | 3300048905 | Bacteria | 7899 |
| 420 | Ga0496102_0010935 | 3300048905 | Bacteria | 7817 |
| 421 | Ga0496102_0013615 | 3300048905 | Bacteria | 7050 |
| 422 | Ga0496102_0112516 | 3300048905 | Bacteria | 2539 |
| 423 | Ga0496102_0436896 | 3300048905 | Bacteria | 1228 |
| 424 | Ga0496102_0536950 | 3300048905 | Bacteria | 1092 |
| 425 | Ga0496102_0962233 | 3300048905 | Bacteria | 775 |
| 426 | Ga0496103_0014931 | 3300048906 | Bacteria | 4617 |
| 427 | Ga0496103_0016740 | 3300048906 | Bacteria | 4379 |
| 428 | Ga0496103_0256365 | 3300048906 | Bacteria | 1126 |
| 429 | Ga0496104_0006653 | 3300048907 | Bacteria | 10172 |
| 430 | Ga0496104_0112805 | 3300048907 | Bacteria | 2607 |
| 431 | Ga0496105_0039705 | 3300048908 | Bacteria | 3880 |
| 432 | Ga0496105_0065910 | 3300048908 | Bacteria | 2989 |
| 433 | Ga0496105_0080110 | 3300048908 | Bacteria | 2697 |
| 434 | Ga0496105_0785957 | 3300048908 | Bacteria | 725 |
| 435 | Ga0496106_0075174 | 3300048909 | Bacteria | 2587 |
| 436 | Ga0496106_0227992 | 3300048909 | Bacteria | 1487 |
| 437 | Ga0496107_0081685 | 3300048910 | Bacteria | 2357 |
| 438 | Ga0496108_0038651 | 3300048911 | Bacteria | 3976 |
| 439 | Ga0496108_0084979 | 3300048911 | Bacteria | 2686 |
| 440 | Ga0496108_0137794 | 3300048911 | Bacteria | 2101 |
| 441 | Ga0496108_0279555 | 3300048911 | Bacteria | 1453 |
| 442 | Ga0496109_0014537 | 3300048912 | Bacteria | 6847 |
| 443 | Ga0496109_0026023 | 3300048912 | Bacteria | 5215 |
| 444 | Ga0496109_0047889 | 3300048912 | Bacteria | 3888 |
| 445 | Ga0496109_0079079 | 3300048912 | Bacteria | 3029 |
| 446 | Ga0496109_0455677 | 3300048912 | Bacteria | 1208 |
| 447 | Ga0496109_0494959 | 3300048912 | Bacteria | 1154 |
| 448 | Ga0496110_0002615 | 3300048913 | Bacteria | 13555 |
| 449 | Ga0496110_0142741 | 3300048913 | Bacteria | 2165 |
| 450 | Ga0496110_0823482 | 3300048913 | Bacteria | 833 |
| 451 | Ga0496111_0132118 | 3300048914 | Bacteria | 1848 |
| 452 | Ga0496111_0155293 | 3300048914 | Bacteria | 1698 |
| 453 | Ga0496111_0782721 | 3300048914 | Bacteria | 691 |
| 454 | Ga0496112_0137544 | 3300048915 | Bacteria | 2413 |
| 455 | Ga0496112_0199841 | 3300048915 | Bacteria | 1959 |
| 456 | Ga0496113_0391331 | 3300048916 | Bacteria | 1116 |
| 457 | Ga0496113_0656831 | 3300048916 | Bacteria | 838 |
| 458 | Ga0496114_0006631 | 3300048917 | Bacteria | 9122 |
| 459 | Ga0496114_0010389 | 3300048917 | Bacteria | 7408 |
| 460 | Ga0496114_0011584 | 3300048917 | Bacteria | 7048 |
| 461 | Ga0496114_0079688 | 3300048917 | Bacteria | 2765 |
| 462 | Ga0496114_1042899 | 3300048917 | Bacteria | 701 |
| 463 | Ga0496115_0183269 | 3300048918 | Bacteria | 1730 |
| 464 | Ga0496115_0420337 | 3300048918 | Bacteria | 1083 |
| 465 | Ga0496115_0733321 | 3300048918 | Bacteria | 774 |
| 466 | Ga0501031_0008197 | 3300049568 | Bacteria | 6800 |
| 467 | Ga0501031_0053932 | 3300049568 | Bacteria | 2620 |
| 468 | Ga0501031_0063395 | 3300049568 | Bacteria | 2408 |
| 469 | Ga0501031_0227359 | 3300049568 | Bacteria | 1214 |
| 470 | Ga0501031_0519253 | 3300049568 | Bacteria | 768 |
| 471 | Ga0501032_0017653 | 3300049569 | Bacteria | 5008 |
| 472 | Ga0501032_0033128 | 3300049569 | Bacteria | 3542 |
| 473 | Ga0501032_0092388 | 3300049569 | Bacteria | 2008 |
| 474 | Ga0501033_0004737 | 3300049570 | Bacteria | 10884 |
| 475 | Ga0501033_0011833 | 3300049570 | Bacteria | 6670 |
| 476 | Ga0501033_0098023 | 3300049570 | Bacteria | 2141 |
| 477 | Ga0501034_0001484 | 3300049571 | Bacteria | 30939 |
| 478 | Ga0501034_0002497 | 3300049571 | Bacteria | 22075 |
| 479 | Ga0501034_0018284 | 3300049571 | Bacteria | 7189 |
| 480 | Ga0501034_0089958 | 3300049571 | Bacteria | 3068 |
| 481 | Ga0501034_0163516 | 3300049571 | Bacteria | 2195 |
| 482 | Ga0501036_0005938 | 3300049572 | Bacteria | 9891 |
| 483 | Ga0501036_0027654 | 3300049572 | Bacteria | 4793 |
| 484 | Ga0501036_0102797 | 3300049572 | Bacteria | 2417 |
| 485 | Ga0501036_0256932 | 3300049572 | Bacteria | 1464 |
| 486 | Ga0501036_0652248 | 3300049572 | Bacteria | 871 |
| 487 | Ga0501037_0020944 | 3300049573 | Bacteria | 4830 |
| 488 | Ga0501037_0037013 | 3300049573 | Bacteria | 3596 |
| 489 | Ga0501037_0171522 | 3300049573 | Bacteria | 1542 |
| 490 | Ga0501038_0095359 | 3300049574 | Bacteria | 2485 |
| 491 | Ga0501039_0074437 | 3300049575 | Bacteria | 2639 |
| 492 | Ga0501039_0110161 | 3300049575 | Bacteria | 2152 |
| 493 | Ga0501039_0110793 | 3300049575 | Bacteria | 2146 |
| 494 | Ga0501039_0361085 | 3300049575 | Bacteria | 1141 |
| 495 | Ga0501039_0548076 | 3300049575 | Bacteria | 907 |
| 496 | Ga0501040_0010997 | 3300049576 | Bacteria | 5918 |
| 497 | Ga0501040_0250104 | 3300049576 | Bacteria | 1264 |
| 498 | Ga0501040_0279249 | 3300049576 | Bacteria | 1193 |
| 499 | Ga0501041_0137712 | 3300049577 | Bacteria | 1521 |
| 500 | Ga0501041_0220817 | 3300049577 | Bacteria | 1189 |
| 501 | Ga0501042_0074609 | 3300049578 | Bacteria | 2427 |
| 502 | Ga0501042_0769405 | 3300049578 | Bacteria | 700 |
| 503 | Ga0501043_0011528 | 3300049579 | Bacteria | 6920 |
| 504 | Ga0501043_0105585 | 3300049579 | Bacteria | 2213 |
| 505 | Ga0501043_0136560 | 3300049579 | Bacteria | 1921 |
| 506 | Ga0501043_0759064 | 3300049579 | Bacteria | 704 |
| 507 | Ga0501046_0000837 | 3300049580 | Bacteria | 29974 |
| 508 | Ga0501046_0005031 | 3300049580 | Bacteria | 11866 |
| 509 | Ga0501046_0233695 | 3300049580 | Bacteria | 1357 |
| 510 | Ga0501047_0023163 | 3300049581 | Bacteria | 5962 |
| 511 | Ga0501047_0398366 | 3300049581 | Bacteria | 1209 |
| 512 | Ga0501047_0473909 | 3300049581 | Bacteria | 1080 |
| 513 | Ga0501047_0764834 | 3300049581 | Bacteria | 781 |
| 514 | Ga0501048_0025882 | 3300049582 | Bacteria | 4274 |
| 515 | Ga0501048_0073647 | 3300049582 | Bacteria | 2410 |
| 516 | Ga0501048_0546184 | 3300049582 | Bacteria | 831 |
| 517 | Ga0501067_0001937 | 3300049583 | Bacteria | 11390 |
| 518 | Ga0501067_0004724 | 3300049583 | Bacteria | 7539 |
| 519 | Ga0501068_0004892 | 3300049584 | Bacteria | 7297 |
| 520 | Ga0501068_0006818 | 3300049584 | Bacteria | 6316 |
| 521 | Ga0501068_0088105 | 3300049584 | Bacteria | 1912 |
| 522 | Ga0501068_0135011 | 3300049584 | Bacteria | 1544 |
| 523 | Ga0501068_0162697 | 3300049584 | Bacteria | 1407 |
| 524 | Ga0501068_0325974 | 3300049584 | Bacteria | 985 |
| 525 | Ga0501069_0042144 | 3300049585 | Bacteria | 2524 |
| 526 | Ga0501069_0096134 | 3300049585 | Bacteria | 1678 |
| 527 | Ga0501070_0006214 | 3300049586 | Bacteria | 10168 |
| 528 | Ga0501070_0006679 | 3300049586 | Bacteria | 9825 |
| 529 | Ga0501070_0017209 | 3300049586 | Bacteria | 6068 |
| 530 | Ga0501070_0156492 | 3300049586 | Bacteria | 1879 |
| 531 | Ga0501070_0290520 | 3300049586 | Bacteria | 1332 |
| 532 | Ga0501070_0308986 | 3300049586 | Bacteria | 1287 |
| 533 | Ga0501070_0566084 | 3300049586 | Bacteria | 908 |
| 534 | Ga0501070_0704071 | 3300049586 | Bacteria | 799 |
| 535 | Ga0501070_0718865 | 3300049586 | Bacteria | 789 |
| 536 | Ga0501070_0981438 | 3300049586 | Bacteria | 656 |
| 537 | Ga0501071_0002975 | 3300049587 | Bacteria | 10474 |
| 538 | Ga0501071_0015018 | 3300049587 | Bacteria | 5308 |
| 539 | Ga0501072_0007827 | 3300049588 | Bacteria | 8116 |
| 540 | Ga0501072_0016531 | 3300049588 | Bacteria | 5668 |
| 541 | Ga0501072_0083824 | 3300049588 | Bacteria | 2527 |
| 542 | Ga0501073_0006815 | 3300049589 | Bacteria | 8494 |
| 543 | Ga0501073_0042090 | 3300049589 | Bacteria | 3225 |
| 544 | Ga0501073_0104619 | 3300049589 | Bacteria | 1965 |
| 545 | Ga0501074_0007789 | 3300049590 | Bacteria | 7755 |
| 546 | Ga0501074_0020875 | 3300049590 | Bacteria | 4757 |
| 547 | Ga0501074_0022682 | 3300049590 | Bacteria | 4563 |
| 548 | Ga0501074_0124770 | 3300049590 | Bacteria | 1841 |
| 549 | Ga0501075_0126956 | 3300049591 | Bacteria | 1942 |
| 550 | Ga0501075_0559867 | 3300049591 | Bacteria | 872 |
| 551 | Ga0501076_0011109 | 3300049592 | Bacteria | 6699 |
| 552 | Ga0501077_0036670 | 3300049593 | Bacteria | 3124 |
