F472748

General Info

Members Datasets Scaffolds Average Seq Length
653 257 1306 115

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100619539|Ga0068860_1006195392
Length 145
Sequence VGGRPRDIDRRGGLTTNAATPRMTRRLDLMAVDDVPEGTMKMAWVDGADQVVVVQANGVIRAFQGICTHEYFELDKGFLTGGGSPGPDGKPAGTLTCALHLSRFDLATGDALDPPAEEPLVQYPVVVENGRVFIDVPDGPLPVNQ

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
189 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 10.57
Rhizosphere 88.67
Stem 0
Stem Tuber 0
Unclassified 26.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100619539 3300005843 Bacteria 1089
2 Ga0070683_100505281 3300005329 Bacteria 1155
3 Ga0070683_101442409 3300005329 Bacteria 662
4 Ga0070670_100320263 3300005331 Unclassified 1358
5 Ga0070670_100606949 3300005331 Bacteria 980
6 Ga0070670_100922245 3300005331 Bacteria 792
7 Ga0068869_100043792 3300005334 Bacteria 3217
8 Ga0068869_101462437 3300005334 Bacteria 606
9 Ga0070666_10644680 3300005335 Bacteria 774
10 Ga0070666_11060506 3300005335 Bacteria 602
11 Ga0070680_100161069 3300005336 Bacteria 1886
12 Ga0070680_101358527 3300005336 Bacteria 615
13 Ga0068868_100286013 3300005338 Bacteria 1397
14 Ga0068868_100374536 3300005338 Bacteria 1224
15 Ga0068868_100616514 3300005338 Unclassified 963
16 Ga0070660_100274138 3300005339 Unclassified 1379
17 Ga0070660_101065520 3300005339 Bacteria 684
18 Ga0070660_101230437 3300005339 Unclassified 635
19 Ga0070689_100107445 3300005340 Bacteria 2215
20 Ga0070691_10052511 3300005341 Bacteria 1949
21 Ga0070691_10125734 3300005341 Bacteria 1295
22 Ga0070691_10431500 3300005341 Bacteria 749
23 Ga0070687_100041697 3300005343 Unclassified 2321
24 Ga0070661_101622847 3300005344 Bacteria 547
25 Ga0070692_10006117 3300005345 Bacteria 5201
26 Ga0070669_100292474 3300005353 Bacteria 1308
27 Ga0070669_101002809 3300005353 Unclassified 716
28 Ga0070669_101232094 3300005353 Unclassified 647
29 Ga0070675_100179910 3300005354 Unclassified 1828
30 Ga0070671_100771563 3300005355 Bacteria 836
31 Ga0070671_101546096 3300005355 Bacteria 587
32 Ga0070674_100037756 3300005356 Bacteria 3251
33 Ga0070674_100819851 3300005356 Bacteria 805
34 Ga0070674_100853647 3300005356 Unclassified 790
35 Ga0070674_101423472 3300005356 Unclassified 621
36 Ga0070674_101907920 3300005356 Bacteria 540
37 Ga0070673_100775818 3300005364 Unclassified 884
38 Ga0070673_101304746 3300005364 Bacteria 682
39 Ga0070688_100106278 3300005365 Unclassified 1859
40 Ga0070659_100031230 3300005366 Bacteria 4125
41 Ga0070659_100558243 3300005366 Bacteria 981
42 Ga0070659_102100572 3300005366 Unclassified 508
43 Ga0070667_100387094 3300005367 Unclassified 1271
44 Ga0070667_100581575 3300005367 Bacteria 1031
45 Ga0070703_10037953 3300005406 Bacteria 1487
46 Ga0070703_10362362 3300005406 Bacteria 622
47 Ga0070703_10417361 3300005406 Bacteria 588
48 Ga0070710_10138686 3300005437 Unclassified 1489
49 Ga0070701_10014631 3300005438 Bacteria 3602
50 Ga0070701_10233854 3300005438 Bacteria 1102
51 Ga0070711_100473918 3300005439 Bacteria 1028
52 Ga0070705_100132327 3300005440 Bacteria 1629
53 Ga0070705_100387612 3300005440 Bacteria 1030
54 Ga0070705_100418439 3300005440 Bacteria 997
55 Ga0070705_100454718 3300005440 Bacteria 961
56 Ga0070705_101405075 3300005440 Bacteria 582
57 Ga0070705_101585758 3300005440 Unclassified 550
58 Ga0070700_100074925 3300005441 Bacteria 2170
59 Ga0070700_100233239 3300005441 Bacteria 1311
60 Ga0070694_100060992 3300005444 Bacteria 2573
61 Ga0070694_100183318 3300005444 Bacteria 1550
62 Ga0070694_100492137 3300005444 Bacteria 974
63 Ga0070694_100860014 3300005444 Bacteria 747
64 Ga0070694_101397391 3300005444 Bacteria 590
65 Ga0070708_100010779 3300005445 Bacteria 7421
66 Ga0070708_100027341 3300005445 Bacteria 4894
67 Ga0070708_100046223 3300005445 Bacteria 3841
68 Ga0070708_100125385 3300005445 Unclassified 2373
69 Ga0070708_100165496 3300005445 Bacteria 2062
70 Ga0070708_100812773 3300005445 Unclassified 879
71 Ga0070663_101070661 3300005455 Bacteria 704
72 Ga0070678_100009810 3300005456 Bacteria 5821
73 Ga0070678_100038532 3300005456 Bacteria 3366
74 Ga0070662_100064412 3300005457 Bacteria 2684
75 Ga0070662_100100781 3300005457 Bacteria 2185
76 Ga0070662_100236017 3300005457 Bacteria 1465
77 Ga0070681_10187146 3300005458 Bacteria 1991
78 Ga0070681_10375566 3300005458 Bacteria 1332
79 Ga0070681_11576464 3300005458 Bacteria 582
80 Ga0068867_100222609 3300005459 Unclassified 1521
81 Ga0068867_100880992 3300005459 Bacteria 804
82 Ga0068867_101589403 3300005459 Unclassified 611
83 Ga0070685_10174731 3300005466 Unclassified 1379
84 Ga0070685_10452453 3300005466 Bacteria 900
85 Ga0070706_100001875 3300005467 Bacteria 21714
86 Ga0070706_100089589 3300005467 Bacteria 2853
87 Ga0070706_100139337 3300005467 Unclassified 2264
88 Ga0070706_100442709 3300005467 Bacteria 1209
89 Ga0070706_100487605 3300005467 Bacteria 1147
90 Ga0070706_100886232 3300005467 Bacteria 824
91 Ga0070706_101232312 3300005467 Bacteria 687
92 Ga0070706_101276489 3300005467 Bacteria 674
93 Ga0070707_100003529 3300005468 Bacteria 14761
94 Ga0070707_100013306 3300005468 Bacteria 7697
95 Ga0070707_100090533 3300005468 Bacteria 2961
96 Ga0070707_100143169 3300005468 Bacteria 2327
97 Ga0070707_100169235 3300005468 Bacteria 2129
98 Ga0070707_100181805 3300005468 Bacteria 2050
99 Ga0070707_100196319 3300005468 Bacteria 1967
100 Ga0070707_100743966 3300005468 Bacteria 944
101 Ga0070707_100855068 3300005468 Bacteria 874
102 Ga0070707_100867779 3300005468 Unclassified 867
103 Ga0070707_101378512 3300005468 Bacteria 671
104 Ga0070698_100016117 3300005471 Bacteria 7891
105 Ga0070698_100027926 3300005471 Bacteria 5862
106 Ga0070698_100127860 3300005471 Bacteria 2498
107 Ga0070698_100214276 3300005471 Bacteria 1860
108 Ga0070698_100424034 3300005471 Bacteria 1265
109 Ga0070698_100492895 3300005471 Bacteria 1163
110 Ga0070698_100493153 3300005471 Bacteria 1162
111 Ga0070698_100525299 3300005471 Bacteria 1122
112 Ga0070698_100624391 3300005471 Bacteria 1018
113 Ga0070698_101588677 3300005471 Bacteria 606
114 Ga0070699_100003054 3300005518 Bacteria 14853
115 Ga0070699_100026683 3300005518 Bacteria 4983
116 Ga0070699_100035114 3300005518 Bacteria 4333