| 553 | Ga0501077_0146406 | 3300049593 | Bacteria | 1498 |
| 554 | Ga0501077_0645909 | 3300049593 | Bacteria | 680 |
| 555 | Ga0501079_0011457 | 3300049741 | Bacteria | 6769 |
| 556 | Ga0501079_0124946 | 3300049741 | Bacteria | 2001 |
| 557 | Ga0501079_0205934 | 3300049741 | Bacteria | 1537 |
| 558 | Ga0501080_0025987 | 3300049742 | Bacteria | 5440 |
| 559 | Ga0501080_0054792 | 3300049742 | Bacteria | 3713 |
| 560 | Ga0501080_0231368 | 3300049742 | Bacteria | 1689 |
| 561 | Ga0501080_0536291 | 3300049742 | Bacteria | 1043 |
| 562 | Ga0501081_0252683 | 3300049743 | Bacteria | 1287 |
| 563 | Ga0501081_0820749 | 3300049743 | Bacteria | 700 |
| 564 | Ga0501083_0012888 | 3300049744 | Bacteria | 5847 |
| 565 | Ga0501083_0169964 | 3300049744 | Bacteria | 1425 |
| 566 | Ga0501083_0189244 | 3300049744 | Bacteria | 1343 |
| 567 | Ga0501035_0001886 | 3300049822 | Bacteria | 21100 |
| 568 | Ga0501035_0583128 | 3300049822 | Bacteria | 913 |
| 569 | Ga0501035_0679279 | 3300049822 | Bacteria | 832 |
| 570 | Ga0501044_0001121 | 3300049823 | Bacteria | 31806 |
| 571 | Ga0501044_0075942 | 3300049823 | Bacteria | 3411 |
| 572 | Ga0501044_0196047 | 3300049823 | Bacteria | 1980 |
| 573 | Ga0501044_0499505 | 3300049823 | Bacteria | 1118 |
| 574 | Ga0501045_0105210 | 3300049824 | Bacteria | 2091 |
| 575 | Ga0501045_0158404 | 3300049824 | Bacteria | 1685 |
| 576 | Ga0501045_0537606 | 3300049824 | Bacteria | 867 |
| 577 | nmdc:mga03683_128184_c1 | 3300050489 | Bacteria | 1133 |
| 578 | nmdc:mga03n38_12316_c1 | 3300050490 | Bacteria | 3214 |
| 579 | nmdc:mga03n38_177199_c1 | 3300050490 | Bacteria | 1090 |
| 580 | nmdc:mga00v17_15065_c1 | 3300050491 | Bacteria | 4334 |
| 581 | nmdc:mga00v17_164083_c1 | 3300050491 | Bacteria | 1431 |
| 582 | nmdc:mga00v17_353775_c1 | 3300050491 | Bacteria | 955 |
| 583 | nmdc:mga00v17_5897_c1 | 3300050491 | Bacteria | 6474 |
| 584 | nmdc:mga00v17_97985_c1 | 3300050491 | Bacteria | 1848 |
| 585 | nmdc:mga0yw44_123912_c1 | 3300050492 | Bacteria | 1667 |
| 586 | nmdc:mga0yw44_126671_c1 | 3300050492 | Bacteria | 1650 |
| 587 | nmdc:mga0yw44_150882_c1 | 3300050492 | Bacteria | 1516 |
| 588 | nmdc:mga0yw44_338293_c1 | 3300050492 | Bacteria | 1012 |
| 589 | nmdc:mga0yw44_34567_c1 | 3300050492 | Bacteria | 2963 |
| 590 | nmdc:mga0yw44_471684_c1 | 3300050492 | Bacteria | 851 |
| 591 | nmdc:mga0yw44_473171_c1 | 3300050492 | Bacteria | 850 |
| 592 | nmdc:mga0yw44_56321_c1 | 3300050492 | Bacteria | 2395 |
| 593 | nmdc:mga0yw44_6515_c1 | 3300050492 | Bacteria | 5651 |
| 594 | nmdc:mga0k408_115650_c1 | 3300050493 | Bacteria | 1587 |
| 595 | nmdc:mga0k408_84802_c1 | 3300050493 | Bacteria | 1859 |
| 596 | nmdc:mga0k408_92394_c1 | 3300050493 | Bacteria | 1778 |
| 597 | nmdc:mga06z11_185685_c1 | 3300050494 | Bacteria | 1201 |
| 598 | nmdc:mga06z11_27408_c1 | 3300050494 | Bacteria | 2723 |
| 599 | nmdc:mga06z11_446613_c1 | 3300050494 | Bacteria | 781 |
| 600 | nmdc:mga06z11_463190_c1 | 3300050494 | Bacteria | 766 |
| 601 | nmdc:mga06z11_473553_c1 | 3300050494 | Bacteria | 758 |
| 602 | nmdc:mga07m45_2428_c1 | 3300050496 | Bacteria | 8741 |
| 603 | nmdc:mga07m45_326277_c1 | 3300050496 | Bacteria | 892 |
| 604 | nmdc:mga07m45_351197_c1 | 3300050496 | Bacteria | 857 |
| 605 | nmdc:mga08y16_1162819_c1 | 3300050511 | Bacteria | 744 |
| 606 | nmdc:mga0sz30_125764_c1 | 3300050516 | Bacteria | 1128 |
| 607 | Ga0495601_0205890 | 3300053077 | Bacteria | 1285 |
| 608 | Ga0495612_0005084 | 3300053078 | Bacteria | 5447 |
| 609 | Ga0495655_0101016 | 3300053083 | Bacteria | 854 |
| 610 | Ga0495595_0369619 | 3300053084 | Bacteria | 725 |
| 611 | Ga0495619_0009810 | 3300053085 | Bacteria | 6036 |
| 612 | Ga0500644_0000050 | 3300053088 | Bacteria | 71907 |
| 613 | Ga0500641_0001127 | 3300053096 | Bacteria | 9490 |
| 614 | Ga0500641_0040656 | 3300053096 | Bacteria | 1879 |
| 615 | Ga0500556_0000726 | 3300053104 | Bacteria | 19847 |
| 616 | Ga0500593_000179 | 3300053117 | Bacteria | 25713 |
| 617 | Ga0500642_0111613 | 3300053130 | Bacteria | 1277 |
| 618 | Ga0500568_0233386 | 3300053139 | Bacteria | 671 |
| 619 | Ga0500573_0148649 | 3300053140 | Bacteria | 1285 |
| 620 | Ga0500573_0240167 | 3300053140 | Bacteria | 940 |
| 621 | Ga0501084_0034543 | 3300054114 | Bacteria | 4228 |
| 622 | Ga0501084_0046597 | 3300054114 | Bacteria | 3632 |
| 623 | Ga0501084_0047926 | 3300054114 | Bacteria | 3578 |
| 624 | Ga0501084_1090111 | 3300054114 | Bacteria | 671 |
| 625 | Ga0501082_0043978 | 3300060353 | Bacteria | 3852 |
| 626 | Ga0501082_0481827 | 3300060353 | Bacteria | 1084 |
| 627 | Ga0501082_0971994 | 3300060353 | Bacteria | 742 |
| 628 | Ga0501082_1243899 | 3300060353 | Bacteria | 650 |
| 629 | Ga0466962_0006470 | 3300061719 | Bacteria | 5622 |
| 630 | Ga0466962_0008596 | 3300061719 | Bacteria | 4894 |
| 631 | Ga0466962_0077845 | 3300061719 | Bacteria | 1585 |
| 632 | Ga0466962_0107769 | 3300061719 | Bacteria | 1340 |
| 633 | Ga0466962_0160343 | 3300061719 | Bacteria | 1093 |
| 634 | Ga0530510_0159371 | 3300061734 | Bacteria | 1669 |
| 635 | Ga0530510_0354933 | 3300061734 | Bacteria | 1102 |
| 636 | Ga0530510_0469192 | 3300061734 | Bacteria | 953 |
| 637 | Ga0530510_0798358 | 3300061734 | Bacteria | 720 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10003086 | Ga0081455_100030868 | 141 |
| 2 | 3300037312 | Ga0395899_0200820 | Ga0395899_0200820_13_621 | 142 |
| 3 | 3300037466 | Ga0395898_0007168 | Ga0395898_0007168_9105_9713 | 142 |
| 4 | 3300038443 | Ga0395901_0016154 | Ga0395901_0016154_4617_5225 | 142 |
| 5 | 3300037312 | Ga0395899_0012741 | Ga0395899_0012741_1590_2198 | 143 |
| 6 | 3300037418 | Ga0395900_0019991 | Ga0395900_0019991_5966_6574 | 143 |
| 7 | 3300038443 | Ga0395901_0013836 | Ga0395901_0013836_6576_7184 | 143 |
| 8 | 3300021361 | Ga0213872_10080390 | Ga0213872_100803901 | 146 |
| 9 | 3300039438 | Ga0436360_1006231 | Ga0436360_1006231_1332_1955 | 146 |
| 10 | 3300039447 | Ga0436361_1181514 | Ga0436361_1181514_727_1350 | 146 |
| 11 | 3300007265 | Ga0099794_10297847 | Ga0099794_102978471 | 147 |
| 12 | 3300005341 | Ga0070691_10346090 | Ga0070691_103460902 | 148 |
| 13 | 3300005436 | Ga0070713_100147932 | Ga0070713_1001479322 | 156 |
| 14 | 3300005937 | Ga0081455_10034777 | Ga0081455_100347774 | 156 |
| 15 | 3300006175 | Ga0070712_100813714 | Ga0070712_1008137141 | 156 |
| 16 | 3300025928 | Ga0207700_10147952 | Ga0207700_101479522 | 156 |
| 17 | 3300037068 | Ga0373925_0357446 | Ga0373925_0357446_339_878 | 157 |
| 18 | 3300048915 | Ga0496112_0137544 | Ga0496112_0137544_1903_2397 | 157 |
| 19 | 3300061734 | Ga0530510_0469192 | Ga0530510_0469192_11_484 | 157 |
| 20 | 3300009094 | Ga0111539_11236149 | Ga0111539_112361492 | 162 |
| 21 | 3300005530 | Ga0070679_100002885 | Ga0070679_10000288513 | 163 |
| 22 | 3300025904 | Ga0207647_10006988 | Ga0207647_100069882 | 163 |
| 23 | 3300025912 | Ga0207707_10316286 | Ga0207707_103162861 | 163 |
| 24 | 3300025917 | Ga0207660_10148228 | Ga0207660_101482281 | 163 |
| 25 | 3300050494 | nmdc:mga06z11_473553_c1 | nmdc:mga06z11_473553_c1_15_593 | 163 |
| 26 | 3300005843 | Ga0068860_100160294 | Ga0068860_1001602941 | 164 |
| 27 | 3300028381 | Ga0268264_10135921 | Ga0268264_101359211 | 164 |
| 28 | 3300044842 | Ga0466957_0451582 | Ga0466957_0451582_367_861 | 164 |
| 29 | 3300049822 | Ga0501035_0679279 | Ga0501035_0679279_38_532 | 164 |
| 30 | 3300060353 | Ga0501082_1243899 | Ga0501082_1243899_137_631 | 164 |
| 31 | 3300049571 | Ga0501034_0002497 | Ga0501034_0002497_15432_16037 | 165 |
| 32 | 3300044842 | Ga0466957_0199758 | Ga0466957_0199758_47_547 | 166 |
| 33 | 3300006038 | Ga0075365_10205794 | Ga0075365_102057942 | 167 |
| 34 | 3300006038 | Ga0075365_10269179 | Ga0075365_102691792 | 167 |
| 35 | 3300006042 | Ga0075368_10054728 | Ga0075368_100547282 | 167 |
| 36 | 3300006178 | Ga0075367_10434592 | Ga0075367_104345921 | 167 |
| 37 | 3300006186 | Ga0075369_10065581 | Ga0075369_100655812 | 167 |
| 38 | 3300006195 | Ga0075366_10171761 | Ga0075366_101717612 | 167 |
| 39 | 3300006353 | Ga0075370_10195204 | Ga0075370_101952042 | 167 |
| 40 | 3300006353 | Ga0075370_10273588 | Ga0075370_102735881 | 167 |
| 41 | 3300036401 | Ga0373937_0040759 | Ga0373937_0040759_2507_3115 | 167 |
| 42 | 3300050492 | nmdc:mga0yw44_126671_c1 | nmdc:mga0yw44_126671_c1_601_1209 | 167 |
| 43 | 3300050492 | nmdc:mga0yw44_150882_c1 | nmdc:mga0yw44_150882_c1_748_1356 | 167 |
| 44 | 3300050493 | nmdc:mga0k408_92394_c1 | nmdc:mga0k408_92394_c1_131_739 | 167 |
| 45 | 3300050494 | nmdc:mga06z11_185685_c1 | nmdc:mga06z11_185685_c1_394_1002 | 167 |
| 46 | 3300050494 | nmdc:mga06z11_446613_c1 | nmdc:mga06z11_446613_c1_48_656 | 167 |
| 47 | 3300050496 | nmdc:mga07m45_351197_c1 | nmdc:mga07m45_351197_c1_51_659 | 167 |
| 48 | 3300050511 | nmdc:mga08y16_1162819_c1 | nmdc:mga08y16_1162819_c1_23_631 | 167 |
| 49 | 3300048905 | Ga0496102_0962233 | Ga0496102_0962233_39_611 | 168 |
| 50 | 3300026075 | Ga0207708_10301567 | Ga0207708_103015672 | 170 |
| 51 | 3300044656 | Ga0466969_0010413 | Ga0466969_0010413_141_716 | 170 |
| 52 | 3300044658 | Ga0466972_0416015 | Ga0466972_0416015_16_528 | 170 |
| 53 | 3300044765 | Ga0466970_0000598 | Ga0466970_0000598_11552_12127 | 170 |
| 54 | 3300061719 | Ga0466962_0160343 | Ga0466962_0160343_294_869 | 170 |
| 55 | 3300006038 | Ga0075365_10044252 | Ga0075365_100442523 | 171 |
| 56 | 3300006048 | Ga0075363_100404336 | Ga0075363_1004043362 | 171 |
| 57 | 3300006051 | Ga0075364_10725413 | Ga0075364_107254131 | 171 |
| 58 | 3300006177 | Ga0075362_10024977 | Ga0075362_100249772 | 171 |
| 59 | 3300006178 | Ga0075367_10036960 | Ga0075367_100369602 | 171 |
| 60 | 3300006195 | Ga0075366_10035211 | Ga0075366_100352112 | 171 |
| 61 | 3300050491 | nmdc:mga00v17_353775_c1 | nmdc:mga00v17_353775_c1_314_922 | 171 |
| 62 | 3300050492 | nmdc:mga0yw44_56321_c1 | nmdc:mga0yw44_56321_c1_73_681 | 171 |
| 63 | 3300050493 | nmdc:mga0k408_115650_c1 | nmdc:mga0k408_115650_c1_694_1302 | 171 |
| 64 | 3300005366 | Ga0070659_101010824 | Ga0070659_1010108241 | 172 |
| 65 | 3300006178 | Ga0075367_10248375 | Ga0075367_102483751 | 172 |
| 66 | 3300039437 | Ga0436365_1768712 | Ga0436365_1768712_704_1312 | 172 |
| 67 | 3300050492 | nmdc:mga0yw44_338293_c1 | nmdc:mga0yw44_338293_c1_171_779 | 172 |
| 68 | 3300006038 | Ga0075365_10093087 | Ga0075365_100930872 | 173 |
| 69 | 3300053096 | Ga0500641_0001127 | Ga0500641_0001127_2921_3529 | 173 |
| 70 | 3300005327 | Ga0070658_10062170 | Ga0070658_100621702 | 175 |
| 71 | 3300005455 | Ga0070663_100141707 | Ga0070663_1001417072 | 175 |
| 72 | 3300005539 | Ga0068853_100058831 | Ga0068853_1000588313 | 175 |
| 73 | 3300005548 | Ga0070665_100042027 | Ga0070665_1000420272 | 175 |
| 74 | 3300005563 | Ga0068855_100104580 | Ga0068855_1001045802 | 175 |
| 75 | 3300005578 | Ga0068854_100007951 | Ga0068854_1000079516 | 175 |
| 76 | 3300005614 | Ga0068856_100192569 | Ga0068856_1001925692 | 175 |
| 77 | 3300005616 | Ga0068852_100186888 | Ga0068852_1001868882 | 175 |
| 78 | 3300009093 | Ga0105240_10119011 | Ga0105240_101190113 | 175 |
| 79 | 3300009174 | Ga0105241_10011187 | Ga0105241_100111876 | 175 |
| 80 | 3300009545 | Ga0105237_10013245 | Ga0105237_100132459 | 175 |
| 81 | 3300009551 | Ga0105238_10007039 | Ga0105238_100070396 | 175 |
| 82 | 3300010375 | Ga0105239_10104410 | Ga0105239_101044103 | 175 |
| 83 | 3300020069 | Ga0197907_10836942 | Ga0197907_108369423 | 175 |
| 84 | 3300022467 | Ga0224712_10008704 | Ga0224712_100087041 | 175 |
| 85 | 3300025904 | Ga0207647_10028751 | Ga0207647_100287513 | 175 |
| 86 | 3300025909 | Ga0207705_10119983 | Ga0207705_101199832 | 175 |
| 87 | 3300025911 | Ga0207654_10100280 | Ga0207654_101002802 | 175 |
| 88 | 3300025913 | Ga0207695_10015897 | Ga0207695_100158976 | 175 |
| 89 | 3300025914 | Ga0207671_10001468 | Ga0207671_1000146820 | 175 |
| 90 | 3300025924 | Ga0207694_10003092 | Ga0207694_100030927 | 175 |
| 91 | 3300025949 | Ga0207667_10395376 | Ga0207667_103953762 | 175 |
| 92 | 3300025981 | Ga0207640_10403778 | Ga0207640_104037782 | 175 |
| 93 | 3300026041 | Ga0207639_10169153 | Ga0207639_101691532 | 175 |
| 94 | 3300026078 | Ga0207702_10732939 | Ga0207702_107329391 | 175 |
| 95 | 3300026142 | Ga0207698_10521080 | Ga0207698_105210802 | 175 |
| 96 | 3300028379 | Ga0268266_10068655 | Ga0268266_100686553 | 175 |
| 97 | 3300047315 | Ga0495581_0026637 | Ga0495581_0026637_1971_2540 | 175 |
| 98 | 3300038443 | Ga0395901_0607055 | Ga0395901_0607055_126_707 | 176 |
| 99 | 3300050496 | nmdc:mga07m45_326277_c1 | nmdc:mga07m45_326277_c1_69_623 | 176 |
| 100 | 3300044693 | Ga0466961_0013942 | Ga0466961_0013942_1686_2258 | 177 |
| 101 | 3300049575 | Ga0501039_0361085 | Ga0501039_0361085_215_766 | 177 |
| 102 | 3300005327 | Ga0070658_10009109 | Ga0070658_100091097 | 178 |
| 103 | 3300005331 | Ga0070670_100647432 | Ga0070670_1006474322 | 178 |
| 104 | 3300005336 | Ga0070680_100002368 | Ga0070680_1000023689 | 178 |
| 105 | 3300005338 | Ga0068868_100264029 | Ga0068868_1002640292 | 178 |
| 106 | 3300005340 | Ga0070689_100629193 | Ga0070689_1006291931 | 178 |
| 107 | 3300005356 | Ga0070674_100504136 | Ga0070674_1005041362 | 178 |
| 108 | 3300005456 | Ga0070678_100078733 | Ga0070678_1000787332 | 178 |
| 109 | 3300005458 | Ga0070681_10018251 | Ga0070681_100182512 | 178 |
| 110 | 3300005530 | Ga0070679_100005262 | Ga0070679_1000052625 | 178 |
| 111 | 3300005539 | Ga0068853_100549682 | Ga0068853_1005496822 | 178 |
| 112 | 3300005548 | Ga0070665_100037527 | Ga0070665_1000375274 | 178 |
| 113 | 3300005563 | Ga0068855_100029299 | Ga0068855_1000292994 | 178 |
| 114 | 3300005563 | Ga0068855_100256471 | Ga0068855_1002564713 | 178 |
| 115 | 3300005937 | Ga0081455_10001499 | Ga0081455_1000149915 | 178 |
| 116 | 3300006038 | Ga0075365_10329558 | Ga0075365_103295581 | 178 |
| 117 | 3300006042 | Ga0075368_10151036 | Ga0075368_101510361 | 178 |
| 118 | 3300006058 | Ga0075432_10007942 | Ga0075432_100079425 | 178 |
| 119 | 3300006186 | Ga0075369_10079636 | Ga0075369_100796362 | 178 |
| 120 | 3300006195 | Ga0075366_10018878 | Ga0075366_100188784 | 178 |
| 121 | 3300009093 | Ga0105240_10008364 | Ga0105240_100083648 | 178 |
| 122 | 3300009094 | Ga0111539_11316096 | Ga0111539_113160961 | 178 |
| 123 | 3300013105 | Ga0157369_10814820 | Ga0157369_108148202 | 178 |
| 124 | 3300013296 | Ga0157374_10179208 | Ga0157374_101792082 | 178 |
| 125 | 3300014969 | Ga0157376_10269346 | Ga0157376_102693462 | 178 |
| 126 | 3300014969 | Ga0157376_10506782 | Ga0157376_105067822 | 178 |
| 127 | 3300025909 | Ga0207705_10038710 | Ga0207705_100387102 | 178 |
| 128 | 3300025912 | Ga0207707_10001025 | Ga0207707_1000102525 | 178 |
| 129 | 3300025913 | Ga0207695_10045796 | Ga0207695_100457965 | 178 |
| 130 | 3300025917 | Ga0207660_10005894 | Ga0207660_100058946 | 178 |
| 131 | 3300025921 | Ga0207652_10007355 | Ga0207652_1000735510 | 178 |
| 132 | 3300025926 | Ga0207659_10604726 | Ga0207659_106047262 | 178 |
| 133 | 3300025937 | Ga0207669_10543825 | Ga0207669_105438252 | 178 |
| 134 | 3300025940 | Ga0207691_10553797 | Ga0207691_105537971 | 178 |
| 135 | 3300025942 | Ga0207689_10040149 | Ga0207689_100401495 | 178 |
| 136 | 3300025949 | Ga0207667_10019039 | Ga0207667_100190396 | 178 |
| 137 | 3300025949 | Ga0207667_10389235 | Ga0207667_103892352 | 178 |
| 138 | 3300025981 | Ga0207640_10445651 | Ga0207640_104456511 | 178 |
| 139 | 3300026023 | Ga0207677_10106279 | Ga0207677_101062792 | 178 |
| 140 | 3300026041 | Ga0207639_10397499 | Ga0207639_103974992 | 178 |
| 141 | 3300026121 | Ga0207683_10255276 | Ga0207683_102552762 | 178 |
| 142 | 3300027907 | Ga0207428_10316640 | Ga0207428_103166402 | 178 |
| 143 | 3300028379 | Ga0268266_10073140 | Ga0268266_100731402 | 178 |
| 144 | 3300031250 | Ga0265331_10089390 | Ga0265331_100893902 | 178 |
| 145 | 3300031901 | Ga0307406_10907534 | Ga0307406_109075341 | 178 |
| 146 | 3300035113 | Ga0373936_0191580 | Ga0373936_0191580_35_643 | 178 |