117 Ga0070699_100348908 3300005518 Archaea 1333
118 Ga0070699_100632260 3300005518 Unclassified 977
119 Ga0070699_100925320 3300005518 Bacteria 799
120 Ga0070679_100084467 3300005530 Bacteria 3163
121 Ga0070679_101369013 3300005530 Bacteria 654
122 Ga0070684_100051863 3300005535 Bacteria 3565
123 Ga0070684_100092621 3300005535 Bacteria 2689
124 Ga0070684_100170586 3300005535 Bacteria 1976
125 Ga0070684_100570382 3300005535 Bacteria 1051
126 Ga0070684_100648325 3300005535 Bacteria 983
127 Ga0070697_100033322 3300005536 Bacteria 4148
128 Ga0070697_100038038 3300005536 Bacteria 3886
129 Ga0070697_100398817 3300005536 Bacteria 1193
130 Ga0070697_100507758 3300005536 Bacteria 1055
131 Ga0068853_101889040 3300005539 Bacteria 579
132 Ga0070672_100188354 3300005543 Unclassified 1722
133 Ga0070686_100107377 3300005544 Unclassified 1896
134 Ga0070686_100220742 3300005544 Bacteria 1370
135 Ga0070686_101436660 3300005544 Bacteria 580
136 Ga0070695_100053457 3300005545 Bacteria 2597
137 Ga0070695_100058972 3300005545 Bacteria 2484
138 Ga0070695_100373835 3300005545 Bacteria 1074
139 Ga0070695_100642937 3300005545 Bacteria 837
140 Ga0070696_100006337 3300005546 Bacteria 7921
141 Ga0070696_100029969 3300005546 Bacteria 3722
142 Ga0070696_100986331 3300005546 Bacteria 703
143 Ga0070693_100010011 3300005547 Bacteria 4732
144 Ga0070693_100094024 3300005547 Unclassified 1813
145 Ga0070665_100795791 3300005548 Bacteria 959
146 Ga0070665_101650220 3300005548 Unclassified 649
147 Ga0070704_100096956 3300005549 Bacteria 2212
148 Ga0070704_100120095 3300005549 Bacteria 2017
149 Ga0070704_100972707 3300005549 Bacteria 766
150 Ga0068855_100480361 3300005563 Unclassified 1353
151 Ga0070664_101076592 3300005564 Bacteria 757
152 Ga0070664_101404464 3300005564 Bacteria 660
153 Ga0070664_101642140 3300005564 Unclassified 609
154 Ga0068857_100181633 3300005577 Bacteria 1915
155 Ga0068854_100303909 3300005578 Unclassified 1291
156 Ga0068854_100785757 3300005578 Bacteria 829
157 Ga0068854_101396994 3300005578 Bacteria 633
158 Ga0068854_101876129 3300005578 Unclassified 551
159 Ga0070702_100273461 3300005615 Bacteria 1156
160 Ga0070702_101698775 3300005615 Bacteria 525
161 Ga0068852_100317971 3300005616 Bacteria 1511
162 Ga0068852_102072299 3300005616 Bacteria 591
163 Ga0068864_100126539 3300005618 Bacteria 2290
164 Ga0068864_100375895 3300005618 Bacteria 1345
165 Ga0068864_100904005 3300005618 Unclassified 872
166 Ga0068864_102682986 3300005618 Bacteria 504
167 Ga0068866_10076292 3300005718 Unclassified 1787
168 Ga0068866_10214312 3300005718 Bacteria 1158
169 Ga0068861_100438417 3300005719 Unclassified 1168
170 Ga0068861_101861081 3300005719 Unclassified 598
171 Ga0068870_10258813 3300005840 Bacteria 1082
172 Ga0068870_10611778 3300005840 Unclassified 742
173 Ga0068870_10679907 3300005840 Bacteria 708
174 Ga0068863_100472865 3300005841 Unclassified 1232
175 Ga0068858_100115705 3300005842 Bacteria 2506
176 Ga0068858_100239426 3300005842 Bacteria 1722
177 Ga0068858_101041151 3300005842 Bacteria 803
178 Ga0068860_100126875 3300005843 Bacteria 2446
179 Ga0068860_100316626 3300005843 Bacteria 1531
180 Ga0068860_101219018 3300005843 Unclassified 773
181 Ga0081539_10008731 3300005985 Bacteria 8709
182 Ga0075365_10876371 3300006038 Bacteria 633
183 Ga0070715_10113185 3300006163 Bacteria 1283
184 Ga0097621_100241290 3300006237 Bacteria 1580
185 Ga0068871_100643026 3300006358 Bacteria 968
186 Ga0068871_101873836 3300006358 Unclassified 570
187 Ga0075428_100001305 3300006844 Bacteria 26445
188 Ga0075433_10261945 3300006852 Bacteria 1533
189 Ga0075433_11136942 3300006852 Unclassified 679
190 Ga0075434_100039037 3300006871 Bacteria 4704
191 Ga0075434_100096008 3300006871 Bacteria 2969
192 Ga0075434_100166038 3300006871 Bacteria 2227
193 Ga0075434_101858499 3300006871 Unclassified 609
194 Ga0068865_100004000 3300006881 Bacteria 8852
195 Ga0068865_101669391 3300006881 Unclassified 574
196 Ga0075436_100408023 3300006914 Bacteria 985
197 Ga0075436_100911121 3300006914 Bacteria 658
198 Ga0075435_100106468 3300007076 Bacteria 2329
199 Ga0075435_100270639 3300007076 Unclassified 1449
200 Ga0075435_100360468 3300007076 Bacteria 1247
201 Ga0075435_100732246 3300007076 Unclassified 860
202 Ga0105244_10197399 3300009036 Unclassified 950
203 Ga0111539_10046913 3300009094 Bacteria 5166
204 Ga0111539_10374791 3300009094 Bacteria 1657
205 Ga0111539_11849312 3300009094 Unclassified 700
206 Ga0105245_10011078 3300009098 Bacteria 7849
207 Ga0105245_10119338 3300009098 Bacteria 2462
208 Ga0105245_10175718 3300009098 Bacteria 2042
209 Ga0105245_10251064 3300009098 Bacteria 1718
210 Ga0105245_10346023 3300009098 Bacteria 1471
211 Ga0105245_10880180 3300009098 Bacteria 937
212 Ga0105247_10085377 3300009101 Unclassified 1996
213 Ga0105247_10650290 3300009101 Bacteria 788
214 Ga0105247_10712920 3300009101 Bacteria 756
215 Ga0114129_10001114 3300009147 Bacteria 35435
216 Ga0114129_10342870 3300009147 Bacteria 1981
217 Ga0114129_10891225 3300009147 Bacteria 1128
218 Ga0114129_12021794 3300009147 Bacteria 696
219 Ga0114129_12853140 3300009147 Bacteria 573
220 Ga0105243_10315676 3300009148 Bacteria 1422
221 Ga0105243_10339346 3300009148 Bacteria 1376
222 Ga0105243_10509059 3300009148 Unclassified 1142
223 Ga0105243_10698864 3300009148 Bacteria 988
224 Ga0105243_10805781 3300009148 Bacteria 926
225 Ga0105241_11681566 3300009174 Unclassified 616
226 Ga0105242_10176913 3300009176 Bacteria 1879
227 Ga0105242_10202337 3300009176 Bacteria 1765
228 Ga0105242_10207349 3300009176 Bacteria 1744
229 Ga0105242_10654156 3300009176 Bacteria 1022
230 Ga0105242_10675526 3300009176 Bacteria 1007
231 Ga0105242_11307659 3300009176 Bacteria 749
232 Ga0105242_11707861 3300009176 Bacteria 666
233 Ga0105242_12062210 3300009176 Unclassified 614
234 Ga0105242_12818714 3300009176 Unclassified 536
235 Ga0105248_10089673 3300009177 Bacteria 3462
236 Ga0105248_10366551 3300009177 Bacteria 1622
237 Ga0105248_10466078 3300009177 Bacteria 1424
238 Ga0105237_11952106 3300009545 Bacteria 595
239 Ga0105238_11650164 3300009551 Unclassified 672
240 Ga0105249_10012237 3300009553 Bacteria 7558
241 Ga0105249_10028245 3300009553 Bacteria 5064
242 Ga0105249_10346190 3300009553 Unclassified 1504
243 Ga0105249_10863520 3300009553 Unclassified 971
244 Ga0105249_11022503 3300009553 Bacteria 895
245 Ga0105249_11889403 3300009553 Bacteria 670
246 Ga0105249_12046863 3300009553 Unclassified 645
247 Ga0105249_13035949 3300009553 Bacteria 539
248 Ga0105239_10184301 3300010375 Bacteria 2336
249 Ga0105239_10223121 3300010375 Bacteria 2114
250 Ga0105239_11914760 3300010375 Unclassified 688
251 Ga0105246_10199822 3300011119 Bacteria 1553
252 Ga0105246_10233656 3300011119 Unclassified 1449
253 Ga0105246_10295365 3300011119 Bacteria 1306
254 Ga0105246_12277407 3300011119 Unclassified 529
255 Ga0157346_1012575 3300012480 Bacteria 642
256 Ga0157373_10126449 3300013100 Bacteria 1798
257 Ga0157373_10934764 3300013100 Unclassified 645
258 Ga0157371_10202362 3300013102 Unclassified 1424
259 Ga0157370_10499291 3300013104 Unclassified 1117
260 Ga0157374_10355443 3300013296 Unclassified 1456
261 Ga0157374_11894348 3300013296 Unclassified 622
262 Ga0157374_11961187 3300013296 Unclassified 612
263 Ga0157378_10056367 3300013297 Bacteria 3502
264 Ga0157378_10085824 3300013297 Unclassified 2852
265 Ga0157378_10148147 3300013297 Bacteria 2185
266 Ga0157378_10325299 3300013297 Bacteria 1495
267 Ga0157378_11320412 3300013297 Bacteria 763
268 Ga0157378_11740243 3300013297 Unclassified 671
269 Ga0157378_12273493 3300013297 Bacteria 594
270 Ga0163162_10012775 3300013306 Bacteria 8203
271 Ga0163162_10631958 3300013306 Bacteria 1195
272 Ga0163162_10832986 3300013306 Archaea 1038
273 Ga0157372_11890882 3300013307 Unclassified 686
274 Ga0157375_10026738 3300013308 Bacteria 5384
275 Ga0157375_10050046 3300013308 Bacteria 4097
276 Ga0157375_11622092 3300013308 Bacteria 765
277 Ga0163163_10042215 3300014325 Bacteria 4465
278 Ga0163163_10064496 3300014325 Bacteria 3634
279 Ga0163163_10067906 3300014325 Bacteria 3546
280 Ga0163163_10197514 3300014325 Bacteria 2060
281 Ga0163163_10240433 3300014325 Bacteria 1860
282 Ga0163163_11359778 3300014325 Bacteria 772
283 Ga0163163_12123047 3300014325 Unclassified 621
284 Ga0157380_10218480 3300014326 Unclassified 1704
285 Ga0157380_10649532 3300014326 Bacteria 1052
286 Ga0157380_13380658 3300014326 Unclassified 510
287 Ga0182008_10017803 3300014497 Bacteria 3683
288 Ga0157377_10074229 3300014745 Unclassified 1973
289 Ga0157377_10092909 3300014745 Unclassified 1785
290 Ga0157377_10173438 3300014745 Unclassified 1350
291 Ga0157379_10053139 3300014968 Bacteria 3619
292 Ga0157379_10055024 3300014968 Bacteria 3556
293 Ga0157379_10260541 3300014968 Bacteria 1575
294 Ga0157379_10684713 3300014968 Unclassified 962
295 Ga0157379_10706824 3300014968 Bacteria 946
296 Ga0157379_10760344 3300014968 Unclassified 913
297 Ga0157376_10079434 3300014969 Bacteria 2812
298 Ga0157376_10306703 3300014969 Bacteria 1505
299 Ga0157376_10738197 3300014969 Unclassified 993
300 Ga0157376_11232513 3300014969 Unclassified 777
301 Ga0157376_11687366 3300014969 Unclassified 669
302 Ga0163161_10152847 3300017792 Unclassified 1755
303 Ga0163161_10291367 3300017792 Bacteria 1283
304 Ga0163161_10458820 3300017792 Bacteria 1031
305 Ga0163161_11298328 3300017792 Bacteria 633
306 Ga0163161_11620386 3300017792 Bacteria 571
307 Ga0207653_10120889 3300025885 Bacteria 943
308 Ga0207653_10157279 3300025885 Bacteria 839
309 Ga0207692_10076305 3300025898 Bacteria 1780
310 Ga0207710_10228616 3300025900 Unclassified 925
311 Ga0207688_10051964 3300025901 Bacteria 2296
312 Ga0207688_10121881 3300025901 Bacteria 1522
313 Ga0207680_10916508 3300025903 Bacteria 628
314 Ga0207645_10108029 3300025907 Bacteria 1800
315 Ga0207643_10016227 3300025908 Bacteria 4062
316 Ga0207684_10000259 3300025910 Bacteria 78593
317 Ga0207684_10086167 3300025910 Bacteria 2675
318 Ga0207684_10220087 3300025910 Unclassified 1638
319 Ga0207684_10553281 3300025910 Unclassified 984
320 Ga0207684_10570029 3300025910 Bacteria 968
321 Ga0207684_10837156 3300025910 Bacteria 776
322 Ga0207707_10165699 3300025912 Unclassified 1931
323 Ga0207663_10088441 3300025916 Bacteria 2049
324 Ga0207660_10000001 3300025917 Bacteria 1034169
325 Ga0207660_10209824 3300025917 Bacteria 1525
326 Ga0207660_10515721 3300025917 Unclassified 970
327 Ga0207662_10000553 3300025918 Bacteria 16628
328 Ga0207662_10224191 3300025918 Unclassified 1225
329 Ga0207662_10297113 3300025918 Bacteria 1073
330 Ga0207657_10090552 3300025919 Bacteria 2553
331 Ga0207657_10816433 3300025919 Bacteria 721
332 Ga0207649_10227256 3300025920 Bacteria 1333
333 Ga0207652_10424267 3300025921 Unclassified 1199
334 Ga0207646_10005157 3300025922 Bacteria 13835
335 Ga0207646_10005955 3300025922 Bacteria 12717
336 Ga0207646_10028969 3300025922 Bacteria 5036
337 Ga0207646_10028972 3300025922 Bacteria 5036
338 Ga0207646_10036191 3300025922 Bacteria 4457
339 Ga0207646_10063954 3300025922 Bacteria 3284
340 Ga0207646_10079549 3300025922 Bacteria 2931
341 Ga0207646_10638105 3300025922 Bacteria 955
342 Ga0207681_10397746 3300025923 Bacteria 1112
343 Ga0207650_10528241 3300025925 Bacteria 988
344 Ga0207659_10014016 3300025926 Bacteria 5158
345 Ga0207659_10721969 3300025926 Bacteria 854
346 Ga0207687_10156631 3300025927 Bacteria 1743
347 Ga0207687_10161848 3300025927 Unclassified 1718
348 Ga0207687_10680897 3300025927 Unclassified 872
349 Ga0207687_10818492 3300025927 Bacteria 795
350 Ga0207690_10061921 3300025932 Bacteria 2545
351 Ga0207690_10422383 3300025932 Bacteria 1067
352 Ga0207706_10036256 3300025933 Bacteria 4381
353 Ga0207706_10066065 3300025933 Bacteria 3183
354 Ga0207706_10159620 3300025933 Bacteria 1982
355 Ga0207706_10343539 3300025933 Bacteria 1298
356 Ga0207686_10321336 3300025934 Bacteria 1156
357 Ga0207686_10857108 3300025934 Bacteria 731
358 Ga0207686_11120077 3300025934 Bacteria 642
359 Ga0207709_10140696 3300025935 Unclassified 1658
360 Ga0207709_11364581 3300025935 Bacteria 587
361 Ga0207670_10055372 3300025936 Bacteria 2680
362 Ga0207670_11422251 3300025936 Bacteria 589
363 Ga0207704_10262539 3300025938 Unclassified 1303
364 Ga0207704_10498278 3300025938 Unclassified 981
365 Ga0207691_10189910 3300025940 Unclassified 1792
366 Ga0207691_10405105 3300025940 Bacteria 1163