| 147 | 3300037418 | Ga0395900_0007584 | Ga0395900_0007584_6084_6692 | 178 |
| 148 | 3300049571 | Ga0501034_0001484 | Ga0501034_0001484_2342_2941 | 178 |
| 149 | 3300049573 | Ga0501037_0171522 | Ga0501037_0171522_316_915 | 178 |
| 150 | 3300049584 | Ga0501068_0006818 | Ga0501068_0006818_1099_1698 | 178 |
| 151 | 3300049586 | Ga0501070_0156492 | Ga0501070_0156492_93_692 | 178 |
| 152 | 3300050489 | nmdc:mga03683_128184_c1 | nmdc:mga03683_128184_c1_81_689 | 178 |
| 153 | 3300050492 | nmdc:mga0yw44_471684_c1 | nmdc:mga0yw44_471684_c1_173_781 | 178 |
| 154 | 3300050493 | nmdc:mga0k408_84802_c1 | nmdc:mga0k408_84802_c1_754_1362 | 178 |
| 155 | 3300050494 | nmdc:mga06z11_463190_c1 | nmdc:mga06z11_463190_c1_129_737 | 178 |
| 156 | 3300050516 | nmdc:mga0sz30_125764_c1 | nmdc:mga0sz30_125764_c1_10_618 | 178 |
| 157 | 3300026089 | Ga0207648_10811747 | Ga0207648_108117471 | 179 |
| 158 | 3300049743 | Ga0501081_0820749 | Ga0501081_0820749_129_683 | 179 |
| 159 | iso_pu_bacteria | 2795385472 | 2795796603 | 179 |
| 160 | iso_pu_bacteria | 2884693830 | 2884695656 | 179 |
| 161 | iso_pu_bacteria | 2895427314 | 2895438738 | 179 |
| 162 | iso_pu_bacteria | 2895442618 | 2895445637 | 179 |
| 163 | 3300026142 | Ga0207698_11109974 | Ga0207698_111099742 | 180 |
| 164 | 3300028794 | Ga0307515_10053283 | Ga0307515_100532837 | 180 |
| 165 | 3300044683 | Ga0466965_0191333 | Ga0466965_0191333_258_809 | 180 |
| 166 | 3300044684 | Ga0466966_0047198 | Ga0466966_0047198_855_1406 | 180 |
| 167 | 3300044693 | Ga0466961_0005509 | Ga0466961_0005509_3627_4178 | 180 |
| 168 | 3300044694 | Ga0466963_0079207 | Ga0466963_0079207_1396_1947 | 180 |
| 169 | 3300044694 | Ga0466963_0436183 | Ga0466963_0436183_78_629 | 180 |
| 170 | 3300044735 | Ga0466968_0004609 | Ga0466968_0004609_912_1463 | 180 |
| 171 | 3300044842 | Ga0466957_0010934 | Ga0466957_0010934_2715_3266 | 180 |
| 172 | 3300045049 | Ga0466959_0003111 | Ga0466959_0003111_9502_10053 | 180 |
| 173 | 3300045836 | Ga0466958_0001868 | Ga0466958_0001868_887_1438 | 180 |
| 174 | iso_pu_bacteria | 2857481737 | 2857483255 | 180 |
| 175 | iso_pu_bacteria | 2984576629 | 2984577243 | 180 |
| 176 | iso_pu_bacteria | 2990256926 | 2990260654 | 180 |
| 177 | 3300013105 | Ga0157369_10928979 | Ga0157369_109289791 | 181 |
| 178 | 3300025941 | Ga0207711_11156492 | Ga0207711_111564921 | 181 |
| 179 | 3300045976 | Ga0466967_0152275 | Ga0466967_0152275_1459_2028 | 181 |
| 180 | 3300048905 | Ga0496102_0536950 | Ga0496102_0536950_503_1078 | 181 |
| 181 | 3300048906 | Ga0496103_0256365 | Ga0496103_0256365_19_594 | 181 |
| 182 | 3300048911 | Ga0496108_0084979 | Ga0496108_0084979_769_1344 | 181 |
| 183 | 3300048911 | Ga0496108_0279555 | Ga0496108_0279555_767_1342 | 181 |
| 184 | 3300048912 | Ga0496109_0026023 | Ga0496109_0026023_4528_5103 | 181 |
| 185 | 3300048912 | Ga0496109_0079079 | Ga0496109_0079079_1939_2514 | 181 |
| 186 | 3300048915 | Ga0496112_0199841 | Ga0496112_0199841_128_703 | 181 |
| 187 | 3300048916 | Ga0496113_0656831 | Ga0496113_0656831_231_806 | 181 |
| 188 | 3300048917 | Ga0496114_0010389 | Ga0496114_0010389_2848_3423 | 181 |
| 189 | iso_pu_bacteria | 2643221567 | 2643853562 | 181 |
| 190 | iso_pu_bacteria | 2643221624 | 2644137530 | 181 |
| 191 | iso_pu_bacteria | 2920879853 | 2920882171 | 181 |
| 192 | 3300002067 | JGI24735J21928_10053686 | JGI24735J21928_100536861 | 182 |
| 193 | 3300005435 | Ga0070714_100013219 | Ga0070714_1000132193 | 182 |
| 194 | 3300006028 | Ga0070717_10519438 | Ga0070717_105194382 | 182 |
| 195 | 3300009098 | Ga0105245_10591887 | Ga0105245_105918872 | 182 |
| 196 | 3300025919 | Ga0207657_10340038 | Ga0207657_103400382 | 182 |
| 197 | 3300025921 | Ga0207652_10017591 | Ga0207652_100175913 | 182 |
| 198 | 3300025927 | Ga0207687_10019001 | Ga0207687_100190016 | 182 |
| 199 | 3300025929 | Ga0207664_10009318 | Ga0207664_100093187 | 182 |
| 200 | 3300039437 | Ga0436365_1263051 | Ga0436365_1263051_43_612 | 182 |
| 201 | 3300044684 | Ga0466966_0252671 | Ga0466966_0252671_423_992 | 182 |
| 202 | 3300044694 | Ga0466963_0390639 | Ga0466963_0390639_290_859 | 182 |
| 203 | 3300044694 | Ga0466963_0659194 | Ga0466963_0659194_20_589 | 182 |
| 204 | 3300048903 | Ga0496100_0096006 | Ga0496100_0096006_1064_1639 | 182 |
| 205 | 3300048904 | Ga0496101_0135975 | Ga0496101_0135975_517_1092 | 182 |
| 206 | 3300048907 | Ga0496104_0006653 | Ga0496104_0006653_1070_1645 | 182 |
| 207 | 3300048908 | Ga0496105_0039705 | Ga0496105_0039705_2003_2578 | 182 |
| 208 | 3300048911 | Ga0496108_0038651 | Ga0496108_0038651_3013_3588 | 182 |
| 209 | 3300048912 | Ga0496109_0014537 | Ga0496109_0014537_392_967 | 182 |
| 210 | 3300048913 | Ga0496110_0142741 | Ga0496110_0142741_793_1368 | 182 |
| 211 | 3300048917 | Ga0496114_0006631 | Ga0496114_0006631_7430_8005 | 182 |
| 212 | 3300048918 | Ga0496115_0183269 | Ga0496115_0183269_782_1357 | 182 |
| 213 | 3300001990 | JGI24737J22298_10027915 | JGI24737J22298_100279152 | 183 |
| 214 | 3300005327 | Ga0070658_10059767 | Ga0070658_100597674 | 183 |
| 215 | 3300005329 | Ga0070683_100001861 | Ga0070683_10000186121 | 183 |
| 216 | 3300005329 | Ga0070683_100053804 | Ga0070683_1000538043 | 183 |
| 217 | 3300005336 | Ga0070680_100000200 | Ga0070680_10000020041 | 183 |
| 218 | 3300005337 | Ga0070682_100005518 | Ga0070682_10000551810 | 183 |
| 219 | 3300005345 | Ga0070692_10004188 | Ga0070692_100041882 | 183 |
| 220 | 3300005356 | Ga0070674_100086493 | Ga0070674_1000864932 | 183 |
| 221 | 3300005435 | Ga0070714_100061304 | Ga0070714_1000613044 | 183 |
| 222 | 3300005456 | Ga0070678_100058612 | Ga0070678_1000586123 | 183 |
| 223 | 3300005458 | Ga0070681_10000052 | Ga0070681_1000005230 | 183 |
| 224 | 3300005466 | Ga0070685_10013113 | Ga0070685_100131132 | 183 |
| 225 | 3300005471 | Ga0070698_100523986 | Ga0070698_1005239861 | 183 |
| 226 | 3300005530 | Ga0070679_100000018 | Ga0070679_10000001874 | 183 |
| 227 | 3300005535 | Ga0070684_100006183 | Ga0070684_1000061836 | 183 |
| 228 | 3300005577 | Ga0068857_100121496 | Ga0068857_1001214963 | 183 |
| 229 | 3300005618 | Ga0068864_100170335 | Ga0068864_1001703352 | 183 |
| 230 | 3300005841 | Ga0068863_100474198 | Ga0068863_1004741982 | 183 |
| 231 | 3300006178 | Ga0075367_10627551 | Ga0075367_106275511 | 183 |
| 232 | 3300006358 | Ga0068871_100135096 | Ga0068871_1001350963 | 183 |
| 233 | 3300009098 | Ga0105245_10009576 | Ga0105245_100095769 | 183 |
| 234 | 3300009148 | Ga0105243_10026469 | Ga0105243_100264692 | 183 |
| 235 | 3300009148 | Ga0105243_10152214 | Ga0105243_101522142 | 183 |
| 236 | 3300009176 | Ga0105242_10194703 | Ga0105242_101947032 | 183 |
| 237 | 3300009177 | Ga0105248_10138883 | Ga0105248_101388832 | 183 |
| 238 | 3300010375 | Ga0105239_10003376 | Ga0105239_1000337612 | 183 |
| 239 | 3300011119 | Ga0105246_10002553 | Ga0105246_1000255310 | 183 |
| 240 | 3300013105 | Ga0157369_10024307 | Ga0157369_100243073 | 183 |
| 241 | 3300013306 | Ga0163162_10004012 | Ga0163162_1000401212 | 183 |
| 242 | 3300013307 | Ga0157372_10003758 | Ga0157372_1000375812 | 183 |
| 243 | 3300013308 | Ga0157375_10034952 | Ga0157375_100349523 | 183 |
| 244 | 3300014325 | Ga0163163_10033431 | Ga0163163_100334311 | 183 |
| 245 | 3300014745 | Ga0157377_10095550 | Ga0157377_100955502 | 183 |
| 246 | 3300014968 | Ga0157379_10059305 | Ga0157379_100593052 | 183 |
| 247 | 3300014969 | Ga0157376_10310812 | Ga0157376_103108122 | 183 |
| 248 | 3300014969 | Ga0157376_10670324 | Ga0157376_106703241 | 183 |
| 249 | 3300025904 | Ga0207647_10027106 | Ga0207647_100271061 | 183 |
| 250 | 3300025907 | Ga0207645_10614592 | Ga0207645_106145922 | 183 |
| 251 | 3300025909 | Ga0207705_10051832 | Ga0207705_100518324 | 183 |
| 252 | 3300025912 | Ga0207707_10000384 | Ga0207707_1000038412 | 183 |
| 253 | 3300025917 | Ga0207660_10000175 | Ga0207660_1000017542 | 183 |
| 254 | 3300025919 | Ga0207657_10066054 | Ga0207657_100660542 | 183 |