367 Ga0207711_10292230 3300025941 Bacteria 1502
368 Ga0207689_10115040 3300025942 Unclassified 2211
369 Ga0207661_10278588 3300025944 Unclassified 1494
370 Ga0207661_10974397 3300025944 Bacteria 781
371 Ga0207661_11871306 3300025944 Bacteria 546
372 Ga0207679_10535670 3300025945 Unclassified 1049
373 Ga0207679_10956060 3300025945 Bacteria 785
374 Ga0207679_11469181 3300025945 Bacteria 625
375 Ga0207667_10122060 3300025949 Bacteria 2685
376 Ga0207651_10021452 3300025960 Bacteria 3927
377 Ga0207651_11821431 3300025960 Unclassified 548
378 Ga0207712_10043131 3300025961 Bacteria 3110
379 Ga0207712_10436573 3300025961 Bacteria 1108
380 Ga0207712_10759030 3300025961 Bacteria 850
381 Ga0207640_10231053 3300025981 Bacteria 1423
382 Ga0207640_10266364 3300025981 Unclassified 1338
383 Ga0207640_10703610 3300025981 Bacteria 866
384 Ga0207640_12143644 3300025981 Unclassified 507
385 Ga0207658_10697923 3300025986 Bacteria 917
386 Ga0207658_10947729 3300025986 Unclassified 785
387 Ga0207677_10307770 3300026023 Bacteria 1311
388 Ga0207677_10497296 3300026023 Bacteria 1053
389 Ga0207703_10267454 3300026035 Bacteria 1548
390 Ga0207703_11081257 3300026035 Bacteria 770
391 Ga0207639_10023889 3300026041 Bacteria 4418
392 Ga0207678_10958850 3300026067 Bacteria 757
393 Ga0207708_10050089 3300026075 Bacteria 3180
394 Ga0207708_10445038 3300026075 Bacteria 1078
395 Ga0207708_11358897 3300026075 Unclassified 623
396 Ga0207702_10770804 3300026078 Bacteria 950
397 Ga0207702_11557929 3300026078 Bacteria 654
398 Ga0207641_10104940 3300026088 Bacteria 2496
399 Ga0207641_10472976 3300026088 Bacteria 1214
400 Ga0207648_10105084 3300026089 Bacteria 2477
401 Ga0207648_11184538 3300026089 Bacteria 717
402 Ga0207676_10461024 3300026095 Bacteria 1200
403 Ga0207676_12210781 3300026095 Bacteria 548
404 Ga0207676_12298562 3300026095 Bacteria 537
405 Ga0207674_10019019 3300026116 Bacteria 7444
406 Ga0207674_10373997 3300026116 Bacteria 1377
407 Ga0207674_11030491 3300026116 Bacteria 792
408 Ga0207675_100161188 3300026118 Bacteria 2139
409 Ga0207675_100433926 3300026118 Bacteria 1299
410 Ga0207675_101518129 3300026118 Unclassified 691
411 Ga0207683_10135509 3300026121 Unclassified 2217
412 Ga0207683_10262993 3300026121 Bacteria 1575
413 Ga0207683_11256869 3300026121 Bacteria 686
414 Ga0207698_10397682 3300026142 Unclassified 1316
415 Ga0207698_10593007 3300026142 Bacteria 1091
416 Ga0209983_1037634 3300027665 Bacteria 1042
417 Ga0209983_1059183 3300027665 Bacteria 845
418 Ga0209974_10017637 3300027876 Unclassified 2367
419 Ga0209974_10085669 3300027876 Unclassified 1088
420 Ga0268266_11012523 3300028379 Bacteria 804
421 Ga0268264_10808357 3300028381 Unclassified 937
422 Ga0268264_11024795 3300028381 Bacteria 832
423 Ga0316578_10506117 3300031728 Bacteria 711
424 Ga0307405_11797675 3300031731 Bacteria 545
425 Ga0307410_10436939 3300031852 Bacteria 1065
426 Ga0307406_10020414 3300031901 Bacteria 3901
427 Ga0307406_10734109 3300031901 Bacteria 828
428 Ga0307412_10151415 3300031911 Bacteria 1712
429 Ga0307409_100047202 3300031995 Bacteria 3267
430 Ga0307409_100485498 3300031995 Bacteria 1200
431 Ga0307409_100663197 3300031995 Bacteria 1038
432 Ga0307416_100022325 3300032002 Bacteria 4566
433 Ga0307416_102071157 3300032002 Bacteria 671
434 Ga0307415_100004122 3300032126 Bacteria 7497
435 Ga0307415_100600661 3300032126 Bacteria 979
436 Ga0307415_100922092 3300032126 Unclassified 807
437 Ga0373958_0105072 3300034819 Bacteria 667
438 Ga0373932_0138602 3300035112 Bacteria 826
439 Ga0373943_0064787 3300035170 Bacteria 1836
440 Ga0373961_0224590 3300035241 Unclassified 671
441 Ga0316574_0034564 3300035398 Bacteria 3083
442 Ga0316574_0059126 3300035398 Bacteria 2403
443 Ga0373931_0029707 3300035691 Bacteria 2809
444 Ga0373931_0595544 3300035691 Bacteria 722
445 Ga0373931_0829422 3300035691 Bacteria 618
446 Ga0373947_0083308 3300035725 Bacteria 1983
447 Ga0373937_0524574 3300036401 Unclassified 1125
448 Ga0373937_1307234 3300036401 Bacteria 673
449 Ga0373925_0088831 3300037068 Bacteria 2360
450 Ga0395905_0389582 3300037471 Unclassified 1288
451 Ga0395905_0595036 3300037471 Bacteria 1008
452 Ga0395901_0711917 3300038443 Unclassified 1001
453 Ga0436365_0066826 3300039437 Unclassified 1189
454 Ga0436362_0330617 3300039453 Unclassified 607
455 Ga0439465_0013475 3300041413 Unclassified 2548
456 Ga0439465_0104423 3300041413 Bacteria 981
457 Ga0451793_1418209 3300041452 Bacteria 1055
458 Ga0451798_0961196 3300041458 Unclassified 506
459 Ga0451802_2153148 3300041460 Unclassified 592
460 Ga0451807_0056908 3300041486 Bacteria 505
461 Ga0451849_0619516 3300041505 Bacteria 593
462 Ga0451851_0322829 3300041507 Bacteria 828
463 Ga0451853_2733156 3300041512 Bacteria 1003
464 Ga0439441_013613 3300042001 Bacteria 1414
465 Ga0439455_0255154 3300042012 Bacteria 514
466 Ga0450913_024597 3300042117 Bacteria 570
467 Ga0450906_015640 3300042145 Unclassified 1377
468 Ga0439446_0103756 3300042156 Bacteria 902
469 Ga0439458_0085125 3300042157 Unclassified 810
470 Ga0439458_0085440 3300042157 Bacteria 808
471 Ga0439459_0119159 3300042438 Bacteria 664
472 Ga0439460_0081220 3300042461 Unclassified 1018
473 Ga0453683_1087093 3300044673 Bacteria 533
474 Ga0453684_0589184 3300044712 Bacteria 1220
475 Ga0453684_0694989 3300044712 Bacteria 1106
476 Ga0466968_0642206 3300044735 Bacteria 538
477 Ga0451576_0106462 3300045051 Bacteria 2918
478 Ga0495603_0414865 3300046455 Bacteria 772
479 Ga0495629_0412062 3300046459 Bacteria 918
480 Ga0495641_0160758 3300046461 Bacteria 1005
481 Ga0495641_0280615 3300046461 Unclassified 750
482 Ga0495641_0283004 3300046461 Bacteria 747
483 Ga0495586_0100494 3300046535 Bacteria 1605
484 Ga0495599_0115320 3300046678 Bacteria 1672
485 Ga0495647_0350392 3300046681 Unclassified 672
486 Ga0495658_0195527 3300046683 Bacteria 1259
487 Ga0495658_0722886 3300046683 Bacteria 638
488 Ga0495613_0805514 3300046689 Bacteria 613
489 Ga0495676_0174945 3300047321 Bacteria 1508
490 Ga0495676_0914054 3300047321 Bacteria 562
491 Ga0495680_0602481 3300047322 Bacteria 735
492 Ga0496100_0013652 3300048903 Bacteria 4693
493 Ga0496100_0303411 3300048903 Bacteria 1196
494 Ga0496100_0397101 3300048903 Bacteria 1050
495 Ga0496100_0966145 3300048903 Bacteria 670
496 Ga0496101_0011984 3300048904 Bacteria 5777
497 Ga0496102_0060690 3300048905 Bacteria 3459
498 Ga0496102_0169015 3300048905 Unclassified 2058
499 Ga0496102_0238206 3300048905 Bacteria 1716
500 Ga0496102_0305221 3300048905 Bacteria 1500
501 Ga0496102_1096815 3300048905 Unclassified 716
502 Ga0496102_1180941 3300048905 Unclassified 685
503 Ga0496103_0030714 3300048906 Bacteria 3271
504 Ga0496103_0042359 3300048906 Unclassified 2801
505 Ga0496103_0454120 3300048906 Bacteria 822
506 Ga0496103_0753144 3300048906 Unclassified 616
507 Ga0496103_0817755 3300048906 Bacteria 587
508 Ga0496104_0000498 3300048907 Bacteria 33953
509 Ga0496105_0000281 3300048908 Bacteria 33474
510 Ga0496105_0013773 3300048908 Bacteria 6422
511 Ga0496105_0243709 3300048908 Unclassified 1458
512 Ga0496105_0340562 3300048908 Unclassified 1199
513 Ga0496106_0126692 3300048909 Bacteria 2000
514 Ga0496106_0262150 3300048909 Bacteria 1383
515 Ga0496106_0611842 3300048909 Unclassified 872
516 Ga0496106_0877024 3300048909 Unclassified 709
517 Ga0496107_0129952 3300048910 Bacteria 1859
518 Ga0496107_0638032 3300048910 Bacteria 786
519 Ga0496107_0720665 3300048910 Unclassified 733
520 Ga0496107_0799709 3300048910 Unclassified 690
521 Ga0496107_0956217 3300048910 Bacteria 623
522 Ga0496108_0007038 3300048911 Bacteria 9108
523 Ga0496108_0047905 3300048911 Bacteria 3573
524 Ga0496108_0121655 3300048911 Unclassified 2239
525 Ga0496108_0134833 3300048911 Unclassified 2123
526 Ga0496109_0001907 3300048912 Bacteria 17322
527 Ga0496109_0014150 3300048912 Bacteria 6937
528 Ga0496109_0082012 3300048912 Bacteria 2972
529 Ga0496109_0331382 3300048912 Bacteria 1437
530 Ga0496109_0447205 3300048912 Unclassified 1221
531 Ga0496109_0509682 3300048912 Bacteria 1136
532 Ga0496109_1154182 3300048912 Unclassified 711
533 Ga0496109_1596500 3300048912 Bacteria 587
534 Ga0496109_1799862 3300048912 Unclassified 546
535 Ga0496110_0031802 3300048913 Bacteria 4555
536 Ga0496110_0106431 3300048913 Bacteria 2517
537 Ga0496110_0148621 3300048913 Bacteria 2120
538 Ga0496110_0373367 3300048913 Bacteria 1299
539 Ga0496111_0009308 3300048914 Bacteria 6549
540 Ga0496111_0012081 3300048914 Bacteria 5839
541 Ga0496111_0023887 3300048914 Bacteria 4297
542 Ga0496111_0363446 3300048914 Unclassified 1071
543 Ga0496111_0472515 3300048914 Unclassified 924
544 Ga0496112_0000012 3300048915 Bacteria 243643
545 Ga0496112_0001724 3300048915 Bacteria 17092
546 Ga0496112_0549519 3300048915 Bacteria 1089
547 Ga0496112_1656578 3300048915 Unclassified 553
548 Ga0496113_0004095 3300048916 Bacteria 8882
549 Ga0496113_0014354 3300048916 Bacteria 5402
550 Ga0496113_0175758 3300048916 Unclassified 1697
551 Ga0496113_0351356 3300048916 Bacteria 1183
552 Ga0496114_0023563 3300048917 Bacteria 5024
553 Ga0496114_0203968 3300048917 Unclassified 1733
554 Ga0496114_0521904 3300048917 Bacteria 1050
555 Ga0496114_0537399 3300048917 Unclassified 1033
556 Ga0496114_1329543 3300048917 Bacteria 606
557 Ga0501032_0742569 3300049569 Bacteria 621
558 Ga0501036_0122630 3300049572 Bacteria 2195
559 Ga0501036_0194189 3300049572 Unclassified 1708
560 Ga0501038_0051275 3300049574 Bacteria 3563
561 Ga0501038_0168176 3300049574 Bacteria 1777
562 Ga0501038_0461617 3300049574 Bacteria 975
563 Ga0501039_0116366 3300049575 Bacteria 2093
564 Ga0501040_0084367 3300049576 Bacteria 2204
565 Ga0501040_0276043 3300049576 Bacteria 1200
566 Ga0501040_0498310 3300049576 Bacteria 878
567 Ga0501041_0072322 3300049577 Unclassified 2118
568 Ga0501042_0286504 3300049578 Bacteria 1190
569 Ga0501043_0366420 3300049579 Bacteria 1093
570 Ga0501046_0091757 3300049580 Unclassified 2336
571 Ga0501046_0373215 3300049580 Bacteria 1033
572 Ga0501046_0509904 3300049580 Unclassified 861
573 Ga0501048_0110530 3300049582 Unclassified 1941
574 Ga0501067_0088884 3300049583 Bacteria 1714
575 Ga0501067_0134486 3300049583 Bacteria 1376
576 Ga0501067_0372617 3300049583 Unclassified 796
577 Ga0501067_0660236 3300049583 Unclassified 587
578 Ga0501069_0017880 3300049585 Bacteria 3823
579 Ga0501069_0020347 3300049585 Bacteria 3595
580 Ga0501069_0742299 3300049585 Bacteria 593
581 Ga0501070_0560153 3300049586 Bacteria 914
582 Ga0501070_0697179 3300049586 Unclassified 803
583 Ga0501071_0106691 3300049587 Bacteria 2068
584 Ga0501071_0233771 3300049587 Bacteria 1385
585 Ga0501071_0365505 3300049587 Bacteria 1099
586 Ga0501071_0431178 3300049587 Bacteria 1008
587 Ga0501071_0469609 3300049587 Unclassified 964
588 Ga0501072_0042078 3300049588 Bacteria 3589
589 Ga0501072_0339873 3300049588 Bacteria 1192
590 Ga0501072_0382329 3300049588 Unclassified 1117
591 Ga0501074_0325600 3300049590 Bacteria 1091
592 Ga0501074_0561423 3300049590 Bacteria 808
593 Ga0501075_0018886 3300049591 Bacteria 4997
594 Ga0501075_0697261 3300049591 Unclassified 774
595 Ga0501075_0975937 3300049591 Bacteria 644
596 Ga0501076_0080315 3300049592 Bacteria 2618
597 Ga0501076_0107133 3300049592 Bacteria 2256
598 Ga0501076_0215322 3300049592 Unclassified 1570
599 Ga0501076_0353418 3300049592 Bacteria 1207
600 Ga0501077_0043985 3300049593 Bacteria 2838
601 Ga0501077_0074743 3300049593 Bacteria 2146
602 Ga0501079_0155963 3300049741 Unclassified 1780
603 Ga0501079_0213362 3300049741 Unclassified 1508
604 Ga0501079_0257385 3300049741 Bacteria 1364
605 Ga0501079_0340426 3300049741 Unclassified 1175
606 Ga0501080_0060507 3300049742 Bacteria 3526
607 Ga0501080_0215236 3300049742 Bacteria 1760
608 Ga0501081_0127982 3300049743 Bacteria 1813
609 Ga0501081_0139565 3300049743 Unclassified 1736
610 Ga0501081_0290408 3300049743 Bacteria 1198
611 Ga0501081_0554317 3300049743 Unclassified 859
612 Ga0501083_0077060 3300049744 Bacteria 2213
613 Ga0501035_0348278 3300049822 Bacteria 1240
614 Ga0501035_0466516 3300049822 Bacteria 1043
615 Ga0501035_0673492 3300049822 Unclassified 837
616 Ga0501045_0025256 3300049824 Bacteria 4270
617 Ga0501045_0422235 3300049824 Unclassified 992
618 Ga0501045_0527009 3300049824 Bacteria 877
619 Ga0501045_0600443 3300049824 Unclassified 815
620 nmdc:mga05p37_142_c1 3300050507 Bacteria 67494
621 nmdc:mga05p37_312688_c1 3300050507 Bacteria 1861