| 255 | 3300025921 | Ga0207652_10000293 | Ga0207652_1000029318 | 183 |
| 256 | 3300025926 | Ga0207659_10176548 | Ga0207659_101765482 | 183 |
| 257 | 3300025927 | Ga0207687_10023514 | Ga0207687_100235142 | 183 |
| 258 | 3300025935 | Ga0207709_10268818 | Ga0207709_102688182 | 183 |
| 259 | 3300025941 | Ga0207711_10210578 | Ga0207711_102105782 | 183 |
| 260 | 3300025944 | Ga0207661_10006769 | Ga0207661_100067697 | 183 |
| 261 | 3300025944 | Ga0207661_10073705 | Ga0207661_100737053 | 183 |
| 262 | 3300026067 | Ga0207678_10080490 | Ga0207678_100804903 | 183 |
| 263 | 3300026078 | Ga0207702_10050948 | Ga0207702_100509485 | 183 |
| 264 | 3300026088 | Ga0207641_10745002 | Ga0207641_107450022 | 183 |
| 265 | 3300026095 | Ga0207676_10150381 | Ga0207676_101503812 | 183 |
| 266 | 3300026116 | Ga0207674_10034172 | Ga0207674_100341727 | 183 |
| 267 | 3300026121 | Ga0207683_10021147 | Ga0207683_100211472 | 183 |
| 268 | 3300028379 | Ga0268266_10508426 | Ga0268266_105084262 | 183 |
| 269 | 3300028381 | Ga0268264_10031083 | Ga0268264_100310836 | 183 |
| 270 | 3300031838 | Ga0307518_10100533 | Ga0307518_101005332 | 183 |
| 271 | 3300033179 | Ga0307507_10031342 | Ga0307507_100313422 | 183 |
| 272 | 3300033179 | Ga0307507_10174856 | Ga0307507_101748563 | 183 |
| 273 | 3300035121 | Ga0373960_0063198 | Ga0373960_0063198_383_958 | 183 |
| 274 | 3300042005 | Ga0439448_0082929 | Ga0439448_0082929_401_976 | 183 |
| 275 | 3300044693 | Ga0466961_0327656 | Ga0466961_0327656_142_705 | 183 |
| 276 | 3300044706 | Ga0466964_0017258 | Ga0466964_0017258_378_953 | 183 |
| 277 | 3300044765 | Ga0466970_0105721 | Ga0466970_0105721_428_997 | 183 |
| 278 | 3300045049 | Ga0466959_0155969 | Ga0466959_0155969_927_1496 | 183 |
| 279 | 3300045049 | Ga0466959_0187167 | Ga0466959_0187167_171_734 | 183 |
| 280 | 3300045049 | Ga0466959_0457487 | Ga0466959_0457487_131_700 | 183 |
| 281 | 3300048904 | Ga0496101_0166374 | Ga0496101_0166374_712_1287 | 183 |
| 282 | 3300048905 | Ga0496102_0010713 | Ga0496102_0010713_3450_4025 | 183 |
| 283 | 3300048905 | Ga0496102_0436896 | Ga0496102_0436896_603_1178 | 183 |
| 284 | 3300048906 | Ga0496103_0016740 | Ga0496103_0016740_3750_4325 | 183 |
| 285 | 3300048908 | Ga0496105_0785957 | Ga0496105_0785957_16_585 | 183 |
| 286 | 3300048910 | Ga0496107_0081685 | Ga0496107_0081685_179_754 | 183 |
| 287 | 3300048911 | Ga0496108_0137794 | Ga0496108_0137794_1045_1620 | 183 |
| 288 | 3300048912 | Ga0496109_0047889 | Ga0496109_0047889_555_1130 | 183 |
| 289 | 3300048913 | Ga0496110_0002615 | Ga0496110_0002615_3884_4459 | 183 |
| 290 | 3300049569 | Ga0501032_0033128 | Ga0501032_0033128_696_1256 | 183 |
| 291 | 3300049570 | Ga0501033_0011833 | Ga0501033_0011833_3170_3730 | 183 |
| 292 | 3300049571 | Ga0501034_0089958 | Ga0501034_0089958_90_650 | 183 |
| 293 | 3300049579 | Ga0501043_0136560 | Ga0501043_0136560_872_1432 | 183 |
| 294 | 3300049581 | Ga0501047_0023163 | Ga0501047_0023163_3302_3862 | 183 |
| 295 | 3300049586 | Ga0501070_0718865 | Ga0501070_0718865_197_766 | 183 |
| 296 | 3300049822 | Ga0501035_0001886 | Ga0501035_0001886_20413_20973 | 183 |
| 297 | 3300049823 | Ga0501044_0001121 | Ga0501044_0001121_20413_20973 | 183 |
| 298 | 3300050492 | nmdc:mga0yw44_6515_c1 | nmdc:mga0yw44_6515_c1_4670_5245 | 183 |
| 299 | 3300005439 | Ga0070711_100962760 | Ga0070711_1009627601 | 184 |
| 300 | 3300005467 | Ga0070706_100336483 | Ga0070706_1003364831 | 184 |
| 301 | 3300005471 | Ga0070698_100036927 | Ga0070698_1000369276 | 184 |
| 302 | 3300005471 | Ga0070698_100046720 | Ga0070698_1000467203 | 184 |
| 303 | 3300005536 | Ga0070697_100079495 | Ga0070697_1000794953 | 184 |
| 304 | 3300006051 | Ga0075364_10000945 | Ga0075364_100009452 | 184 |
| 305 | 3300006175 | Ga0070712_100128683 | Ga0070712_1001286833 | 184 |
| 306 | 3300006353 | Ga0075370_10016952 | Ga0075370_100169524 | 184 |
| 307 | 3300021388 | Ga0213875_10000249 | Ga0213875_1000024930 | 184 |
| 308 | 3300025910 | Ga0207684_10889354 | Ga0207684_108893541 | 184 |
| 309 | 3300025922 | Ga0207646_10207338 | Ga0207646_102073383 | 184 |
| 310 | 3300025929 | Ga0207664_10246516 | Ga0207664_102465163 | 184 |
| 311 | 3300050490 | nmdc:mga03n38_177199_c1 | nmdc:mga03n38_177199_c1_314_982 | 184 |
| 312 | 3300050491 | nmdc:mga00v17_5897_c1 | nmdc:mga00v17_5897_c1_1834_2502 | 184 |
| 313 | 3300053130 | Ga0500642_0111613 | Ga0500642_0111613_559_1131 | 184 |
| 314 | 3300005435 | Ga0070714_100030191 | Ga0070714_1000301912 | 185 |
| 315 | 3300005468 | Ga0070707_100026218 | Ga0070707_1000262182 | 185 |
| 316 | 3300005548 | Ga0070665_100001068 | Ga0070665_10000106811 | 185 |
| 317 | 3300013308 | Ga0157375_10941208 | Ga0157375_109412082 | 185 |
| 318 | 3300020081 | Ga0206354_10736619 | Ga0206354_107366192 | 185 |
| 319 | 3300020082 | Ga0206353_10232671 | Ga0206353_102326712 | 185 |
| 320 | 3300025910 | Ga0207684_10729692 | Ga0207684_107296922 | 185 |
| 321 | 3300025922 | Ga0207646_10067790 | Ga0207646_100677904 | 185 |
| 322 | 3300028379 | Ga0268266_10003912 | Ga0268266_100039124 | 185 |
| 323 | 3300031911 | Ga0307412_10997002 | Ga0307412_109970021 | 185 |
| 324 | 3300032002 | Ga0307416_100084232 | Ga0307416_1000842322 | 185 |
| 325 | 3300033179 | Ga0307507_10000013 | Ga0307507_10000013213 | 185 |
| 326 | 3300044656 | Ga0466969_0013126 | Ga0466969_0013126_3366_3935 | 185 |
| 327 | 3300044656 | Ga0466969_0138386 | Ga0466969_0138386_390_959 | 185 |
| 328 | 3300044684 | Ga0466966_0064110 | Ga0466966_0064110_1199_1768 | 185 |
| 329 | 3300044693 | Ga0466961_0039362 | Ga0466961_0039362_1268_1837 | 185 |
| 330 | 3300044693 | Ga0466961_0140241 | Ga0466961_0140241_478_1047 | 185 |
| 331 | 3300044694 | Ga0466963_0584664 | Ga0466963_0584664_10_579 | 185 |
| 332 | 3300044719 | Ga0466971_0016915 | Ga0466971_0016915_1281_1850 | 185 |
| 333 | 3300044719 | Ga0466971_0027398 | Ga0466971_0027398_1539_2108 | 185 |
| 334 | 3300044719 | Ga0466971_0261482 | Ga0466971_0261482_116_694 | 185 |
| 335 | 3300044765 | Ga0466970_0096141 | Ga0466970_0096141_185_754 | 185 |
| 336 | 3300044765 | Ga0466970_0118129 | Ga0466970_0118129_410_979 | 185 |
| 337 | 3300044842 | Ga0466957_0246455 | Ga0466957_0246455_30_599 | 185 |
| 338 | 3300044842 | Ga0466957_0657757 | Ga0466957_0657757_125_694 | 185 |
| 339 | 3300045049 | Ga0466959_0081157 | Ga0466959_0081157_469_1038 | 185 |
| 340 | 3300045836 | Ga0466958_0287148 | Ga0466958_0287148_438_1007 | 185 |
| 341 | 3300045836 | Ga0466958_0427933 | Ga0466958_0427933_184_753 | 185 |
| 342 | 3300046459 | Ga0495629_0292340 | Ga0495629_0292340_39_650 | 185 |
| 343 | 3300046461 | Ga0495641_0023474 | Ga0495641_0023474_152_751 | 185 |
| 344 | 3300046511 | Ga0495608_0129463 | Ga0495608_0129463_958_1548 | 185 |
| 345 | 3300046543 | Ga0495645_0039408 | Ga0495645_0039408_1796_2380 | 185 |
| 346 | 3300048903 | Ga0496100_0104528 | Ga0496100_0104528_1163_1774 | 185 |
| 347 | 3300048904 | Ga0496101_0017044 | Ga0496101_0017044_3578_4168 | 185 |
| 348 | 3300048905 | Ga0496102_0010935 | Ga0496102_0010935_54_644 | 185 |
| 349 | 3300048905 | Ga0496102_0112516 | Ga0496102_0112516_1435_2025 | 185 |
| 350 | 3300048906 | Ga0496103_0014931 | Ga0496103_0014931_1486_2076 | 185 |
| 351 | 3300048909 | Ga0496106_0227992 | Ga0496106_0227992_782_1372 | 185 |
| 352 | 3300048918 | Ga0496115_0420337 | Ga0496115_0420337_267_857 | 185 |
| 353 | 3300061719 | Ga0466962_0006470 | Ga0466962_0006470_1495_2064 | 185 |
| 354 | 3300061719 | Ga0466962_0107769 | Ga0466962_0107769_760_1329 | 185 |
| 355 | 3300005329 | Ga0070683_100037152 | Ga0070683_1000371521 | 186 |
| 356 | 3300005535 | Ga0070684_100323908 | Ga0070684_1003239081 | 186 |
| 357 | 3300022467 | Ga0224712_10029128 | Ga0224712_100291281 | 186 |
| 358 | 3300025944 | Ga0207661_10025263 | Ga0207661_100252635 | 186 |
| 359 | 3300046454 | Ga0495592_0017836 | Ga0495592_0017836_2819_3391 | 186 |
| 360 | 3300046462 | Ga0495651_0008132 | Ga0495651_0008132_4191_4763 | 186 |
| 361 | 3300046462 | Ga0495651_0129807 | Ga0495651_0129807_498_1067 | 186 |