622 nmdc:mga08y16_205720_c1 3300050511 Bacteria 2039
623 nmdc:mga08y16_63385_c1 3300050511 Bacteria 3860
624 nmdc:mga08y16_74591_c1 3300050511 Bacteria 3535
625 nmdc:mga08y16_794277_c1 3300050511 Bacteria 940
626 nmdc:mga0n895_100842_c1 3300050512 Unclassified 2896
627 nmdc:mga0n895_1053497_c1 3300050512 Bacteria 792
628 nmdc:mga0n895_193305_c1 3300050512 Bacteria 2066
629 nmdc:mga0n895_193777_c1 3300050512 Bacteria 2063
630 nmdc:mga0n895_2066251_c1 3300050512 Bacteria 527
631 nmdc:mga0rr50_128824_c1 3300050513 Bacteria 2023
632 nmdc:mga0rr50_274057_c1 3300050513 Unclassified 1407
633 nmdc:mga0a205_1032091_c1 3300050515 Bacteria 669
634 nmdc:mga0a205_18026_c1 3300050515 Bacteria 3583
635 nmdc:mga0a205_227930_c1 3300050515 Bacteria 1747
636 nmdc:mga0a205_32872_c1 3300050515 Bacteria 4974
637 nmdc:mga0a205_91394_c1 3300050515 Bacteria 2941
638 Ga0495601_0187861 3300053077 Bacteria 1351
639 Ga0495601_0338026 3300053077 Bacteria 980
640 Ga0495612_0000135 3300053078 Bacteria 31349
641 Ga0501084_0033498 3300054114 Bacteria 4298
642 Ga0501084_0052398 3300054114 Bacteria 3414
643 Ga0501084_0941081 3300054114 Unclassified 726
644 Ga0501084_1062978 3300054114 Bacteria 680
645 Ga0501082_0290545 3300060353 Bacteria 1423
646 Ga0501082_0505782 3300060353 Bacteria 1056
647 Ga0501082_0702980 3300060353 Unclassified 885
648 Ga0501082_0731191 3300060353 Bacteria 866
649 Ga0530510_0008194 3300061734 Bacteria 7290
650 Ga0530510_0062834 3300061734 Bacteria 2688
651 Ga0530510_0083958 3300061734 Unclassified 2320
652 Ga0530510_0503970 3300061734 Unclassified 918
653 Ga0530510_1051873 3300061734 Bacteria 623
654 Ga0068860_100619539
655 Ga0070683_100505281
656 Ga0070683_101442409
657 Ga0070670_100320263
658 Ga0070670_100606949
659 Ga0070670_100922245
660 Ga0068869_100043792
661 Ga0068869_101462437
662 Ga0070666_10644680
663 Ga0070666_11060506
664 Ga0070680_100161069
665 Ga0070680_101358527
666 Ga0068868_100286013
667 Ga0068868_100374536
668 Ga0068868_100616514
669 Ga0070660_100274138
670 Ga0070660_101065520
671 Ga0070660_101230437
672 Ga0070689_100107445
673 Ga0070691_10052511
674 Ga0070691_10125734
675 Ga0070691_10431500
676 Ga0070687_100041697
677 Ga0070661_101622847
678 Ga0070692_10006117
679 Ga0070669_100292474
680 Ga0070669_101002809
681 Ga0070669_101232094
682 Ga0070675_100179910
683 Ga0070671_100771563
684 Ga0070671_101546096
685 Ga0070674_100037756
686 Ga0070674_100819851
687 Ga0070674_100853647
688 Ga0070674_101423472
689 Ga0070674_101907920
690 Ga0070673_100775818
691 Ga0070673_101304746
692 Ga0070688_100106278
693 Ga0070659_100031230
694 Ga0070659_100558243
695 Ga0070659_102100572
696 Ga0070667_100387094
697 Ga0070667_100581575
698 Ga0070703_10037953
699 Ga0070703_10362362
700 Ga0070703_10417361
701 Ga0070710_10138686
702 Ga0070701_10014631
703 Ga0070701_10233854
704 Ga0070711_100473918
705 Ga0070705_100132327
706 Ga0070705_100387612
707 Ga0070705_100418439
708 Ga0070705_100454718
709 Ga0070705_101405075
710 Ga0070705_101585758
711 Ga0070700_100074925
712 Ga0070700_100233239
713 Ga0070694_100060992
714 Ga0070694_100183318
715 Ga0070694_100492137
716 Ga0070694_100860014
717 Ga0070694_101397391
718 Ga0070708_100010779
719 Ga0070708_100027341
720 Ga0070708_100046223
721 Ga0070708_100125385
722 Ga0070708_100165496
723 Ga0070708_100812773
724 Ga0070663_101070661
725 Ga0070678_100009810
726 Ga0070678_100038532
727 Ga0070662_100064412
728 Ga0070662_100100781
729 Ga0070662_100236017
730 Ga0070681_10187146
731 Ga0070681_10375566
732 Ga0070681_11576464
733 Ga0068867_100222609
734 Ga0068867_100880992
735 Ga0068867_101589403
736 Ga0070685_10174731
737 Ga0070685_10452453
738 Ga0070706_100001875
739 Ga0070706_100089589
740 Ga0070706_100139337
741 Ga0070706_100442709
742 Ga0070706_100487605
743 Ga0070706_100886232
744 Ga0070706_101232312
745 Ga0070706_101276489
746 Ga0070707_100003529
747 Ga0070707_100013306
748 Ga0070707_100090533
749 Ga0070707_100143169
750 Ga0070707_100169235
751 Ga0070707_100181805
752 Ga0070707_100196319
753 Ga0070707_100743966
754 Ga0070707_100855068
755 Ga0070707_100867779
756 Ga0070707_101378512
757 Ga0070698_100016117
758 Ga0070698_100027926
759 Ga0070698_100127860
760 Ga0070698_100214276
761 Ga0070698_100424034
762 Ga0070698_100492895
763 Ga0070698_100493153
764 Ga0070698_100525299
765 Ga0070698_100624391
766 Ga0070698_101588677
767 Ga0070699_100003054
768 Ga0070699_100026683
769 Ga0070699_100035114
770 Ga0070699_100348908
771 Ga0070699_100632260
772 Ga0070699_100925320
773 Ga0070679_100084467
774 Ga0070679_101369013
775 Ga0070684_100051863
776 Ga0070684_100092621
777 Ga0070684_100170586
778 Ga0070684_100570382
779 Ga0070684_100648325
780 Ga0070697_100033322
781 Ga0070697_100038038
782 Ga0070697_100398817
783 Ga0070697_100507758
784 Ga0068853_101889040
785 Ga0070672_100188354
786 Ga0070686_100107377
787 Ga0070686_100220742
788 Ga0070686_101436660
789 Ga0070695_100053457
790 Ga0070695_100058972
791 Ga0070695_100373835
792 Ga0070695_100642937
793 Ga0070696_100006337
794 Ga0070696_100029969
795 Ga0070696_100986331
796 Ga0070693_100010011
797 Ga0070693_100094024
798 Ga0070665_100795791
799 Ga0070665_101650220
800 Ga0070704_100096956
801 Ga0070704_100120095
802 Ga0070704_100972707
803 Ga0068855_100480361
804 Ga0070664_101076592
805 Ga0070664_101404464
806 Ga0070664_101642140
807 Ga0068857_100181633
808 Ga0068854_100303909
809 Ga0068854_100785757
810 Ga0068854_101396994
811 Ga0068854_101876129
812 Ga0070702_100273461
813 Ga0070702_101698775
814 Ga0068852_100317971
815 Ga0068852_102072299
816 Ga0068864_100126539
817 Ga0068864_100375895
818 Ga0068864_100904005
819 Ga0068864_102682986
820 Ga0068866_10076292
821 Ga0068866_10214312
822 Ga0068861_100438417
823 Ga0068861_101861081
824 Ga0068870_10258813
825 Ga0068870_10611778
826 Ga0068870_10679907
827 Ga0068863_100472865
828 Ga0068858_100115705
829 Ga0068858_100239426
830 Ga0068858_101041151
831 Ga0068860_100126875
832 Ga0068860_100316626
833 Ga0068860_101219018
834 Ga0081539_10008731
835 Ga0075365_10876371
836 Ga0070715_10113185
837 Ga0097621_100241290
838 Ga0068871_100643026
839 Ga0068871_101873836
840 Ga0075428_100001305
841 Ga0075433_10261945
842 Ga0075433_11136942