| 362 | 3300046516 | Ga0495628_0026610 | Ga0495628_0026610_2259_2831 | 186 |
| 363 | 3300046529 | Ga0495652_0000288 | Ga0495652_0000288_27704_28276 | 186 |
| 364 | 3300046543 | Ga0495645_0015629 | Ga0495645_0015629_2961_3533 | 186 |
| 365 | 3300046809 | Ga0495600_0010059 | Ga0495600_0010059_2355_2927 | 186 |
| 366 | 3300047317 | Ga0495604_0023186 | Ga0495604_0023186_2986_3558 | 186 |
| 367 | 3300049571 | Ga0501034_0018284 | Ga0501034_0018284_3642_4217 | 186 |
| 368 | 3300049571 | Ga0501034_0163516 | Ga0501034_0163516_1565_2140 | 186 |
| 369 | 3300049572 | Ga0501036_0256932 | Ga0501036_0256932_244_819 | 186 |
| 370 | 3300049572 | Ga0501036_0652248 | Ga0501036_0652248_101_676 | 186 |
| 371 | 3300049575 | Ga0501039_0110793 | Ga0501039_0110793_1011_1586 | 186 |
| 372 | 3300049579 | Ga0501043_0105585 | Ga0501043_0105585_682_1257 | 186 |
| 373 | 3300049581 | Ga0501047_0473909 | Ga0501047_0473909_203_778 | 186 |
| 374 | 3300049583 | Ga0501067_0001937 | Ga0501067_0001937_4558_5133 | 186 |
| 375 | 3300049583 | Ga0501067_0004724 | Ga0501067_0004724_5156_5731 | 186 |
| 376 | 3300049584 | Ga0501068_0004892 | Ga0501068_0004892_3988_4563 | 186 |
| 377 | 3300049584 | Ga0501068_0135011 | Ga0501068_0135011_915_1490 | 186 |
| 378 | 3300049586 | Ga0501070_0017209 | Ga0501070_0017209_2739_3314 | 186 |
| 379 | 3300049586 | Ga0501070_0290520 | Ga0501070_0290520_691_1266 | 186 |
| 380 | 3300049587 | Ga0501071_0015018 | Ga0501071_0015018_2994_3569 | 186 |
| 381 | 3300049588 | Ga0501072_0007827 | Ga0501072_0007827_4516_5091 | 186 |
| 382 | 3300049588 | Ga0501072_0016531 | Ga0501072_0016531_679_1254 | 186 |
| 383 | 3300049589 | Ga0501073_0006815 | Ga0501073_0006815_4766_5341 | 186 |
| 384 | 3300049589 | Ga0501073_0042090 | Ga0501073_0042090_691_1266 | 186 |
| 385 | 3300049590 | Ga0501074_0007789 | Ga0501074_0007789_3154_3729 | 186 |
| 386 | 3300049590 | Ga0501074_0020875 | Ga0501074_0020875_3178_3753 | 186 |
| 387 | 3300049593 | Ga0501077_0036670 | Ga0501077_0036670_2248_2823 | 186 |
| 388 | 3300049593 | Ga0501077_0146406 | Ga0501077_0146406_264_839 | 186 |
| 389 | 3300049741 | Ga0501079_0011457 | Ga0501079_0011457_3602_4177 | 186 |
| 390 | 3300049741 | Ga0501079_0205934 | Ga0501079_0205934_877_1452 | 186 |
| 391 | 3300049742 | Ga0501080_0025987 | Ga0501080_0025987_2739_3314 | 186 |
| 392 | 3300049742 | Ga0501080_0054792 | Ga0501080_0054792_352_927 | 186 |
| 393 | 3300049744 | Ga0501083_0012888 | Ga0501083_0012888_1971_2546 | 186 |
| 394 | 3300049744 | Ga0501083_0169964 | Ga0501083_0169964_341_916 | 186 |
| 395 | 3300049823 | Ga0501044_0499505 | Ga0501044_0499505_175_750 | 186 |
| 396 | 3300053140 | Ga0500573_0240167 | Ga0500573_0240167_266_838 | 186 |
| 397 | 3300054114 | Ga0501084_0034543 | Ga0501084_0034543_2579_3154 | 186 |
| 398 | 3300054114 | Ga0501084_0046597 | Ga0501084_0046597_1938_2513 | 186 |
| 399 | 3300060353 | Ga0501082_0043978 | Ga0501082_0043978_2220_2795 | 186 |
| 400 | 3300060353 | Ga0501082_0481827 | Ga0501082_0481827_428_1003 | 186 |
| 401 | 3300005436 | Ga0070713_100572420 | Ga0070713_1005724202 | 187 |
| 402 | 3300025928 | Ga0207700_10902657 | Ga0207700_109026571 | 187 |
| 403 | 3300046462 | Ga0495651_0101951 | Ga0495651_0101951_994_1569 | 187 |
| 404 | 3300046679 | Ga0495623_0360343 | Ga0495623_0360343_19_594 | 187 |
| 405 | 3300053077 | Ga0495601_0205890 | Ga0495601_0205890_420_995 | 187 |
| 406 | 3300053078 | Ga0495612_0005084 | Ga0495612_0005084_2021_2596 | 187 |
| 407 | 3300053085 | Ga0495619_0009810 | Ga0495619_0009810_3771_4346 | 187 |
| 408 | iso_pu_bacteria | 2773857762 | 2774393849 | 187 |
| 409 | iso_pu_bacteria | 2808606439 | 2809195278 | 187 |
| 410 | iso_pu_bacteria | 2811994878 | 2812350155 | 187 |
| 411 | iso_pu_bacteria | 2891968417 | 2891972224 | 187 |
| 412 | iso_pu_bacteria | 8054609563 | 8054610542 | 187 |
| 413 | 3300005468 | Ga0070707_100747715 | Ga0070707_1007477151 | 189 |
| 414 | 3300005471 | Ga0070698_100099122 | Ga0070698_1000991223 | 189 |
| 415 | 3300006038 | Ga0075365_10487753 | Ga0075365_104877532 | 190 |
| 416 | 3300048914 | Ga0496111_0782721 | Ga0496111_0782721_73_645 | 190 |
| 417 | 3300048917 | Ga0496114_1042899 | Ga0496114_1042899_32_604 | 190 |
| 418 | 3300000549 | LJQas_1003649 | LJQas_10036492 | 191 |
| 419 | 3300004803 | Ga0058862_12892104 | Ga0058862_128921042 | 191 |
| 420 | 3300005336 | Ga0070680_100230621 | Ga0070680_1002306212 | 191 |
| 421 | 3300005339 | Ga0070660_100078056 | Ga0070660_1000780562 | 191 |
| 422 | 3300005344 | Ga0070661_100105226 | Ga0070661_1001052263 | 191 |
| 423 | 3300005356 | Ga0070674_100547089 | Ga0070674_1005470892 | 191 |
| 424 | 3300005366 | Ga0070659_100862893 | Ga0070659_1008628931 | 191 |
| 425 | 3300005458 | Ga0070681_10443581 | Ga0070681_104435811 | 191 |
| 426 | 3300005530 | Ga0070679_100236659 | Ga0070679_1002366592 | 191 |
| 427 | 3300005535 | Ga0070684_100241877 | Ga0070684_1002418773 | 191 |
| 428 | 3300005564 | Ga0070664_100122123 | Ga0070664_1001221233 | 191 |
| 429 | 3300005577 | Ga0068857_100958894 | Ga0068857_1009588942 | 191 |
| 430 | 3300005616 | Ga0068852_100859276 | Ga0068852_1008592762 | 191 |
| 431 | 3300005719 | Ga0068861_100614098 | Ga0068861_1006140981 | 191 |
| 432 | 3300006038 | Ga0075365_10025619 | Ga0075365_100256192 | 191 |
| 433 | 3300006038 | Ga0075365_10462154 | Ga0075365_104621542 | 191 |
| 434 | 3300006042 | Ga0075368_10035503 | Ga0075368_100355032 | 191 |
| 435 | 3300006048 | Ga0075363_100007205 | Ga0075363_1000072055 | 191 |
| 436 | 3300006048 | Ga0075363_100217299 | Ga0075363_1002172992 | 191 |
| 437 | 3300006051 | Ga0075364_10002837 | Ga0075364_1000283710 | 191 |
| 438 | 3300006051 | Ga0075364_10147829 | Ga0075364_101478292 | 191 |
| 439 | 3300006178 | Ga0075367_10075144 | Ga0075367_100751442 | 191 |
| 440 | 3300006844 | Ga0075428_100179639 | Ga0075428_1001796392 | 191 |
| 441 | 3300006847 | Ga0075431_100011593 | Ga0075431_1000115936 | 191 |
| 442 | 3300006880 | Ga0075429_100008808 | Ga0075429_1000088087 | 191 |
| 443 | 3300009176 | Ga0105242_10126874 | Ga0105242_101268742 | 191 |
| 444 | 3300009545 | Ga0105237_11253721 | Ga0105237_112537212 | 191 |
| 445 | 3300010375 | Ga0105239_10454204 | Ga0105239_104542042 | 191 |
| 446 | 3300011119 | Ga0105246_10100493 | Ga0105246_101004934 | 191 |
| 447 | 3300013307 | Ga0157372_10406357 | Ga0157372_104063572 | 191 |
| 448 | 3300013308 | Ga0157375_10286940 | Ga0157375_102869402 | 191 |
| 449 | 3300014325 | Ga0163163_10082838 | Ga0163163_100828385 | 191 |
| 450 | 3300014325 | Ga0163163_11732226 | Ga0163163_117322261 | 191 |
| 451 | 3300014326 | Ga0157380_10618189 | Ga0157380_106181892 | 191 |
| 452 | 3300014326 | Ga0157380_11269706 | Ga0157380_112697062 | 191 |
| 453 | 3300017792 | Ga0163161_10021053 | Ga0163161_100210536 | 191 |
| 454 | 3300017792 | Ga0163161_10022665 | Ga0163161_100226653 | 191 |
| 455 | 3300020070 | Ga0206356_11719020 | Ga0206356_117190201 | 191 |
| 456 | 3300020082 | Ga0206353_11128717 | Ga0206353_111287172 | 191 |
| 457 | 3300022467 | Ga0224712_10259083 | Ga0224712_102590831 | 191 |
| 458 | 3300025901 | Ga0207688_10034915 | Ga0207688_100349154 | 191 |
| 459 | 3300025919 | Ga0207657_10083761 | Ga0207657_100837612 | 191 |
| 460 | 3300025919 | Ga0207657_10380923 | Ga0207657_103809231 | 191 |
| 461 | 3300025920 | Ga0207649_10312773 | Ga0207649_103127732 | 191 |
| 462 | 3300025921 | Ga0207652_10409740 | Ga0207652_104097402 | 191 |
| 463 | 3300025921 | Ga0207652_11187171 | Ga0207652_111871711 | 191 |
| 464 | 3300025933 | Ga0207706_10352982 | Ga0207706_103529822 | 191 |
| 465 | 3300025933 | Ga0207706_11022053 | Ga0207706_110220531 | 191 |
| 466 | 3300025935 | Ga0207709_10216266 | Ga0207709_102162662 | 191 |
| 467 | 3300025935 | Ga0207709_10526120 | Ga0207709_105261202 | 191 |
| 468 | 3300025937 | Ga0207669_10258388 | Ga0207669_102583882 | 191 |
| 469 | 3300025945 | Ga0207679_10015073 | Ga0207679_100150735 | 191 |