843 Ga0075434_100039037
844 Ga0075434_100096008
845 Ga0075434_100166038
846 Ga0075434_101858499
847 Ga0068865_100004000
848 Ga0068865_101669391
849 Ga0075436_100408023
850 Ga0075436_100911121
851 Ga0075435_100106468
852 Ga0075435_100270639
853 Ga0075435_100360468
854 Ga0075435_100732246
855 Ga0105244_10197399
856 Ga0111539_10046913
857 Ga0111539_10374791
858 Ga0111539_11849312
859 Ga0105245_10011078
860 Ga0105245_10119338
861 Ga0105245_10175718
862 Ga0105245_10251064
863 Ga0105245_10346023
864 Ga0105245_10880180
865 Ga0105247_10085377
866 Ga0105247_10650290
867 Ga0105247_10712920
868 Ga0114129_10001114
869 Ga0114129_10342870
870 Ga0114129_10891225
871 Ga0114129_12021794
872 Ga0114129_12853140
873 Ga0105243_10315676
874 Ga0105243_10339346
875 Ga0105243_10509059
876 Ga0105243_10698864
877 Ga0105243_10805781
878 Ga0105241_11681566
879 Ga0105242_10176913
880 Ga0105242_10202337
881 Ga0105242_10207349
882 Ga0105242_10654156
883 Ga0105242_10675526
884 Ga0105242_11307659
885 Ga0105242_11707861
886 Ga0105242_12062210
887 Ga0105242_12818714
888 Ga0105248_10089673
889 Ga0105248_10366551
890 Ga0105248_10466078
891 Ga0105237_11952106
892 Ga0105238_11650164
893 Ga0105249_10012237
894 Ga0105249_10028245
895 Ga0105249_10346190
896 Ga0105249_10863520
897 Ga0105249_11022503
898 Ga0105249_11889403
899 Ga0105249_12046863
900 Ga0105249_13035949
901 Ga0105239_10184301
902 Ga0105239_10223121
903 Ga0105239_11914760
904 Ga0105246_10199822
905 Ga0105246_10233656
906 Ga0105246_10295365
907 Ga0105246_12277407
908 Ga0157346_1012575
909 Ga0157373_10126449
910 Ga0157373_10934764
911 Ga0157371_10202362
912 Ga0157370_10499291
913 Ga0157374_10355443
914 Ga0157374_11894348
915 Ga0157374_11961187
916 Ga0157378_10056367
917 Ga0157378_10085824
918 Ga0157378_10148147
919 Ga0157378_10325299
920 Ga0157378_11320412
921 Ga0157378_11740243
922 Ga0157378_12273493
923 Ga0163162_10012775
924 Ga0163162_10631958
925 Ga0163162_10832986
926 Ga0157372_11890882
927 Ga0157375_10026738
928 Ga0157375_10050046
929 Ga0157375_11622092
930 Ga0163163_10042215
931 Ga0163163_10064496
932 Ga0163163_10067906
933 Ga0163163_10197514
934 Ga0163163_10240433
935 Ga0163163_11359778
936 Ga0163163_12123047
937 Ga0157380_10218480
938 Ga0157380_10649532
939 Ga0157380_13380658
940 Ga0182008_10017803
941 Ga0157377_10074229
942 Ga0157377_10092909
943 Ga0157377_10173438
944 Ga0157379_10053139
945 Ga0157379_10055024
946 Ga0157379_10260541
947 Ga0157379_10684713
948 Ga0157379_10706824
949 Ga0157379_10760344
950 Ga0157376_10079434
951 Ga0157376_10306703
952 Ga0157376_10738197
953 Ga0157376_11232513
954 Ga0157376_11687366
955 Ga0163161_10152847
956 Ga0163161_10291367
957 Ga0163161_10458820
958 Ga0163161_11298328
959 Ga0163161_11620386
960 Ga0207653_10120889
961 Ga0207653_10157279
962 Ga0207692_10076305
963 Ga0207710_10228616
964 Ga0207688_10051964
965 Ga0207688_10121881
966 Ga0207680_10916508
967 Ga0207645_10108029
968 Ga0207643_10016227
969 Ga0207684_10000259
970 Ga0207684_10086167
971 Ga0207684_10220087
972 Ga0207684_10553281
973 Ga0207684_10570029
974 Ga0207684_10837156
975 Ga0207707_10165699
976 Ga0207663_10088441
977 Ga0207660_10000001
978 Ga0207660_10209824
979 Ga0207660_10515721
980 Ga0207662_10000553
981 Ga0207662_10224191
982 Ga0207662_10297113
983 Ga0207657_10090552
984 Ga0207657_10816433
985 Ga0207649_10227256
986 Ga0207652_10424267
987 Ga0207646_10005157
988 Ga0207646_10005955
989 Ga0207646_10028969
990 Ga0207646_10028972
991 Ga0207646_10036191
992 Ga0207646_10063954
993 Ga0207646_10079549
994 Ga0207646_10638105
995 Ga0207681_10397746
996 Ga0207650_10528241
997 Ga0207659_10014016
998 Ga0207659_10721969
999 Ga0207687_10156631
1000 Ga0207687_10161848
1001 Ga0207687_10680897
1002 Ga0207687_10818492
1003 Ga0207690_10061921
1004 Ga0207690_10422383
1005 Ga0207706_10036256
1006 Ga0207706_10066065
1007 Ga0207706_10159620
1008 Ga0207706_10343539
1009 Ga0207686_10321336
1010 Ga0207686_10857108
1011 Ga0207686_11120077
1012 Ga0207709_10140696
1013 Ga0207709_11364581
1014 Ga0207670_10055372
1015 Ga0207670_11422251
1016 Ga0207704_10262539
1017 Ga0207704_10498278
1018 Ga0207691_10189910
1019 Ga0207691_10405105
1020 Ga0207711_10292230
1021 Ga0207689_10115040
1022 Ga0207661_10278588
1023 Ga0207661_10974397
1024 Ga0207661_11871306
1025 Ga0207679_10535670
1026 Ga0207679_10956060
1027 Ga0207679_11469181
1028 Ga0207667_10122060
1029 Ga0207651_10021452
1030 Ga0207651_11821431
1031 Ga0207712_10043131
1032 Ga0207712_10436573
1033 Ga0207712_10759030
1034 Ga0207640_10231053
1035 Ga0207640_10266364
1036 Ga0207640_10703610
1037 Ga0207640_12143644
1038 Ga0207658_10697923
1039 Ga0207658_10947729
1040 Ga0207677_10307770
1041 Ga0207677_10497296
1042 Ga0207703_10267454
1043 Ga0207703_11081257
1044 Ga0207639_10023889
1045 Ga0207678_10958850
1046 Ga0207708_10050089
1047 Ga0207708_10445038
1048 Ga0207708_11358897
1049 Ga0207702_10770804
1050 Ga0207702_11557929
1051 Ga0207641_10104940
1052 Ga0207641_10472976
1053 Ga0207648_10105084
1054 Ga0207648_11184538
1055 Ga0207676_10461024
1056 Ga0207676_12210781
1057 Ga0207676_12298562
1058 Ga0207674_10019019
1059 Ga0207674_10373997
1060 Ga0207674_11030491
1061 Ga0207675_100161188
1062 Ga0207675_100433926
1063 Ga0207675_101518129
1064 Ga0207683_10135509
1065 Ga0207683_10262993
1066 Ga0207683_11256869
1067 Ga0207698_10397682
1068 Ga0207698_10593007
1069 Ga0209983_1037634
1070 Ga0209983_1059183
1071 Ga0209974_10017637
1072 Ga0209974_10085669
1073 Ga0268266_11012523
1074 Ga0268264_10808357
1075 Ga0268264_11024795
1076 Ga0316578_10506117
1077 Ga0307405_11797675
1078 Ga0307410_10436939
1079 Ga0307406_10020414
1080 Ga0307406_10734109
1081 Ga0307412_10151415
1082 Ga0307409_100047202
1083 Ga0307409_100485498
1084 Ga0307409_100663197
1085 Ga0307416_100022325
1086 Ga0307416_102071157
1087 Ga0307415_100004122
1088 Ga0307415_100600661
1089 Ga0307415_100922092
1090 Ga0373958_0105072
1091 Ga0373932_0138602
1092 Ga0373943_0064787
1093 Ga0373961_0224590
1094 Ga0316574_0034564
1095 Ga0316574_0059126
1096 Ga0373931_0029707
1097 Ga0373931_0595544
1098 Ga0373931_0829422
1099 Ga0373947_0083308
1100 Ga0373937_0524574
1101 Ga0373937_1307234
1102 Ga0373925_0088831
1103 Ga0395905_0389582
1104 Ga0395905_0595036
1105 Ga0395901_0711917