| 470 | 3300026067 | Ga0207678_10434158 | Ga0207678_104341582 | 191 |
| 471 | 3300026116 | Ga0207674_10665394 | Ga0207674_106653942 | 191 |
| 472 | 3300027907 | Ga0207428_10001546 | Ga0207428_1000154621 | 191 |
| 473 | 3300031691 | Ga0316579_10006137 | Ga0316579_100061376 | 191 |
| 474 | 3300031824 | Ga0307413_10914423 | Ga0307413_109144231 | 191 |
| 475 | 3300031852 | Ga0307410_10904420 | Ga0307410_109044201 | 191 |
| 476 | 3300031901 | Ga0307406_10238420 | Ga0307406_102384202 | 191 |
| 477 | 3300031995 | Ga0307409_100348203 | Ga0307409_1003482032 | 191 |
| 478 | 3300032002 | Ga0307416_100601896 | Ga0307416_1006018963 | 191 |
| 479 | 3300032002 | Ga0307416_101802163 | Ga0307416_1018021631 | 191 |
| 480 | 3300032004 | Ga0307414_10403703 | Ga0307414_104037032 | 191 |
| 481 | 3300032126 | Ga0307415_100395730 | Ga0307415_1003957302 | 191 |
| 482 | 3300032133 | Ga0316583_10135817 | Ga0316583_101358171 | 191 |
| 483 | 3300041405 | Ga0439438_022198 | Ga0439438_022198_48_623 | 191 |
| 484 | 3300041407 | Ga0439447_017678 | Ga0439447_017678_1088_1663 | 191 |
| 485 | 3300041453 | Ga0451797_0236862 | Ga0451797_0236862_115_690 | 191 |
| 486 | 3300041505 | Ga0451849_1028718 | Ga0451849_1028718_78_653 | 191 |
| 487 | 3300041512 | Ga0451853_2720754 | Ga0451853_2720754_247_822 | 191 |
| 488 | 3300042157 | Ga0439458_0076277 | Ga0439458_0076277_88_663 | 191 |
| 489 | 3300042435 | Ga0439434_0003237 | Ga0439434_0003237_1843_2418 | 191 |
| 490 | 3300042439 | Ga0439464_0011028 | Ga0439464_0011028_1707_2282 | 191 |
| 491 | 3300044658 | Ga0466972_0187581 | Ga0466972_0187581_334_909 | 191 |
| 492 | 3300044658 | Ga0466972_0256819 | Ga0466972_0256819_23_598 | 191 |
| 493 | 3300044683 | Ga0466965_0039562 | Ga0466965_0039562_687_1262 | 191 |
| 494 | 3300044683 | Ga0466965_0054818 | Ga0466965_0054818_904_1479 | 191 |
| 495 | 3300044683 | Ga0466965_0102466 | Ga0466965_0102466_441_1016 | 191 |
| 496 | 3300044683 | Ga0466965_0144996 | Ga0466965_0144996_14_589 | 191 |
| 497 | 3300044683 | Ga0466965_0256842 | Ga0466965_0256842_297_872 | 191 |
| 498 | 3300044693 | Ga0466961_0429699 | Ga0466961_0429699_82_657 | 191 |
| 499 | 3300044693 | Ga0466961_0498613 | Ga0466961_0498613_21_596 | 191 |
| 500 | 3300044694 | Ga0466963_0084625 | Ga0466963_0084625_1373_1948 | 191 |
| 501 | 3300044694 | Ga0466963_0119599 | Ga0466963_0119599_1035_1610 | 191 |
| 502 | 3300044694 | Ga0466963_0202338 | Ga0466963_0202338_99_674 | 191 |
| 503 | 3300044694 | Ga0466963_0307899 | Ga0466963_0307899_401_982 | 191 |
| 504 | 3300044694 | Ga0466963_0368125 | Ga0466963_0368125_318_893 | 191 |
| 505 | 3300044706 | Ga0466964_0022138 | Ga0466964_0022138_1524_2099 | 191 |
| 506 | 3300044706 | Ga0466964_0028561 | Ga0466964_0028561_141_716 | 191 |
| 507 | 3300044719 | Ga0466971_0032472 | Ga0466971_0032472_813_1388 | 191 |
| 508 | 3300044719 | Ga0466971_0039677 | Ga0466971_0039677_1283_1858 | 191 |
| 509 | 3300044719 | Ga0466971_0048629 | Ga0466971_0048629_378_953 | 191 |
| 510 | 3300044735 | Ga0466968_0204270 | Ga0466968_0204270_206_781 | 191 |
| 511 | 3300044765 | Ga0466970_0057386 | Ga0466970_0057386_1138_1713 | 191 |
| 512 | 3300044765 | Ga0466970_0067637 | Ga0466970_0067637_1235_1810 | 191 |
| 513 | 3300044765 | Ga0466970_0067946 | Ga0466970_0067946_1208_1783 | 191 |
| 514 | 3300044765 | Ga0466970_0080344 | Ga0466970_0080344_1095_1670 | 191 |
| 515 | 3300044765 | Ga0466970_0082680 | Ga0466970_0082680_1064_1639 | 191 |
| 516 | 3300044765 | Ga0466970_0103656 | Ga0466970_0103656_244_819 | 191 |
| 517 | 3300044765 | Ga0466970_0109523 | Ga0466970_0109523_760_1335 | 191 |
| 518 | 3300044765 | Ga0466970_0109873 | Ga0466970_0109873_626_1201 | 191 |
| 519 | 3300044765 | Ga0466970_0422935 | Ga0466970_0422935_44_622 | 191 |
| 520 | 3300044765 | Ga0466970_0482175 | Ga0466970_0482175_52_675 | 191 |
| 521 | 3300044842 | Ga0466957_0004995 | Ga0466957_0004995_3056_3631 | 191 |
| 522 | 3300044842 | Ga0466957_0094486 | Ga0466957_0094486_866_1441 | 191 |
| 523 | 3300044842 | Ga0466957_0108701 | Ga0466957_0108701_670_1245 | 191 |
| 524 | 3300044842 | Ga0466957_0112490 | Ga0466957_0112490_542_1117 | 191 |
| 525 | 3300044901 | Ga0466960_0011351 | Ga0466960_0011351_1863_2438 | 191 |
| 526 | 3300044901 | Ga0466960_0047673 | Ga0466960_0047673_174_749 | 191 |
| 527 | 3300044901 | Ga0466960_0059583 | Ga0466960_0059583_430_1005 | 191 |
| 528 | 3300044901 | Ga0466960_0099625 | Ga0466960_0099625_146_721 | 191 |
| 529 | 3300044901 | Ga0466960_0185414 | Ga0466960_0185414_119_694 | 191 |
| 530 | 3300044901 | Ga0466960_0286082 | Ga0466960_0286082_301_879 | 191 |
| 531 | 3300044901 | Ga0466960_0315249 | Ga0466960_0315249_223_798 | 191 |
| 532 | 3300045049 | Ga0466959_0308486 | Ga0466959_0308486_195_770 | 191 |
| 533 | 3300045049 | Ga0466959_0592106 | Ga0466959_0592106_53_628 | 191 |
| 534 | 3300045836 | Ga0466958_0036794 | Ga0466958_0036794_111_686 | 191 |
| 535 | 3300045836 | Ga0466958_0267605 | Ga0466958_0267605_43_618 | 191 |
| 536 | 3300045976 | Ga0466967_0018913 | Ga0466967_0018913_238_813 | 191 |
| 537 | 3300045976 | Ga0466967_0036682 | Ga0466967_0036682_18_593 | 191 |
| 538 | 3300045976 | Ga0466967_0073143 | Ga0466967_0073143_689_1264 | 191 |
| 539 | 3300045976 | Ga0466967_0286121 | Ga0466967_0286121_120_695 | 191 |
| 540 | 3300045976 | Ga0466967_1018091 | Ga0466967_1018091_186_764 | 191 |
| 541 | 3300045976 | Ga0466967_1487215 | Ga0466967_1487215_58_633 | 191 |
| 542 | 3300046529 | Ga0495652_0706550 | Ga0495652_0706550_80_655 | 191 |
| 543 | 3300046675 | Ga0495657_0236767 | Ga0495657_0236767_517_1092 | 191 |
| 544 | 3300046809 | Ga0495600_0542599 | Ga0495600_0542599_18_593 | 191 |
| 545 | 3300047322 | Ga0495680_0397094 | Ga0495680_0397094_73_648 | 191 |
| 546 | 3300048903 | Ga0496100_0437049 | Ga0496100_0437049_282_857 | 191 |
| 547 | 3300048904 | Ga0496101_0009555 | Ga0496101_0009555_5247_5822 | 191 |
| 548 | 3300048905 | Ga0496102_0013615 | Ga0496102_0013615_4494_5069 | 191 |
| 549 | 3300048907 | Ga0496104_0112805 | Ga0496104_0112805_1202_1777 | 191 |
| 550 | 3300048908 | Ga0496105_0065910 | Ga0496105_0065910_881_1456 | 191 |
| 551 | 3300048908 | Ga0496105_0080110 | Ga0496105_0080110_106_681 | 191 |
| 552 | 3300048909 | Ga0496106_0075174 | Ga0496106_0075174_166_741 | 191 |
| 553 | 3300048912 | Ga0496109_0455677 | Ga0496109_0455677_78_653 | 191 |
| 554 | 3300048912 | Ga0496109_0494959 | Ga0496109_0494959_378_953 | 191 |
| 555 | 3300048913 | Ga0496110_0823482 | Ga0496110_0823482_98_673 | 191 |
| 556 | 3300048914 | Ga0496111_0132118 | Ga0496111_0132118_938_1513 | 191 |
| 557 | 3300048914 | Ga0496111_0155293 | Ga0496111_0155293_1052_1627 | 191 |
| 558 | 3300048916 | Ga0496113_0391331 | Ga0496113_0391331_200_775 | 191 |
| 559 | 3300048917 | Ga0496114_0011584 | Ga0496114_0011584_1033_1608 | 191 |
| 560 | 3300048917 | Ga0496114_0079688 | Ga0496114_0079688_1243_1818 | 191 |
| 561 | 3300048918 | Ga0496115_0733321 | Ga0496115_0733321_107_703 | 191 |
| 562 | 3300049568 | Ga0501031_0008197 | Ga0501031_0008197_4506_5081 | 191 |
| 563 | 3300049568 | Ga0501031_0053932 | Ga0501031_0053932_1123_1698 | 191 |
| 564 | 3300049568 | Ga0501031_0063395 | Ga0501031_0063395_1157_1732 | 191 |
| 565 | 3300049568 | Ga0501031_0227359 | Ga0501031_0227359_624_1199 | 191 |
| 566 | 3300049568 | Ga0501031_0519253 | Ga0501031_0519253_37_612 | 191 |
| 567 | 3300049569 | Ga0501032_0017653 | Ga0501032_0017653_2718_3293 | 191 |
| 568 | 3300049569 | Ga0501032_0092388 | Ga0501032_0092388_461_1036 | 191 |
| 569 | 3300049570 | Ga0501033_0004737 | Ga0501033_0004737_6209_6784 | 191 |
| 570 | 3300049570 | Ga0501033_0098023 | Ga0501033_0098023_832_1407 | 191 |
| 571 | 3300049572 | Ga0501036_0005938 | Ga0501036_0005938_1557_2132 | 191 |
| 572 | 3300049572 | Ga0501036_0027654 | Ga0501036_0027654_2658_3233 | 191 |
| 573 | 3300049572 | Ga0501036_0102797 | Ga0501036_0102797_55_630 | 191 |
| 574 | 3300049573 | Ga0501037_0020944 | Ga0501037_0020944_3108_3683 | 191 |