1106 Ga0436365_0066826
1107 Ga0436362_0330617
1108 Ga0439465_0013475
1109 Ga0439465_0104423
1110 Ga0451793_1418209
1111 Ga0451798_0961196
1112 Ga0451802_2153148
1113 Ga0451807_0056908
1114 Ga0451849_0619516
1115 Ga0451851_0322829
1116 Ga0451853_2733156
1117 Ga0439441_013613
1118 Ga0439455_0255154
1119 Ga0450913_024597
1120 Ga0450906_015640
1121 Ga0439446_0103756
1122 Ga0439458_0085125
1123 Ga0439458_0085440
1124 Ga0439459_0119159
1125 Ga0439460_0081220
1126 Ga0453683_1087093
1127 Ga0453684_0589184
1128 Ga0453684_0694989
1129 Ga0466968_0642206
1130 Ga0451576_0106462
1131 Ga0495603_0414865
1132 Ga0495629_0412062
1133 Ga0495641_0160758
1134 Ga0495641_0280615
1135 Ga0495641_0283004
1136 Ga0495586_0100494
1137 Ga0495599_0115320
1138 Ga0495647_0350392
1139 Ga0495658_0195527
1140 Ga0495658_0722886
1141 Ga0495613_0805514
1142 Ga0495676_0174945
1143 Ga0495676_0914054
1144 Ga0495680_0602481
1145 Ga0496100_0013652
1146 Ga0496100_0303411
1147 Ga0496100_0397101
1148 Ga0496100_0966145
1149 Ga0496101_0011984
1150 Ga0496102_0060690
1151 Ga0496102_0169015
1152 Ga0496102_0238206
1153 Ga0496102_0305221
1154 Ga0496102_1096815
1155 Ga0496102_1180941
1156 Ga0496103_0030714
1157 Ga0496103_0042359
1158 Ga0496103_0454120
1159 Ga0496103_0753144
1160 Ga0496103_0817755
1161 Ga0496104_0000498
1162 Ga0496105_0000281
1163 Ga0496105_0013773
1164 Ga0496105_0243709
1165 Ga0496105_0340562
1166 Ga0496106_0126692
1167 Ga0496106_0262150
1168 Ga0496106_0611842
1169 Ga0496106_0877024
1170 Ga0496107_0129952
1171 Ga0496107_0638032
1172 Ga0496107_0720665
1173 Ga0496107_0799709
1174 Ga0496107_0956217
1175 Ga0496108_0007038
1176 Ga0496108_0047905
1177 Ga0496108_0121655
1178 Ga0496108_0134833
1179 Ga0496109_0001907
1180 Ga0496109_0014150
1181 Ga0496109_0082012
1182 Ga0496109_0331382
1183 Ga0496109_0447205
1184 Ga0496109_0509682
1185 Ga0496109_1154182
1186 Ga0496109_1596500
1187 Ga0496109_1799862
1188 Ga0496110_0031802
1189 Ga0496110_0106431
1190 Ga0496110_0148621
1191 Ga0496110_0373367
1192 Ga0496111_0009308
1193 Ga0496111_0012081
1194 Ga0496111_0023887
1195 Ga0496111_0363446
1196 Ga0496111_0472515
1197 Ga0496112_0000012
1198 Ga0496112_0001724
1199 Ga0496112_0549519
1200 Ga0496112_1656578
1201 Ga0496113_0004095
1202 Ga0496113_0014354
1203 Ga0496113_0175758
1204 Ga0496113_0351356
1205 Ga0496114_0023563
1206 Ga0496114_0203968
1207 Ga0496114_0521904
1208 Ga0496114_0537399
1209 Ga0496114_1329543
1210 Ga0501032_0742569
1211 Ga0501036_0122630
1212 Ga0501036_0194189
1213 Ga0501038_0051275
1214 Ga0501038_0168176
1215 Ga0501038_0461617
1216 Ga0501039_0116366
1217 Ga0501040_0084367
1218 Ga0501040_0276043
1219 Ga0501040_0498310
1220 Ga0501041_0072322
1221 Ga0501042_0286504
1222 Ga0501043_0366420
1223 Ga0501046_0091757
1224 Ga0501046_0373215
1225 Ga0501046_0509904
1226 Ga0501048_0110530
1227 Ga0501067_0088884
1228 Ga0501067_0134486
1229 Ga0501067_0372617
1230 Ga0501067_0660236
1231 Ga0501069_0017880
1232 Ga0501069_0020347
1233 Ga0501069_0742299
1234 Ga0501070_0560153
1235 Ga0501070_0697179
1236 Ga0501071_0106691
1237 Ga0501071_0233771
1238 Ga0501071_0365505
1239 Ga0501071_0431178
1240 Ga0501071_0469609
1241 Ga0501072_0042078
1242 Ga0501072_0339873
1243 Ga0501072_0382329
1244 Ga0501074_0325600
1245 Ga0501074_0561423
1246 Ga0501075_0018886
1247 Ga0501075_0697261
1248 Ga0501075_0975937
1249 Ga0501076_0080315
1250 Ga0501076_0107133
1251 Ga0501076_0215322
1252 Ga0501076_0353418
1253 Ga0501077_0043985
1254 Ga0501077_0074743
1255 Ga0501079_0155963
1256 Ga0501079_0213362
1257 Ga0501079_0257385
1258 Ga0501079_0340426
1259 Ga0501080_0060507
1260 Ga0501080_0215236
1261 Ga0501081_0127982
1262 Ga0501081_0139565
1263 Ga0501081_0290408
1264 Ga0501081_0554317
1265 Ga0501083_0077060
1266 Ga0501035_0348278
1267 Ga0501035_0466516
1268 Ga0501035_0673492
1269 Ga0501045_0025256
1270 Ga0501045_0422235
1271 Ga0501045_0527009
1272 Ga0501045_0600443
1273 nmdc:mga05p37_142_c1
1274 nmdc:mga05p37_312688_c1
1275 nmdc:mga08y16_205720_c1
1276 nmdc:mga08y16_63385_c1
1277 nmdc:mga08y16_74591_c1
1278 nmdc:mga08y16_794277_c1
1279 nmdc:mga0n895_100842_c1
1280 nmdc:mga0n895_1053497_c1
1281 nmdc:mga0n895_193305_c1
1282 nmdc:mga0n895_193777_c1
1283 nmdc:mga0n895_2066251_c1
1284 nmdc:mga0rr50_128824_c1
1285 nmdc:mga0rr50_274057_c1
1286 nmdc:mga0a205_1032091_c1
1287 nmdc:mga0a205_18026_c1
1288 nmdc:mga0a205_227930_c1
1289 nmdc:mga0a205_32872_c1
1290 nmdc:mga0a205_91394_c1
1291 Ga0495601_0187861
1292 Ga0495601_0338026
1293 Ga0495612_0000135
1294 Ga0501084_0033498
1295 Ga0501084_0052398
1296 Ga0501084_0941081
1297 Ga0501084_1062978
1298 Ga0501082_0290545
1299 Ga0501082_0505782
1300 Ga0501082_0702980
1301 Ga0501082_0731191
1302 Ga0530510_0008194
1303 Ga0530510_0062834
1304 Ga0530510_0083958
1305 Ga0530510_0503970
1306 Ga0530510_1051873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

25

124

0.85

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

27

135

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9659 2 103
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.959 1 103
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.95 1 103
7bui-assembly1.cif.gz_D complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9419 4 98
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.9407 1 101
ID Description Score Start End Superfamily
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9615 4 104 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.959 1 103 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.95 1 103 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9456 1 106 2.102.10.10
af_Q8IBP8_93_209_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9424 2 107 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A535J0D4-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9965 2 111 GO:0046872
GO:0051537
AF-A0A1F8LNY2-F1-model_v4 Rieske domain-containing protein 0.9853 2 110 GO:0046872
GO:0051537
AF-A0A2E2V209-F1-model_v4 Rieske domain-containing protein 0.9804 4 102 GO:0046872
GO:0051537
AF-A0A1Z9RMC5-F1-model_v4 Rieske domain-containing protein 0.9787 3 102 GO:0046872
GO:0051537
AF-A0A2H0YX92-F1-model_v4 (2Fe-2S)-binding protein 0.9784 2 102 GO:0016020
GO:0046872
GO:0051537

Map