| 575 | 3300049573 | Ga0501037_0037013 | Ga0501037_0037013_1701_2276 | 191 |
| 576 | 3300049574 | Ga0501038_0095359 | Ga0501038_0095359_1096_1671 | 191 |
| 577 | 3300049575 | Ga0501039_0074437 | Ga0501039_0074437_528_1103 | 191 |
| 578 | 3300049575 | Ga0501039_0110161 | Ga0501039_0110161_375_950 | 191 |
| 579 | 3300049575 | Ga0501039_0548076 | Ga0501039_0548076_39_614 | 191 |
| 580 | 3300049576 | Ga0501040_0010997 | Ga0501040_0010997_4193_4768 | 191 |
| 581 | 3300049576 | Ga0501040_0250104 | Ga0501040_0250104_371_946 | 191 |
| 582 | 3300049576 | Ga0501040_0279249 | Ga0501040_0279249_524_1099 | 191 |
| 583 | 3300049577 | Ga0501041_0137712 | Ga0501041_0137712_388_963 | 191 |
| 584 | 3300049577 | Ga0501041_0220817 | Ga0501041_0220817_406_981 | 191 |
| 585 | 3300049578 | Ga0501042_0074609 | Ga0501042_0074609_733_1308 | 191 |
| 586 | 3300049578 | Ga0501042_0769405 | Ga0501042_0769405_53_628 | 191 |
| 587 | 3300049579 | Ga0501043_0011528 | Ga0501043_0011528_6131_6706 | 191 |
| 588 | 3300049579 | Ga0501043_0759064 | Ga0501043_0759064_57_632 | 191 |
| 589 | 3300049580 | Ga0501046_0000837 | Ga0501046_0000837_7873_8448 | 191 |
| 590 | 3300049580 | Ga0501046_0005031 | Ga0501046_0005031_7058_7633 | 191 |
| 591 | 3300049580 | Ga0501046_0233695 | Ga0501046_0233695_389_964 | 191 |
| 592 | 3300049581 | Ga0501047_0398366 | Ga0501047_0398366_30_605 | 191 |
| 593 | 3300049581 | Ga0501047_0764834 | Ga0501047_0764834_177_752 | 191 |
| 594 | 3300049582 | Ga0501048_0025882 | Ga0501048_0025882_1113_1688 | 191 |
| 595 | 3300049582 | Ga0501048_0073647 | Ga0501048_0073647_53_628 | 191 |
| 596 | 3300049582 | Ga0501048_0546184 | Ga0501048_0546184_68_643 | 191 |
| 597 | 3300049584 | Ga0501068_0088105 | Ga0501068_0088105_813_1388 | 191 |
| 598 | 3300049584 | Ga0501068_0162697 | Ga0501068_0162697_308_883 | 191 |
| 599 | 3300049584 | Ga0501068_0325974 | Ga0501068_0325974_41_616 | 191 |
| 600 | 3300049585 | Ga0501069_0042144 | Ga0501069_0042144_269_844 | 191 |
| 601 | 3300049585 | Ga0501069_0096134 | Ga0501069_0096134_1059_1643 | 191 |
| 602 | 3300049586 | Ga0501070_0006214 | Ga0501070_0006214_8491_9066 | 191 |
| 603 | 3300049586 | Ga0501070_0006679 | Ga0501070_0006679_8577_9152 | 191 |
| 604 | 3300049586 | Ga0501070_0308986 | Ga0501070_0308986_237_812 | 191 |
| 605 | 3300049586 | Ga0501070_0566084 | Ga0501070_0566084_280_855 | 191 |
| 606 | 3300049586 | Ga0501070_0704071 | Ga0501070_0704071_179_754 | 191 |
| 607 | 3300049586 | Ga0501070_0981438 | Ga0501070_0981438_53_628 | 191 |
| 608 | 3300049587 | Ga0501071_0002975 | Ga0501071_0002975_1003_1578 | 191 |
| 609 | 3300049588 | Ga0501072_0083824 | Ga0501072_0083824_827_1402 | 191 |
| 610 | 3300049589 | Ga0501073_0104619 | Ga0501073_0104619_1144_1719 | 191 |
| 611 | 3300049590 | Ga0501074_0022682 | Ga0501074_0022682_2871_3446 | 191 |
| 612 | 3300049590 | Ga0501074_0124770 | Ga0501074_0124770_178_753 | 191 |
| 613 | 3300049591 | Ga0501075_0126956 | Ga0501075_0126956_595_1170 | 191 |
| 614 | 3300049591 | Ga0501075_0559867 | Ga0501075_0559867_183_758 | 191 |
| 615 | 3300049592 | Ga0501076_0011109 | Ga0501076_0011109_1070_1645 | 191 |
| 616 | 3300049593 | Ga0501077_0645909 | Ga0501077_0645909_27_602 | 191 |
| 617 | 3300049741 | Ga0501079_0124946 | Ga0501079_0124946_1089_1664 | 191 |
| 618 | 3300049742 | Ga0501080_0231368 | Ga0501080_0231368_853_1428 | 191 |
| 619 | 3300049742 | Ga0501080_0536291 | Ga0501080_0536291_114_689 | 191 |
| 620 | 3300049743 | Ga0501081_0252683 | Ga0501081_0252683_341_916 | 191 |
| 621 | 3300049744 | Ga0501083_0189244 | Ga0501083_0189244_424_999 | 191 |
| 622 | 3300049822 | Ga0501035_0583128 | Ga0501035_0583128_294_869 | 191 |
| 623 | 3300049823 | Ga0501044_0075942 | Ga0501044_0075942_2154_2729 | 191 |
| 624 | 3300049823 | Ga0501044_0196047 | Ga0501044_0196047_1136_1711 | 191 |
| 625 | 3300049824 | Ga0501045_0105210 | Ga0501045_0105210_400_975 | 191 |
| 626 | 3300049824 | Ga0501045_0158404 | Ga0501045_0158404_633_1208 | 191 |
| 627 | 3300049824 | Ga0501045_0537606 | Ga0501045_0537606_81_656 | 191 |
| 628 | 3300050490 | nmdc:mga03n38_12316_c1 | nmdc:mga03n38_12316_c1_1967_2548 | 191 |
| 629 | 3300050491 | nmdc:mga00v17_15065_c1 | nmdc:mga00v17_15065_c1_1584_2165 | 191 |
| 630 | 3300050491 | nmdc:mga00v17_164083_c1 | nmdc:mga00v17_164083_c1_648_1223 | 191 |
| 631 | 3300050491 | nmdc:mga00v17_97985_c1 | nmdc:mga00v17_97985_c1_611_1195 | 191 |
| 632 | 3300050492 | nmdc:mga0yw44_123912_c1 | nmdc:mga0yw44_123912_c1_758_1333 | 191 |
| 633 | 3300050492 | nmdc:mga0yw44_34567_c1 | nmdc:mga0yw44_34567_c1_2198_2773 | 191 |
| 634 | 3300050492 | nmdc:mga0yw44_473171_c1 | nmdc:mga0yw44_473171_c1_193_777 | 191 |
| 635 | 3300050494 | nmdc:mga06z11_27408_c1 | nmdc:mga06z11_27408_c1_1516_2097 | 191 |
| 636 | 3300050496 | nmdc:mga07m45_2428_c1 | nmdc:mga07m45_2428_c1_814_1395 | 191 |
| 637 | 3300053083 | Ga0495655_0101016 | Ga0495655_0101016_264_839 | 191 |
| 638 | 3300053084 | Ga0495595_0369619 | Ga0495595_0369619_61_648 | 191 |
| 639 | 3300053088 | Ga0500644_0000050 | Ga0500644_0000050_46234_46809 | 191 |
| 640 | 3300053096 | Ga0500641_0040656 | Ga0500641_0040656_69_653 | 191 |
| 641 | 3300053104 | Ga0500556_0000726 | Ga0500556_0000726_11095_11691 | 191 |
| 642 | 3300053117 | Ga0500593_000179 | Ga0500593_000179_7276_7872 | 191 |
| 643 | 3300053139 | Ga0500568_0233386 | Ga0500568_0233386_50_646 | 191 |
| 644 | 3300053140 | Ga0500573_0148649 | Ga0500573_0148649_599_1174 | 191 |
| 645 | 3300054114 | Ga0501084_0047926 | Ga0501084_0047926_1126_1701 | 191 |
| 646 | 3300054114 | Ga0501084_1090111 | Ga0501084_1090111_44_619 | 191 |
| 647 | 3300060353 | Ga0501082_0971994 | Ga0501082_0971994_43_618 | 191 |
| 648 | 3300061719 | Ga0466962_0008596 | Ga0466962_0008596_277_852 | 191 |
| 649 | 3300061719 | Ga0466962_0077845 | Ga0466962_0077845_92_667 | 191 |
| 650 | 3300061734 | Ga0530510_0159371 | Ga0530510_0159371_382_957 | 191 |
| 651 | 3300061734 | Ga0530510_0354933 | Ga0530510_0354933_18_593 | 191 |
| 652 | 3300061734 | Ga0530510_0798358 | Ga0530510_0798358_94_669 | 191 |
| 653 | iso_pu_bacteria | 2643221615 | 2644091754 | 191 |
| 654 | iso_pu_bacteria | 2643221657 | 2644321557 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pl1-assembly1.cif.gz_A | determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. | 0.9868 | 3 | 191 |
| 3pl1-assembly1.cif.gz_A | determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. | 0.9658 | 3 | 191 |
| 1im5-assembly1.cif.gz_A | crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc | 0.8874 | 1 | 191 |
| 3r2j-assembly2.cif.gz_C | crystal structure of pnc1 from l. infantum in complex with nicotinate | 0.8801 | 2 | 191 |
| 1im5-assembly1.cif.gz_A | crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc | 0.8733 | 1 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pl1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9868 | 3 | 191 | 3.40.50.850 |
| 3pl1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9658 | 3 | 191 | 3.40.50.850 |
| 1im5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8875 | 1 | 191 | 3.40.50.850 |
| 1im5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8733 | 1 | 191 | 3.40.50.850 |
| 3r2jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8723 | 2 | 191 | 3.40.50.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536IXX4-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.9951 | 98 | 190 |
GO:0016787
GO:0019363 GO:0046872 |
| AF-K0EP89-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.9924 | 2 | 190 |
GO:0016787
GO:0019363 GO:0046872 |
| AF-A0A561SMJ7-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.9905 | 3 | 191 |
GO:0016787
GO:0019363 GO:0046872 |
| AF-A0A2U8U8I1-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.9897 | 2 | 190 |
GO:0016787
GO:0019363 GO:0046872 |
| AF-A0A6G9Y899-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.9897 | 1 | 190 |
GO:0016787
GO:0019363 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar