F472747

General Info

Members Datasets Scaffolds Average Seq Length
653 282 1306 365

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100144493|Ga0068858_1001444932
Length 406
Sequence MQNARLPRDMRRASCVDHLHYVFGIFHYLIIMNAVLALEDGTWFRGTAAGAEGLAGGEVVFNTAMTGYQEVLTDPSYAGQIVTMTCPEIGNYGVSSADVESRRPQIAGFIVREESPVASNWRAQGTLHDYLVANGIVAIAGIDTRALTRRLRSGGVMRGVIGTGADLDPAALVERANGVPKMEGSDLVRVVTSEQPFDWPEEDPDEFGVSLDRRPGRRLKIAAYDFGMKWNILRRLSAHGCDVRVYPAGTPASDLLATSPDGVFLSNGPGDPAPLTYAIDNAKALVDANVPVFGICLGHQILGLAMGGSTFKLKFGHRGANHPVKKLETGKIEITSQNHGFAVDPESLPPDVAVTHVNLYDGTVEGLRHRSRPVFSVQYHPEASPGPHDADYLFDDFIRLIEGAGD

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
197 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
198 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 4.29
Rhizosphere 92.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100144493 3300005842 Bacteria 2234
2 JGI25406J46586_10000720 3300003203 Bacteria 15444
3 JGI25406J46586_10018012 3300003203 Bacteria 2908
4 Ga0065712_10079566 3300005290 Bacteria 3189
5 Ga0065712_10090928 3300005290 Bacteria 2396
6 Ga0065712_10110827 3300005290 Bacteria 1829
7 Ga0065715_10116390 3300005293 Bacteria 2383
8 Ga0065715_10146192 3300005293 Bacteria 1785
9 Ga0065707_10021340 3300005295 Bacteria 1334
10 Ga0070676_10000123 3300005328 Bacteria 28716
11 Ga0070683_100002095 3300005329 Bacteria 15748
12 Ga0070683_100115438 3300005329 Bacteria 2535
13 Ga0070690_100202220 3300005330 Bacteria 1383
14 Ga0070670_100009026 3300005331 Bacteria 8518
15 Ga0070670_100012759 3300005331 Bacteria 7191
16 Ga0070670_100016598 3300005331 Bacteria 6318
17 Ga0070677_10028038 3300005333 Bacteria 2125
18 Ga0068869_100068125 3300005334 Bacteria 2628
19 Ga0068869_100273604 3300005334 Bacteria 1356
20 Ga0070666_10053745 3300005335 Bacteria 2717
21 Ga0070666_10093498 3300005335 Bacteria 2067
22 Ga0068868_100067503 3300005338 Bacteria 2847
23 Ga0068868_100133965 3300005338 Bacteria 2030
24 Ga0070660_100008050 3300005339 Bacteria 7367
25 Ga0070691_10001542 3300005341 Bacteria 9924
26 Ga0070691_10100625 3300005341 Bacteria 1435
27 Ga0070687_100097643 3300005343 Bacteria 1638
28 Ga0070661_100026883 3300005344 Bacteria 4142
29 Ga0070661_100045578 3300005344 Bacteria 3206
30 Ga0070668_100048880 3300005347 Bacteria 3254
31 Ga0070669_100010204 3300005353 Bacteria 6673
32 Ga0070669_100030395 3300005353 Bacteria 3897
33 Ga0070669_100108810 3300005353 Bacteria 2101
34 Ga0070675_100003393 3300005354 Bacteria 12068
35 Ga0070675_100074833 3300005354 Bacteria 2814
36 Ga0070675_100227292 3300005354 Bacteria 1627
37 Ga0070675_100276651 3300005354 Bacteria 1474
38 Ga0070671_100047993 3300005355 Bacteria 3550
39 Ga0070671_100104400 3300005355 Bacteria 2378
40 Ga0070674_100035038 3300005356 Bacteria 3358
41 Ga0070673_100006795 3300005364 Bacteria 7470
42 Ga0070673_100063782 3300005364 Bacteria 2933
43 Ga0070673_100126284 3300005364 Bacteria 2141
44 Ga0070673_100178645 3300005364 Bacteria 1816
45 Ga0070688_100026027 3300005365 Bacteria 3471
46 Ga0070659_100043589 3300005366 Bacteria 3509
47 Ga0070709_10095306 3300005434 Bacteria 1971
48 Ga0070714_100033550 3300005435 Bacteria 4292
49 Ga0070713_100121578 3300005436 Bacteria 2291
50 Ga0070713_100156572 3300005436 Bacteria 2031
51 Ga0070701_10041480 3300005438 Bacteria 2345
52 Ga0070711_100128518 3300005439 Bacteria 1884
53 Ga0070705_100087155 3300005440 Bacteria 1935
54 Ga0070700_100003499 3300005441 Bacteria 8100
55 Ga0070700_100004871 3300005441 Bacteria 7054
56 Ga0070700_100070738 3300005441 Bacteria 2225
57 Ga0070700_100094909 3300005441 Bacteria 1954
58 Ga0070694_100099330 3300005444 Bacteria 2056
59 Ga0070694_100100070 3300005444 Bacteria 2050
60 Ga0070694_100101024 3300005444 Bacteria 2040
61 Ga0070708_100168766 3300005445 Bacteria 2042
62 Ga0070678_100018105 3300005456 Bacteria 4558
63 Ga0070678_100239709 3300005456 Bacteria 1516
64 Ga0070662_100053024 3300005457 Bacteria 2935
65 Ga0070681_10007252 3300005458 Bacteria 10818
66 Ga0070681_10035608 3300005458 Bacteria 5001
67 Ga0068867_100311411 3300005459 Bacteria 1301
68 Ga0070707_100142828 3300005468 Bacteria 2330
69 Ga0070698_100007563 3300005471 Bacteria 11752
70 Ga0070698_100015655 3300005471 Bacteria 8010
71 Ga0070698_100230394 3300005471 Bacteria 1786
72 Ga0070699_100023906 3300005518 Bacteria 5267
73 Ga0070699_100135856 3300005518 Bacteria 2169
74 Ga0070699_100245014 3300005518 Bacteria 1601
75 Ga0070679_100105036 3300005530 Bacteria 2811
76 Ga0070684_100001883 3300005535 Bacteria 15371
77 Ga0070672_100017734 3300005543 Bacteria 5131
78 Ga0070672_100136692 3300005543 Bacteria 2019
79 Ga0070672_100365479 3300005543 Bacteria 1232
80 Ga0070686_100000519 3300005544 Bacteria 23065
81 Ga0070695_100004353 3300005545 Bacteria 8299
82 Ga0070693_100100552 3300005547 Bacteria 1761
83 Ga0070665_100003640 3300005548 Bacteria 16325
84 Ga0070704_100005590 3300005549 Bacteria 7338
85 Ga0070704_100061107 3300005549 Bacteria 2695
86 Ga0068855_100089285 3300005563 Bacteria 3558
87 Ga0068855_100238973 3300005563 Bacteria 2030
88 Ga0070664_100001463 3300005564 Bacteria 18814
89 Ga0068857_100063046 3300005577 Bacteria 3295
90 Ga0068854_100002180 3300005578 Bacteria 12038
91 Ga0068854_100060860 3300005578 Bacteria 2733
92 Ga0068856_100052115 3300005614 Bacteria 4035
93 Ga0070702_100038461 3300005615 Bacteria 2664
94 Ga0068859_100012670 3300005617 Bacteria 8479
95 Ga0068859_100177060 3300005617 Bacteria 2215
96 Ga0068859_100284973 3300005617 Bacteria 1745
97 Ga0068864_100031104 3300005618 Bacteria 4527
98 Ga0068864_100316534 3300005618 Bacteria 1464
99 Ga0068864_100395256 3300005618 Bacteria 1313
100 Ga0068866_10029582 3300005718 Bacteria 2621
101 Ga0068866_10084897 3300005718 Bacteria 1710
102 Ga0068861_100047543 3300005719 Bacteria 3239
103 Ga0068861_100088913 3300005719 Bacteria 2434
104 Ga0068861_100144306 3300005719 Bacteria 1946
105 Ga0068861_100205290 3300005719 Bacteria 1657
106 Ga0068863_100002786 3300005841 Bacteria 17315
107 Ga0068858_100009357 3300005842 Bacteria 9353
108 Ga0068858_100024856 3300005842 Bacteria 5577
109 Ga0068858_100161981 3300005842 Bacteria 2106
110 Ga0068858_100226704 3300005842 Bacteria 1771
111 Ga0068858_100322318 3300005842 Bacteria 1477
112 Ga0068860_100022539 3300005843 Bacteria 6090
113 Ga0068860_100025179 3300005843 Bacteria 5741
114 Ga0068860_100085944 3300005843 Bacteria 2993
115 Ga0068862_100071102 3300005844 Bacteria 3005
116 Ga0068862_100254940 3300005844 Bacteria 1600
117 Ga0068862_100294470 3300005844 Bacteria 1491
118 Ga0081455_10181629 3300005937 Bacteria 1592
119 Ga0081455_10227478 3300005937 Bacteria 1379
120 Ga0081538_10025129 3300005981 Bacteria 4214
121 Ga0081539_10000034 3300005985 Bacteria 307597
122 Ga0081539_10000151 3300005985 Bacteria 160054
123 Ga0081539_10004286 3300005985 Bacteria 15997
124 Ga0075365_10045592 3300006038 Bacteria 2877
125 Ga0075365_10072326 3300006038 Bacteria 2323
126 Ga0075368_10043977 3300006042 Bacteria 1761
127 Ga0075364_10002744 3300006051 Bacteria 9897
128 Ga0075364_10060563 3300006051 Bacteria 2482
129 Ga0070715_10030219 3300006163 Bacteria 2188
130 Ga0075367_10021114 3300006178 Bacteria 3635
131 Ga0075367_10052460 3300006178 Bacteria 2414
132 Ga0075366_10004929 3300006195 Bacteria 7200
133 Ga0097621_100228894 3300006237 Bacteria 1622
134 Ga0075370_10113330 3300006353 Bacteria 1575
135 Ga0068871_100301699 3300006358 Bacteria 1406
136 Ga0075428_100011096 3300006844 Bacteria 10024
137 Ga0075428_100015839 3300006844 Bacteria 8345
138 Ga0075428_100040085 3300006844 Bacteria 5154
139 Ga0075428_100103690 3300006844 Bacteria 3101
140 Ga0075428_100240978 3300006844 Bacteria 1951
141 Ga0075428_100390009 3300006844 Bacteria 1493
142 Ga0075430_100006386 3300006846 Bacteria 9938
143 Ga0075430_100008184 3300006846 Bacteria 8837
144 Ga0075430_100160229 3300006846 Bacteria 1873
145 Ga0075431_100007561 3300006847 Bacteria 10819
146 Ga0075431_100013825 3300006847 Bacteria 8152
147 Ga0075431_100042138 3300006847 Bacteria 4708
148 Ga0075431_100048072 3300006847 Bacteria 4400
149 Ga0075431_100095037 3300006847 Bacteria 3077
150 Ga0075431_100190077 3300006847 Bacteria 2104
151 Ga0075431_100397760 3300006847 Bacteria 1379
152 Ga0075433_10014397 3300006852 Bacteria 6460
153 Ga0075433_10044123 3300006852 Bacteria 3873
154 Ga0075433_10225879 3300006852 Bacteria 1663
155 Ga0075434_100017813 3300006871 Bacteria 6851
156 Ga0075434_100020190 3300006871 Bacteria 6457
157 Ga0075434_100082400 3300006871 Bacteria 3214
158 Ga0075434_100198669 3300006871 Bacteria 2025
159 Ga0075434_100301867 3300006871 Bacteria 1622
160 Ga0075429_100018117 3300006880 Bacteria 6094
161 Ga0075429_100035169 3300006880 Bacteria 4356
162 Ga0068865_100023965 3300006881 Bacteria 4000
163 Ga0068865_100088808 3300006881 Bacteria 2237
164 Ga0075436_100024452 3300006914 Bacteria 4152
165 Ga0075436_100030387 3300006914 Bacteria 3718
166 Ga0075436_100064808 3300006914 Bacteria 2526
167 Ga0075436_100069859 3300006914 Bacteria 2427
168 Ga0075436_100095301 3300006914 Bacteria 2070
169 Ga0097620_100012670 3300006931 Bacteria 8479
170 Ga0097620_100177073 3300006931 Bacteria 2215
171 Ga0097620_100284994 3300006931 Bacteria 1745
172 Ga0075435_100000722 3300007076 Bacteria 20521
173 Ga0075435_100001014 3300007076 Bacteria 17816
174 Ga0075435_100006276 3300007076 Bacteria 8391
175 Ga0075435_100006504 3300007076 Bacteria 8267
176 Ga0075435_100032117 3300007076 Bacteria 4144
177 Ga0105240_10012723 3300009093 Bacteria 11598
178 Ga0105240_10119395 3300009093 Bacteria 3176
179 Ga0105240_10410075 3300009093 Bacteria 1524
180 Ga0111539_10000775 3300009094 Bacteria 41523
181 Ga0111539_10003755 3300009094 Bacteria 19994
182 Ga0111539_10005320 3300009094 Bacteria 16658
183 Ga0111539_10008877 3300009094 Bacteria 12727
184 Ga0111539_10073584 3300009094 Bacteria 4029
185 Ga0111539_10086459 3300009094 Bacteria 3684
186 Ga0111539_10117259 3300009094 Bacteria 3121
187 Ga0111539_10163784 3300009094 Bacteria 2601
188 Ga0111539_10413298 3300009094 Bacteria 1571
189 Ga0111539_10467093 3300009094 Bacteria 1469
190 Ga0105245_10032401 3300009098 Bacteria 4626
191 Ga0105245_10166214 3300009098 Bacteria 2097
192 Ga0105245_10263451 3300009098 Bacteria 1678
193 Ga0105245_10338276 3300009098 Bacteria 1488
194 Ga0114129_10000006 3300009147 Bacteria 157531
195 Ga0114129_10001414 3300009147 Bacteria 32334
196 Ga0114129_10006684 3300009147 Bacteria 16377
197 Ga0114129_10008287 3300009147 Bacteria 14826
198 Ga0114129_10008520 3300009147 Bacteria 14616
199 Ga0114129_10008618 3300009147 Bacteria 14540
200 Ga0114129_10022628 3300009147 Bacteria 8914
201 Ga0114129_10028767 3300009147 Bacteria 7874
202 Ga0114129_10042710 3300009147 Bacteria 6381
203 Ga0114129_10065107 3300009147 Bacteria 5088
204 Ga0114129_10066307 3300009147 Bacteria 5036
205 Ga0114129_10067293 3300009147 Bacteria 4996
206 Ga0114129_10131892 3300009147 Bacteria 3430
207 Ga0114129_10161680 3300009147 Bacteria 3058
208 Ga0114129_10164937 3300009147 Bacteria 3024
209 Ga0114129_10170456 3300009147 Bacteria 2968
210 Ga0114129_10317083 3300009147 Bacteria 2073
211 Ga0114129_10507780 3300009147 Bacteria 1574
212 Ga0105243_10020562 3300009148 Bacteria 5004
213 Ga0105243_10066053 3300009148 Bacteria 2908
214 Ga0105241_10051171 3300009174 Bacteria 3149
215 Ga0105241_10337934 3300009174 Bacteria 1304
216 Ga0105242_10018903 3300009176 Bacteria 5395
217 Ga0105242_10143377 3300009176 Bacteria 2075
218 Ga0105248_10003534 3300009177 Bacteria 17337
219 Ga0105248_10027600 3300009177 Bacteria 6322
220 Ga0105248_10082481 3300009177 Bacteria 3616
221 Ga0105248_10089028 3300009177 Bacteria 3474
222 Ga0105248_10117505 3300009177 Bacteria 2999
223 Ga0105248_10236542 3300009177 Bacteria 2056
224 Ga0105248_10335118 3300009177 Bacteria 1704
225 Ga0105249_10069289 3300009553 Bacteria 3255
226 Ga0105249_10092206 3300009553 Bacteria 2836
227 Ga0105249_10097805 3300009553 Bacteria 2756
228 Ga0157374_10294018 3300013296 Bacteria 1606
229 Ga0157378_10237168 3300013297 Bacteria 1741
230 Ga0163162_10092833 3300013306 Bacteria 3103
231 Ga0163162_10105740 3300013306 Bacteria 2909
232 Ga0163162_10120042 3300013306 Bacteria 2732
233 Ga0157372_10494928 3300013307 Bacteria 1425
234 Ga0157375_10204282 3300013308 Bacteria 2132
235 Ga0157375_10218602 3300013308 Bacteria 2063
236 Ga0163163_10000022 3300014325 Bacteria 187289
237 Ga0163163_10010603 3300014325 Bacteria 8301
238 Ga0163163_10014917 3300014325 Bacteria 7159
239 Ga0163163_10208174 3300014325 Bacteria 2004
240 Ga0157380_10017574 3300014326 Bacteria 5292
241 Ga0157380_10243293 3300014326 Bacteria 1624
242 Ga0157377_10178987 3300014745 Bacteria 1332
243 Ga0157379_10014964 3300014968 Bacteria 6804
244 Ga0157379_10052515 3300014968 Bacteria 3641
245 Ga0157379_10053202 3300014968 Bacteria 3617
246 Ga0157376_10006537 3300014969 Bacteria 8246
247 Ga0157376_10029990 3300014969 Bacteria 4337
248 Ga0157376_10123602 3300014969 Bacteria 2298
249 Ga0163161_10144755 3300017792 Bacteria 1802
250 Ga0207697_10004455 3300025315 Bacteria 6689
251 Ga0207697_10034694 3300025315 Bacteria 2065
252 Ga0207656_10067907 3300025321 Bacteria 1579
253 Ga0207682_10024461 3300025893 Bacteria 2391
254 Ga0207642_10025178 3300025899 Bacteria 2403
255 Ga0207688_10005864 3300025901 Bacteria 6684
256 Ga0207680_10078653 3300025903 Bacteria 2066
257 Ga0207680_10079623 3300025903 Bacteria 2055
258 Ga0207645_10002358 3300025907 Bacteria 14892
259 Ga0207645_10024221 3300025907 Bacteria 3938
260 Ga0207654_10104743 3300025911 Bacteria 1749
261 Ga0207707_10011448 3300025912 Bacteria 7727
262 Ga0207707_10051611 3300025912 Bacteria 3582
263 Ga0207707_10060340 3300025912 Bacteria 3300
264 Ga0207695_10035836 3300025913 Bacteria 5371
265 Ga0207695_10041838 3300025913 Bacteria 4901
266 Ga0207662_10022781 3300025918 Bacteria 3595
267 Ga0207662_10126383 3300025918 Bacteria 1608
268 Ga0207657_10048347 3300025919 Bacteria 3714
269 Ga0207649_10088227 3300025920 Bacteria 2025
270 Ga0207652_10009649 3300025921 Bacteria 7765
271 Ga0207681_10018588 3300025923 Bacteria 4381
272 Ga0207681_10029404 3300025923 Bacteria 3568
273 Ga0207681_10203809 3300025923 Bacteria 1520
274 Ga0207650_10013245 3300025925 Bacteria 5705
275 Ga0207650_10025314 3300025925 Bacteria 4226
276 Ga0207650_10028048 3300025925 Bacteria 4035
277 Ga0207659_10065023 3300025926 Bacteria 2642
278 Ga0207687_10161989 3300025927 Bacteria 1718
279 Ga0207700_10168578 3300025928 Bacteria 1825
280 Ga0207664_10123349 3300025929 Bacteria 2171
281 Ga0207644_10034347 3300025931 Bacteria 3548
282 Ga0207644_10065607 3300025931 Bacteria 2640
283 Ga0207644_10177619 3300025931 Bacteria 1667
284 Ga0207644_10359744 3300025931 Bacteria 1184
285 Ga0207690_10113514 3300025932 Bacteria 1955
286 Ga0207706_10097373 3300025933 Bacteria 2588
287 Ga0207706_10153423 3300025933 Bacteria 2026
288 Ga0207706_10155127 3300025933 Bacteria 2014
289 Ga0207706_10166433 3300025933 Bacteria 1937
290 Ga0207686_10078379 3300025934 Bacteria 2148
291 Ga0207709_10153036 3300025935 Bacteria 1600
292 Ga0207670_10079536 3300025936 Bacteria 2289
293 Ga0207704_10087853 3300025938 Bacteria 2032
294 Ga0207691_10007037 3300025940 Bacteria 10851
295 Ga0207691_10025236 3300025940 Bacteria 5581
296 Ga0207691_10050251 3300025940 Bacteria 3818
297 Ga0207691_10182990 3300025940 Bacteria 1830
298 Ga0207691_10198612 3300025940 Bacteria 1746
299 Ga0207711_10096659 3300025941 Bacteria 2607
300 Ga0207711_10167358 3300025941 Bacteria 1993
301 Ga0207711_10177340 3300025941 Bacteria 1936
302 Ga0207711_10236647 3300025941 Bacteria 1674
303 Ga0207711_10332573 3300025941 Bacteria 1405
304 Ga0207661_10051019 3300025944 Bacteria 3299
305 Ga0207661_10086733 3300025944 Bacteria 2598
306 Ga0207661_10110066 3300025944 Bacteria 2328
307 Ga0207661_10123025 3300025944 Bacteria 2212
308 Ga0207667_10046339 3300025949 Bacteria 4603
309 Ga0207651_10043474 3300025960 Bacteria 2999
310 Ga0207651_10382431 3300025960 Bacteria 1193
311 Ga0207712_10121044 3300025961 Bacteria 1980
312 Ga0207668_10011554 3300025972 Bacteria 5371
313 Ga0207668_10067519 3300025972 Bacteria 2539
314 Ga0207668_10102366 3300025972 Bacteria 2131
315 Ga0207640_10049150 3300025981 Bacteria 2729
316 Ga0207658_10095720 3300025986 Bacteria 2314
317 Ga0207677_10039016 3300026023 Bacteria 3119
318 Ga0207677_10225466 3300026023 Bacteria 1506
319 Ga0207703_10015458 3300026035 Bacteria 5950
320 Ga0207703_10021268 3300026035 Bacteria 5080
321 Ga0207703_10092497 3300026035 Bacteria 2546
322 Ga0207703_10156795 3300026035 Bacteria 1990
323 Ga0207703_10377193 3300026035 Bacteria 1311
324 Ga0207639_10415027 3300026041 Bacteria 1216
325 Ga0207708_10000478 3300026075 Bacteria 30880
326 Ga0207708_10019949 3300026075 Bacteria 5054
327 Ga0207708_10049147 3300026075 Bacteria 3211
328 Ga0207708_10128045 3300026075 Bacteria 1983
329 Ga0207702_10061905 3300026078 Bacteria 3194
330 Ga0207641_10093043 3300026088 Bacteria 2642
331 Ga0207641_10154429 3300026088 Bacteria 2081
332 Ga0207641_10427222 3300026088 Bacteria 1277
333 Ga0207648_10002141 3300026089 Bacteria 21470
334 Ga0207648_10005864 3300026089 Bacteria 12291
335 Ga0207648_10057831 3300026089 Bacteria 3383
336 Ga0207648_10112898 3300026089 Bacteria 2386
337 Ga0207676_10021228 3300026095 Bacteria 4764
338 Ga0207676_10073603 3300026095 Bacteria 2750
339 Ga0207674_10038018 3300026116 Bacteria 5001
340 Ga0207674_10138102 3300026116 Bacteria 2398
341 Ga0207674_10318011 3300026116 Bacteria 1506
342 Ga0207675_100074782 3300026118 Bacteria 3170
343 Ga0207675_100136975 3300026118 Bacteria 2324
344 Ga0207675_100151543 3300026118 Bacteria 2207
345 Ga0207675_100177491 3300026118 Bacteria 2038
346 Ga0207675_100326218 3300026118 Bacteria 1500
347 Ga0207683_10007567 3300026121 Bacteria 9306
348 Ga0207683_10208023 3300026121 Bacteria 1780
349 Ga0207683_10241982 3300026121 Bacteria 1646
350 Ga0209983_1001570 3300027665 Bacteria 5060
351 Ga0209813_10012631 3300027866 Bacteria 2238
352 Ga0209974_10004350 3300027876 Bacteria 5038
353 Ga0207428_10001413 3300027907 Bacteria 25302
354 Ga0207428_10007462 3300027907 Bacteria 9968
355 Ga0207428_10013142 3300027907 Bacteria 7247
356 Ga0207428_10025161 3300027907 Bacteria 4985
357 Ga0207428_10027482 3300027907 Bacteria 4736
358 Ga0207428_10147685 3300027907 Bacteria 1791
359 Ga0268266_10034338 3300028379 Bacteria 4314
360 Ga0268266_10239057 3300028379 Bacteria 1675
361 Ga0268265_10046019 3300028380 Bacteria 3259
362 Ga0268265_10060336 3300028380 Bacteria 2906
363 Ga0268265_10433471 3300028380 Bacteria 1223
364 Ga0268264_10061603 3300028381 Bacteria 3148
365 Ga0268264_10159747 3300028381 Bacteria 2029
366 Ga0268264_10160826 3300028381 Bacteria 2023
367 Ga0265322_10016763 3300028654 Bacteria 2113
368 Ga0265330_10000891 3300031235 Bacteria 18559
369 Ga0265329_10005409 3300031242 Bacteria 5162
370 Ga0265316_10003452 3300031344 Bacteria 15984
371 Ga0265342_10000299 3300031712 Bacteria 56319
372 Ga0307405_10109315 3300031731 Bacteria 1870
373 Ga0307406_10200893 3300031901 Bacteria 1467
374 Ga0307406_10217805 3300031901 Bacteria 1417
375 Ga0307407_10176330 3300031903 Bacteria 1413
376 Ga0307409_100146182 3300031995 Bacteria 2045
377 Ga0307416_100034118 3300032002 Bacteria 3868
378 Ga0307416_100047030 3300032002 Bacteria 3411
379 Ga0307416_100109375 3300032002 Bacteria 2431
380 Ga0307416_100117725 3300032002 Bacteria 2359
381 Ga0307411_10023839 3300032005 Bacteria 3635
382 Ga0307411_10045072 3300032005 Bacteria 2834
383 Ga0307415_100016873 3300032126 Bacteria 4366
384 Ga0316583_10034779 3300032133 Bacteria 1788
385 Ga0373950_0002149 3300034818 Bacteria 2682
386 Ga0373959_0001998 3300034820 Bacteria 3246
387 Ga0373926_0009081 3300035083 Bacteria 3318
388 Ga0373928_0003170 3300035084 Bacteria 3150
389 Ga0373928_0007467 3300035084 Bacteria 2109
390 Ga0373929_0001397 3300035085 Bacteria 4627
391 Ga0373934_0001433 3300035086 Bacteria 8722
392 Ga0373940_0001724 3300035088 Bacteria 4053
393 Ga0373944_0016905 3300035089 Bacteria 2064
394 Ga0373949_0007738 3300035090 Bacteria 2354
395 Ga0373951_0000985 3300035091 Bacteria 7643
396 Ga0373952_0002914 3300035092 Bacteria 3092
397 Ga0373932_0000886 3300035112 Bacteria 8762
398 Ga0373956_0006432 3300035119 Bacteria 4708
399 Ga0373957_0007530 3300035120 Bacteria 3486
400 Ga0373943_0004179 3300035170 Bacteria 6549
401 Ga0373961_0000871 3300035241 Bacteria 10163
402 Ga0373924_0000460 3300035410 Bacteria 12507
403 Ga0373931_0010703 3300035691 Bacteria 4414
404 Ga0373933_0002982 3300035724 Bacteria 9437
405 Ga0373947_0022283 3300035725 Bacteria 3672
406 Ga0373937_0002313 3300036401 Bacteria 15914
407 Ga0373937_0177731 3300036401 Bacteria 1998
408 Ga0373937_0240990 3300036401 Bacteria 1704
409 Ga0373937_0452070 3300036401 Bacteria 1220
410 Ga0316584_0144506 3300036712 Bacteria 1773
411 Ga0373925_0009394 3300037068 Bacteria 7119
412 Ga0373925_0097158 3300037068 Bacteria 2259
413 Ga0373925_0319089 3300037068 Bacteria 1257
414 Ga0395905_0060964 3300037471 Bacteria 3528
415 Ga0439439_0036639 3300041406 Bacteria 1263
416 Ga0439461_0019183 3300041410 Bacteria 1345
417 Ga0439433_0012101 3300041999 Bacteria 1891
418 Ga0439443_008239 3300042003 Bacteria 1467
419 Ga0439435_0005568 3300042436 Bacteria 2777
420 Ga0439460_0018878 3300042461 Bacteria 1862
421 Ga0451577_0152196 3300042876 Bacteria 2082
422 Ga0466963_0022873 3300044694 Bacteria 3963
423 Ga0453684_0031449 3300044712 Bacteria 7459
424 Ga0466970_0170203 3300044765 Bacteria 1207
425 Ga0466957_0158747 3300044842 Bacteria 1467
426 Ga0451576_0005062 3300045051 Bacteria 16715
427 Ga0451576_0019288 3300045051 Bacteria 7445
428 Ga0451576_0181579 3300045051 Bacteria 2197
429 Ga0451576_0399987 3300045051 Bacteria 1440
430 Ga0451576_0612037 3300045051 Bacteria 1145
431 Ga0466958_0182784 3300045836 Bacteria 1331
432 Ga0466967_0351448 3300045976 Bacteria 1427
433 Ga0495603_0122117 3300046455 Bacteria 1517
434 Ga0495629_0056279 3300046459 Bacteria 2750
435 Ga0495629_0089353 3300046459 Bacteria 2149
436 Ga0495629_0261768 3300046459 Bacteria 1189
437 Ga0495628_0173372 3300046516 Bacteria 1635
438 Ga0495628_0197872 3300046516 Bacteria 1515
439 Ga0495640_0057958 3300046533 Bacteria 2643
440 Ga0495645_0006016 3300046543 Bacteria 8392
441 Ga0495656_0097933 3300046615 Bacteria 1352
442 Ga0495599_0087570 3300046678 Bacteria 1944
443 Ga0495658_0029730 3300046683 Bacteria 2961
444 Ga0496100_0071571 3300048903 Bacteria 2316
445 Ga0496101_0041817 3300048904 Bacteria 3270
446 Ga0496101_0093788 3300048904 Bacteria 2236
447 Ga0496104_0007455 3300048907 Bacteria 9667
448 Ga0496104_0022529 3300048907 Bacteria 5786
449 Ga0496104_0086146 3300048907 Bacteria 2999
450 Ga0496104_0119302 3300048907 Bacteria 2533
451 Ga0496104_0189283 3300048907 Bacteria 1969
452 Ga0496104_0198591 3300048907 Bacteria 1918
453 Ga0496104_0339984 3300048907 Bacteria 1414
454 Ga0496105_0089356 3300048908 Bacteria 2545
455 Ga0496108_0007791 3300048911 Bacteria 8676
456 Ga0496108_0068740 3300048911 Bacteria 2989
457 Ga0496109_0000495 3300048912 Bacteria 33702
458 Ga0496109_0232197 3300048912 Bacteria 1736
459 Ga0496110_0001823 3300048913 Bacteria 15706
460 Ga0496110_0057063 3300048913 Bacteria 3437
461 Ga0496110_0095000 3300048913 Bacteria 2670
462 Ga0496111_0080834 3300048914 Bacteria 2372
463 Ga0496112_0003258 3300048915 Bacteria 13392
464 Ga0496112_0016048 3300048915 Bacteria 7003
465 Ga0496112_0039726 3300048915 Bacteria 4599
466 Ga0496112_0058695 3300048915 Bacteria 3790
467 Ga0496112_0286573 3300048915 Bacteria 1593
468 Ga0496113_0027491 3300048916 Bacteria 4079
469 Ga0496113_0073854 3300048916 Bacteria 2599
470 Ga0496114_0132173 3300048917 Bacteria 2156
471 Ga0496114_0170656 3300048917 Bacteria 1895
472 Ga0501031_0000349 3300049568 Bacteria 26809
473 Ga0501031_0030592 3300049568 Bacteria 3512
474 Ga0501031_0067135 3300049568 Bacteria 2337
475 Ga0501033_0002398 3300049570 Bacteria 15949
476 Ga0501033_0019677 3300049570 Bacteria 5101
477 Ga0501033_0095188 3300049570 Bacteria 2176
478 Ga0501034_0008746 3300049571 Bacteria 10655
479 Ga0501034_0054925 3300049571 Bacteria 4008
480 Ga0501034_0167096 3300049571 Bacteria 2168
481 Ga0501036_0010984 3300049572 Bacteria 7487
482 Ga0501036_0016766 3300049572 Bacteria 6119
483 Ga0501036_0024486 3300049572 Bacteria 5089
484 Ga0501036_0083221 3300049572 Bacteria 2705
485 Ga0501037_0004137 3300049573 Bacteria 10529
486 Ga0501037_0006139 3300049573 Bacteria 8775
487 Ga0501037_0143712 3300049573 Bacteria 1707
488 Ga0501038_0009002 3300049574 Bacteria 9162
489 Ga0501038_0027944 3300049574 Bacteria 5012
490 Ga0501038_0030252 3300049574 Bacteria 4793
491 Ga0501039_0019305 3300049575 Bacteria 5226
492 Ga0501039_0021549 3300049575 Bacteria 4943
493 Ga0501039_0054301 3300049575 Bacteria 3101
494 Ga0501040_0002396 3300049576 Bacteria 12061
495 Ga0501040_0159921 3300049576 Bacteria 1592
496 Ga0501041_0048230 3300049577 Bacteria 2594
497 Ga0501041_0053109 3300049577 Bacteria 2471
498 Ga0501041_0055257 3300049577 Bacteria 2423
499 Ga0501042_0000533 3300049578 Bacteria 19905
500 Ga0501042_0014358 3300049578 Bacteria 5405
501 Ga0501042_0084553 3300049578 Bacteria 2275
502 Ga0501043_0023236 3300049579 Bacteria 4863
503 Ga0501043_0026534 3300049579 Bacteria 4544
504 Ga0501043_0061039 3300049579 Bacteria 2960
505 Ga0501046_0002001 3300049580 Bacteria 19343
506 Ga0501046_0008702 3300049580 Bacteria 8821
507 Ga0501046_0017316 3300049580 Bacteria 6016
508 Ga0501046_0030024 3300049580 Bacteria 4415
509 Ga0501046_0228506 3300049580 Bacteria 1376
510 Ga0501047_0027772 3300049581 Bacteria 5452
511 Ga0501047_0229965 3300049581 Bacteria 1708
512 Ga0501048_0012214 3300049582 Bacteria 6395
513 Ga0501048_0024981 3300049582 Bacteria 4358
514 Ga0501048_0088315 3300049582 Bacteria 2187
515 Ga0501048_0267169 3300049582 Bacteria 1215
516 Ga0501067_0006327 3300049583 Bacteria 6565
517 Ga0501067_0053814 3300049583 Bacteria 2230
518 Ga0501067_0111191 3300049583 Bacteria 1523
519 Ga0501068_0000628 3300049584 Bacteria 18009
520 Ga0501068_0063475 3300049584 Bacteria 2247
521 Ga0501069_0000934 3300049585 Bacteria 13950
522 Ga0501069_0022705 3300049585 Bacteria 3416
523 Ga0501070_0020421 3300049586 Bacteria 5556
524 Ga0501070_0020626 3300049586 Bacteria 5527
525 Ga0501070_0117112 3300049586 Bacteria 2200
526 Ga0501071_0002554 3300049587 Bacteria 11095
527 Ga0501071_0013666 3300049587 Bacteria 5537
528 Ga0501071_0068605 3300049587 Bacteria 2580
529 Ga0501071_0095343 3300049587 Bacteria 2189
530 Ga0501071_0192823 3300049587 Bacteria 1529
531 Ga0501072_0008108 3300049588 Bacteria 7970
532 Ga0501072_0031647 3300049588 Bacteria 4143
533 Ga0501072_0137880 3300049588 Bacteria 1945
534 Ga0501073_0072445 3300049589 Bacteria 2399
535 Ga0501074_0048475 3300049590 Bacteria 3068
536 Ga0501074_0058579 3300049590 Bacteria 2775
537 Ga0501074_0114033 3300049590 Bacteria 1933
538 Ga0501075_0000977 3300049591 Bacteria 18200
539 Ga0501075_0132676 3300049591 Bacteria 1897
540 Ga0501075_0139467 3300049591 Bacteria 1847
541 Ga0501075_0275458 3300049591 Bacteria 1282
542 Ga0501076_0093237 3300049592 Bacteria 2423
543 Ga0501076_0167479 3300049592 Bacteria 1791
544 Ga0501077_0160826 3300049593 Bacteria 1426
545 Ga0501079_0001695 3300049741 Bacteria 15684
546 Ga0501079_0004939 3300049741 Bacteria 9886
547 Ga0501079_0013857 3300049741 Bacteria 6150
548 Ga0501079_0019608 3300049741 Bacteria 5164
549 Ga0501079_0057475 3300049741 Bacteria 3002
550 Ga0501079_0105627 3300049741 Bacteria 2185
551 Ga0501080_0011443 3300049742 Bacteria 8125
552 Ga0501080_0013430 3300049742 Bacteria 7535
553 Ga0501080_0026958 3300049742 Bacteria 5342
554 Ga0501081_0000743 3300049743 Bacteria 19045
555 Ga0501081_0029516 3300049743 Bacteria 3706
556 Ga0501081_0046918 3300049743 Bacteria 2971
557 Ga0501081_0138041 3300049743 Bacteria 1746
558 Ga0501035_0005874 3300049822 Bacteria 11563
559 Ga0501035_0133704 3300049822 Bacteria 2161
560 Ga0501044_0012286 3300049823 Bacteria 9272
561 Ga0501044_0025445 3300049823 Bacteria 6272
562 Ga0501044_0108719 3300049823 Bacteria 2783
563 Ga0501045_0004142 3300049824 Bacteria 10015
564 Ga0501045_0010030 3300049824 Bacteria 6626
565 Ga0501045_0056678 3300049824 Bacteria 2866
566 Ga0501045_0078028 3300049824 Bacteria 2441
567 nmdc:mga00v17_4213_c1 3300050491 Bacteria 7463
568 nmdc:mga00v17_67611_c1 3300050491 Bacteria 2208
569 nmdc:mga0yw44_14177_c1 3300050492 Bacteria 4221
570 nmdc:mga0yw44_80538_c1 3300050492 Bacteria 2040
571 nmdc:mga0k408_7714_c1 3300050493 Bacteria 5751
572 nmdc:mga06z11_30953_c1 3300050494 Bacteria 2595
573 nmdc:mga06z11_33502_c1 3300050494 Bacteria 2514
574 nmdc:mga04h51_14608_c1 3300050495 Bacteria 2247
575 nmdc:mga04h51_22756_c1 3300050495 Bacteria 1900
576 nmdc:mga05p37_1045_c1 3300050507 Bacteria 31578
577 nmdc:mga05p37_10896_c1 3300050507 Bacteria 10796
578 nmdc:mga05p37_11646_c1 3300050507 Bacteria 10482
579 nmdc:mga05p37_13680_c2 3300050507 Bacteria 2652
580 nmdc:mga05p37_156986_c1 3300050507 Bacteria 2780
581 nmdc:mga05p37_16043_c1 3300050507 Bacteria 9015
582 nmdc:mga05p37_161507_c1 3300050507 Bacteria 2736
583 nmdc:mga05p37_238886_c1 3300050507 Bacteria 2186
584 nmdc:mga05p37_25_c1 3300050507 Bacteria 116982
585 nmdc:mga05p37_29615_c1 3300050507 Bacteria 6680
586 nmdc:mga05p37_39925_c1 3300050507 Bacteria 5763
587 nmdc:mga05p37_74378_c1 3300050507 Bacteria 4181
588 nmdc:mga05p37_7521_c1 3300050507 Bacteria 12844
589 nmdc:mga09592_10873_c1 3300050508 Bacteria 7407
590 nmdc:mga09592_251611_c1 3300050508 Bacteria 1531
591 nmdc:mga09592_29858_c1 3300050508 Bacteria 4534
592 nmdc:mga09592_306579_c1 3300050508 Bacteria 1376
593 nmdc:mga0qj67_34027_c1 3300050509 Bacteria 3979
594 nmdc:mga0qj67_7606_c1 3300050509 Bacteria 8005
595 nmdc:mga0qj67_92127_c1 3300050509 Bacteria 2437
596 nmdc:mga06r32_123732_c1 3300050510 Bacteria 2553
597 nmdc:mga06r32_16004_c1 3300050510 Bacteria 6825
598 nmdc:mga06r32_208717_c1 3300050510 Bacteria 1941
599 nmdc:mga06r32_2567_c1 3300050510 Bacteria 16219
600 nmdc:mga06r32_372405_c1 3300050510 Bacteria 1411
601 nmdc:mga06r32_52838_c1 3300050510 Bacteria 3892
602 nmdc:mga06r32_63797_c1 3300050510 Bacteria 3552
603 nmdc:mga08y16_2366_c1 3300050511 Bacteria 19363
604 nmdc:mga08y16_27336_c1 3300050511 Bacteria 6010
605 nmdc:mga08y16_351569_c1 3300050511 Bacteria 1514
606 nmdc:mga08y16_411857_c1 3300050511 Bacteria 1382
607 nmdc:mga08y16_55953_c1 3300050511 Bacteria 4123
608 nmdc:mga08y16_8313_c1 3300050511 Bacteria 10863
609 nmdc:mga08y16_9568_c1 3300050511 Bacteria 10172
610 nmdc:mga0n895_195859_c1 3300050512 Bacteria 2052
611 nmdc:mga0n895_26876_c1 3300050512 Bacteria 5460
612 nmdc:mga0n895_80539_c1 3300050512 Bacteria 3245
613 nmdc:mga0n895_89628_c1 3300050512 Bacteria 3077
614 nmdc:mga0n895_91535_c1 3300050512 Bacteria 3044
615 nmdc:mga0n895_9594_c1 3300050512 Bacteria 8479
616 nmdc:mga0rr50_104359_c1 3300050513 Bacteria 2233
617 nmdc:mga0rr50_15179_c1 3300050513 Bacteria 5079
618 nmdc:mga0rr50_172466_c1 3300050513 Bacteria 1764
619 nmdc:mga0rr50_177963_c1 3300050513 Bacteria 1737
620 nmdc:mga0rr50_285161_c1 3300050513 Bacteria 1379
621 nmdc:mga0rr50_39026_c1 3300050513 Bacteria 3442
622 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
623 nmdc:mga0rr50_827_c1 3300050513 Bacteria 16653
624 nmdc:mga08x19_191697_c1 3300050514 Bacteria 1399
625 nmdc:mga08x19_406_c1 3300050514 Bacteria 30257
626 nmdc:mga08x19_45161_c1 3300050514 Bacteria 2815
627 nmdc:mga08x19_53182_c1 3300050514 Bacteria 2605
628 nmdc:mga0a205_102267_c1 3300050515 Bacteria 2764
629 nmdc:mga0a205_23002_c1 3300050515 Bacteria 5909
630 nmdc:mga0a205_23560_c1 3300050515 Bacteria 5840
631 nmdc:mga0a205_368499_c1 3300050515 Bacteria 1302
632 Ga0495601_0070286 3300053077 Bacteria 2235
633 Ga0495601_0116879 3300053077 Bacteria 1730
634 Ga0495655_0016048 3300053083 Bacteria 1605
635 Ga0495619_0098371 3300053085 Bacteria 1989
636 Ga0501084_0010125 3300054114 Bacteria 7791
637 Ga0501084_0014250 3300054114 Bacteria 6584
638 Ga0501084_0069902 3300054114 Bacteria 2940
639 Ga0501084_0073748 3300054114 Bacteria 2858
640 Ga0590071_004537 3300059421 Bacteria 3368
641 Ga0590071_011091 3300059421 Bacteria 2108
642 Ga0590071_015291 3300059421 Bacteria 1800
643 Ga0590075_006293 3300059424 Bacteria 2817
644 Ga0590075_014344 3300059424 Bacteria 1937
645 Ga0590077_004700 3300059426 Bacteria 2796
646 Ga0590077_007858 3300059426 Bacteria 2180
647 Ga0501082_0003081 3300060353 Bacteria 14544
648 Ga0501082_0017364 3300060353 Bacteria 6199
649 Ga0501082_0038198 3300060353 Bacteria 4142
650 Ga0501082_0096496 3300060353 Bacteria 2556
651 Ga0501082_0213709 3300060353 Bacteria 1678
652 Ga0530510_0001425 3300061734 Bacteria 16009
653 Ga0530510_0046683 3300061734 Bacteria 3129
654 Ga0068858_100144493
655 JGI25406J46586_10000720
656 JGI25406J46586_10018012
657 Ga0065712_10079566
658 Ga0065712_10090928
659 Ga0065712_10110827
660 Ga0065715_10116390
661 Ga0065715_10146192
662 Ga0065707_10021340
663 Ga0070676_10000123
664 Ga0070683_100002095
665 Ga0070683_100115438
666 Ga0070690_100202220
667 Ga0070670_100009026
668 Ga0070670_100012759
669 Ga0070670_100016598
670 Ga0070677_10028038
671 Ga0068869_100068125
672 Ga0068869_100273604
673 Ga0070666_10053745
674 Ga0070666_10093498
675 Ga0068868_100067503
676 Ga0068868_100133965
677 Ga0070660_100008050
678 Ga0070691_10001542
679 Ga0070691_10100625
680 Ga0070687_100097643
681 Ga0070661_100026883
682 Ga0070661_100045578
683 Ga0070668_100048880
684 Ga0070669_100010204
685 Ga0070669_100030395
686 Ga0070669_100108810
687 Ga0070675_100003393
688 Ga0070675_100074833
689 Ga0070675_100227292
690 Ga0070675_100276651
691 Ga0070671_100047993
692 Ga0070671_100104400
693 Ga0070674_100035038
694 Ga0070673_100006795
695 Ga0070673_100063782
696 Ga0070673_100126284
697 Ga0070673_100178645
698 Ga0070688_100026027
699 Ga0070659_100043589
700 Ga0070709_10095306
701 Ga0070714_100033550
702 Ga0070713_100121578
703 Ga0070713_100156572
704 Ga0070701_10041480
705 Ga0070711_100128518
706 Ga0070705_100087155
707 Ga0070700_100003499
708 Ga0070700_100004871
709 Ga0070700_100070738
710 Ga0070700_100094909
711 Ga0070694_100099330
712 Ga0070694_100100070
713 Ga0070694_100101024
714 Ga0070708_100168766
715 Ga0070678_100018105
716 Ga0070678_100239709
717 Ga0070662_100053024
718 Ga0070681_10007252
719 Ga0070681_10035608
720 Ga0068867_100311411
721 Ga0070707_100142828
722 Ga0070698_100007563
723 Ga0070698_100015655
724 Ga0070698_100230394
725 Ga0070699_100023906
726 Ga0070699_100135856
727 Ga0070699_100245014
728 Ga0070679_100105036
729 Ga0070684_100001883
730 Ga0070672_100017734
731 Ga0070672_100136692
732 Ga0070672_100365479
733 Ga0070686_100000519
734 Ga0070695_100004353
735 Ga0070693_100100552
736 Ga0070665_100003640
737 Ga0070704_100005590
738 Ga0070704_100061107
739 Ga0068855_100089285
740 Ga0068855_100238973
741 Ga0070664_100001463
742 Ga0068857_100063046
743 Ga0068854_100002180
744 Ga0068854_100060860
745 Ga0068856_100052115
746 Ga0070702_100038461
747 Ga0068859_100012670
748 Ga0068859_100177060
749 Ga0068859_100284973
750 Ga0068864_100031104
751 Ga0068864_100316534
752 Ga0068864_100395256
753 Ga0068866_10029582
754 Ga0068866_10084897
755 Ga0068861_100047543
756 Ga0068861_100088913
757 Ga0068861_100144306
758 Ga0068861_100205290
759 Ga0068863_100002786
760 Ga0068858_100009357
761 Ga0068858_100024856
762 Ga0068858_100161981
763 Ga0068858_100226704
764 Ga0068858_100322318
765 Ga0068860_100022539
766 Ga0068860_100025179
767 Ga0068860_100085944
768 Ga0068862_100071102
769 Ga0068862_100254940
770 Ga0068862_100294470
771 Ga0081455_10181629
772 Ga0081455_10227478
773 Ga0081538_10025129
774 Ga0081539_10000034
775 Ga0081539_10000151
776 Ga0081539_10004286
777 Ga0075365_10045592
778 Ga0075365_10072326
779 Ga0075368_10043977
780 Ga0075364_10002744
781 Ga0075364_10060563
782 Ga0070715_10030219
783 Ga0075367_10021114
784 Ga0075367_10052460
785 Ga0075366_10004929
786 Ga0097621_100228894
787 Ga0075370_10113330
788 Ga0068871_100301699
789 Ga0075428_100011096
790 Ga0075428_100015839
791 Ga0075428_100040085
792 Ga0075428_100103690
793 Ga0075428_100240978
794 Ga0075428_100390009
795 Ga0075430_100006386
796 Ga0075430_100008184
797 Ga0075430_100160229
798 Ga0075431_100007561
799 Ga0075431_100013825
800 Ga0075431_100042138
801 Ga0075431_100048072
802 Ga0075431_100095037
803 Ga0075431_100190077
804 Ga0075431_100397760
805 Ga0075433_10014397
806 Ga0075433_10044123
807 Ga0075433_10225879
808 Ga0075434_100017813
809 Ga0075434_100020190
810 Ga0075434_100082400
811 Ga0075434_100198669
812 Ga0075434_100301867
813 Ga0075429_100018117
814 Ga0075429_100035169
815 Ga0068865_100023965
816 Ga0068865_100088808
817 Ga0075436_100024452
818 Ga0075436_100030387
819 Ga0075436_100064808
820 Ga0075436_100069859
821 Ga0075436_100095301
822 Ga0097620_100012670
823 Ga0097620_100177073
824 Ga0097620_100284994
825 Ga0075435_100000722
826 Ga0075435_100001014
827 Ga0075435_100006276
828 Ga0075435_100006504
829 Ga0075435_100032117
830 Ga0105240_10012723
831 Ga0105240_10119395
832 Ga0105240_10410075
833 Ga0111539_10000775
834 Ga0111539_10003755
835 Ga0111539_10005320
836 Ga0111539_10008877
837 Ga0111539_10073584
838 Ga0111539_10086459
839 Ga0111539_10117259
840 Ga0111539_10163784
841 Ga0111539_10413298
842 Ga0111539_10467093
843 Ga0105245_10032401
844 Ga0105245_10166214
845 Ga0105245_10263451
846 Ga0105245_10338276
847 Ga0114129_10000006
848 Ga0114129_10001414
849 Ga0114129_10006684
850 Ga0114129_10008287
851 Ga0114129_10008520
852 Ga0114129_10008618
853 Ga0114129_10022628
854 Ga0114129_10028767
855 Ga0114129_10042710
856 Ga0114129_10065107
857 Ga0114129_10066307
858 Ga0114129_10067293
859 Ga0114129_10131892
860 Ga0114129_10161680
861 Ga0114129_10164937
862 Ga0114129_10170456
863 Ga0114129_10317083
864 Ga0114129_10507780
865 Ga0105243_10020562
866 Ga0105243_10066053
867 Ga0105241_10051171
868 Ga0105241_10337934
869 Ga0105242_10018903
870 Ga0105242_10143377
871 Ga0105248_10003534
872 Ga0105248_10027600
873 Ga0105248_10082481
874 Ga0105248_10089028
875 Ga0105248_10117505
876 Ga0105248_10236542
877 Ga0105248_10335118
878 Ga0105249_10069289
879 Ga0105249_10092206
880 Ga0105249_10097805
881 Ga0157374_10294018
882 Ga0157378_10237168
883 Ga0163162_10092833
884 Ga0163162_10105740
885 Ga0163162_10120042
886 Ga0157372_10494928
887 Ga0157375_10204282
888 Ga0157375_10218602
889 Ga0163163_10000022
890 Ga0163163_10010603
891 Ga0163163_10014917
892 Ga0163163_10208174
893 Ga0157380_10017574
894 Ga0157380_10243293
895 Ga0157377_10178987
896 Ga0157379_10014964
897 Ga0157379_10052515
898 Ga0157379_10053202
899 Ga0157376_10006537
900 Ga0157376_10029990
901 Ga0157376_10123602
902 Ga0163161_10144755
903 Ga0207697_10004455
904 Ga0207697_10034694
905 Ga0207656_10067907
906 Ga0207682_10024461
907 Ga0207642_10025178
908 Ga0207688_10005864
909 Ga0207680_10078653
910 Ga0207680_10079623
911 Ga0207645_10002358
912 Ga0207645_10024221
913 Ga0207654_10104743
914 Ga0207707_10011448
915 Ga0207707_10051611
916 Ga0207707_10060340
917 Ga0207695_10035836
918 Ga0207695_10041838
919 Ga0207662_10022781
920 Ga0207662_10126383
921 Ga0207657_10048347
922 Ga0207649_10088227
923 Ga0207652_10009649
924 Ga0207681_10018588
925 Ga0207681_10029404
926 Ga0207681_10203809
927 Ga0207650_10013245
928 Ga0207650_10025314
929 Ga0207650_10028048
930 Ga0207659_10065023
931 Ga0207687_10161989
932 Ga0207700_10168578
933 Ga0207664_10123349
934 Ga0207644_10034347
935 Ga0207644_10065607
936 Ga0207644_10177619
937 Ga0207644_10359744
938 Ga0207690_10113514
939 Ga0207706_10097373
940 Ga0207706_10153423
941 Ga0207706_10155127
942 Ga0207706_10166433
943 Ga0207686_10078379
944 Ga0207709_10153036
945 Ga0207670_10079536
946 Ga0207704_10087853
947 Ga0207691_10007037
948 Ga0207691_10025236
949 Ga0207691_10050251
950 Ga0207691_10182990
951 Ga0207691_10198612
952 Ga0207711_10096659
953 Ga0207711_10167358
954 Ga0207711_10177340
955 Ga0207711_10236647
956 Ga0207711_10332573
957 Ga0207661_10051019
958 Ga0207661_10086733
959 Ga0207661_10110066
960 Ga0207661_10123025
961 Ga0207667_10046339
962 Ga0207651_10043474
963 Ga0207651_10382431
964 Ga0207712_10121044
965 Ga0207668_10011554
966 Ga0207668_10067519
967 Ga0207668_10102366
968 Ga0207640_10049150
969 Ga0207658_10095720
970 Ga0207677_10039016
971 Ga0207677_10225466
972 Ga0207703_10015458
973 Ga0207703_10021268
974 Ga0207703_10092497
975 Ga0207703_10156795
976 Ga0207703_10377193
977 Ga0207639_10415027
978 Ga0207708_10000478
979 Ga0207708_10019949
980 Ga0207708_10049147
981 Ga0207708_10128045
982 Ga0207702_10061905
983 Ga0207641_10093043
984 Ga0207641_10154429
985 Ga0207641_10427222
986 Ga0207648_10002141
987 Ga0207648_10005864
988 Ga0207648_10057831
989 Ga0207648_10112898
990 Ga0207676_10021228
991 Ga0207676_10073603
992 Ga0207674_10038018
993 Ga0207674_10138102
994 Ga0207674_10318011
995 Ga0207675_100074782
996 Ga0207675_100136975
997 Ga0207675_100151543
998 Ga0207675_100177491
999 Ga0207675_100326218
1000 Ga0207683_10007567
1001 Ga0207683_10208023
1002 Ga0207683_10241982
1003 Ga0209983_1001570
1004 Ga0209813_10012631
1005 Ga0209974_10004350
1006 Ga0207428_10001413
1007 Ga0207428_10007462
1008 Ga0207428_10013142
1009 Ga0207428_10025161
1010 Ga0207428_10027482
1011 Ga0207428_10147685
1012 Ga0268266_10034338
1013 Ga0268266_10239057
1014 Ga0268265_10046019
1015 Ga0268265_10060336
1016 Ga0268265_10433471
1017 Ga0268264_10061603
1018 Ga0268264_10159747
1019 Ga0268264_10160826
1020 Ga0265322_10016763
1021 Ga0265330_10000891
1022 Ga0265329_10005409
1023 Ga0265316_10003452
1024 Ga0265342_10000299
1025 Ga0307405_10109315
1026 Ga0307406_10200893
1027 Ga0307406_10217805
1028 Ga0307407_10176330
1029 Ga0307409_100146182
1030 Ga0307416_100034118
1031 Ga0307416_100047030
1032 Ga0307416_100109375
1033 Ga0307416_100117725
1034 Ga0307411_10023839
1035 Ga0307411_10045072
1036 Ga0307415_100016873
1037 Ga0316583_10034779
1038 Ga0373950_0002149
1039 Ga0373959_0001998
1040 Ga0373926_0009081
1041 Ga0373928_0003170
1042 Ga0373928_0007467
1043 Ga0373929_0001397
1044 Ga0373934_0001433
1045 Ga0373940_0001724
1046 Ga0373944_0016905
1047 Ga0373949_0007738
1048 Ga0373951_0000985
1049 Ga0373952_0002914
1050 Ga0373932_0000886
1051 Ga0373956_0006432
1052 Ga0373957_0007530
1053 Ga0373943_0004179
1054 Ga0373961_0000871
1055 Ga0373924_0000460
1056 Ga0373931_0010703
1057 Ga0373933_0002982
1058 Ga0373947_0022283
1059 Ga0373937_0002313
1060 Ga0373937_0177731
1061 Ga0373937_0240990
1062 Ga0373937_0452070
1063 Ga0316584_0144506
1064 Ga0373925_0009394
1065 Ga0373925_0097158
1066 Ga0373925_0319089
1067 Ga0395905_0060964
1068 Ga0439439_0036639
1069 Ga0439461_0019183
1070 Ga0439433_0012101
1071 Ga0439443_008239
1072 Ga0439435_0005568
1073 Ga0439460_0018878
1074 Ga0451577_0152196
1075 Ga0466963_0022873
1076 Ga0453684_0031449
1077 Ga0466970_0170203
1078 Ga0466957_0158747
1079 Ga0451576_0005062
1080 Ga0451576_0019288
1081 Ga0451576_0181579
1082 Ga0451576_0399987
1083 Ga0451576_0612037
1084 Ga0466958_0182784
1085 Ga0466967_0351448
1086 Ga0495603_0122117
1087 Ga0495629_0056279
1088 Ga0495629_0089353
1089 Ga0495629_0261768
1090 Ga0495628_0173372
1091 Ga0495628_0197872
1092 Ga0495640_0057958
1093 Ga0495645_0006016
1094 Ga0495656_0097933
1095 Ga0495599_0087570
1096 Ga0495658_0029730
1097 Ga0496100_0071571
1098 Ga0496101_0041817
1099 Ga0496101_0093788
1100 Ga0496104_0007455
1101 Ga0496104_0022529
1102 Ga0496104_0086146
1103 Ga0496104_0119302
1104 Ga0496104_0189283
1105 Ga0496104_0198591
1106 Ga0496104_0339984
1107 Ga0496105_0089356
1108 Ga0496108_0007791
1109 Ga0496108_0068740
1110 Ga0496109_0000495
1111 Ga0496109_0232197
1112 Ga0496110_0001823
1113 Ga0496110_0057063
1114 Ga0496110_0095000
1115 Ga0496111_0080834
1116 Ga0496112_0003258
1117 Ga0496112_0016048
1118 Ga0496112_0039726
1119 Ga0496112_0058695
1120 Ga0496112_0286573
1121 Ga0496113_0027491
1122 Ga0496113_0073854
1123 Ga0496114_0132173
1124 Ga0496114_0170656
1125 Ga0501031_0000349
1126 Ga0501031_0030592
1127 Ga0501031_0067135
1128 Ga0501033_0002398
1129 Ga0501033_0019677
1130 Ga0501033_0095188
1131 Ga0501034_0008746
1132 Ga0501034_0054925
1133 Ga0501034_0167096
1134 Ga0501036_0010984
1135 Ga0501036_0016766
1136 Ga0501036_0024486
1137 Ga0501036_0083221
1138 Ga0501037_0004137
1139 Ga0501037_0006139
1140 Ga0501037_0143712
1141 Ga0501038_0009002
1142 Ga0501038_0027944
1143 Ga0501038_0030252
1144 Ga0501039_0019305
1145 Ga0501039_0021549
1146 Ga0501039_0054301
1147 Ga0501040_0002396
1148 Ga0501040_0159921
1149 Ga0501041_0048230
1150 Ga0501041_0053109
1151 Ga0501041_0055257
1152 Ga0501042_0000533
1153 Ga0501042_0014358
1154 Ga0501042_0084553
1155 Ga0501043_0023236
1156 Ga0501043_0026534
1157 Ga0501043_0061039
1158 Ga0501046_0002001
1159 Ga0501046_0008702
1160 Ga0501046_0017316
1161 Ga0501046_0030024
1162 Ga0501046_0228506
1163 Ga0501047_0027772
1164 Ga0501047_0229965
1165 Ga0501048_0012214
1166 Ga0501048_0024981
1167 Ga0501048_0088315
1168 Ga0501048_0267169
1169 Ga0501067_0006327
1170 Ga0501067_0053814
1171 Ga0501067_0111191
1172 Ga0501068_0000628
1173 Ga0501068_0063475
1174 Ga0501069_0000934
1175 Ga0501069_0022705
1176 Ga0501070_0020421
1177 Ga0501070_0020626
1178 Ga0501070_0117112
1179 Ga0501071_0002554
1180 Ga0501071_0013666
1181 Ga0501071_0068605
1182 Ga0501071_0095343
1183 Ga0501071_0192823
1184 Ga0501072_0008108
1185 Ga0501072_0031647
1186 Ga0501072_0137880
1187 Ga0501073_0072445
1188 Ga0501074_0048475
1189 Ga0501074_0058579
1190 Ga0501074_0114033
1191 Ga0501075_0000977
1192 Ga0501075_0132676
1193 Ga0501075_0139467
1194 Ga0501075_0275458
1195 Ga0501076_0093237
1196 Ga0501076_0167479
1197 Ga0501077_0160826
1198 Ga0501079_0001695
1199 Ga0501079_0004939
1200 Ga0501079_0013857
1201 Ga0501079_0019608
1202 Ga0501079_0057475
1203 Ga0501079_0105627
1204 Ga0501080_0011443
1205 Ga0501080_0013430
1206 Ga0501080_0026958
1207 Ga0501081_0000743
1208 Ga0501081_0029516
1209 Ga0501081_0046918
1210 Ga0501081_0138041
1211 Ga0501035_0005874
1212 Ga0501035_0133704
1213 Ga0501044_0012286
1214 Ga0501044_0025445
1215 Ga0501044_0108719
1216 Ga0501045_0004142
1217 Ga0501045_0010030
1218 Ga0501045_0056678
1219 Ga0501045_0078028
1220 nmdc:mga00v17_4213_c1
1221 nmdc:mga00v17_67611_c1
1222 nmdc:mga0yw44_14177_c1
1223 nmdc:mga0yw44_80538_c1
1224 nmdc:mga0k408_7714_c1
1225 nmdc:mga06z11_30953_c1
1226 nmdc:mga06z11_33502_c1
1227 nmdc:mga04h51_14608_c1
1228 nmdc:mga04h51_22756_c1
1229 nmdc:mga05p37_1045_c1
1230 nmdc:mga05p37_10896_c1
1231 nmdc:mga05p37_11646_c1
1232 nmdc:mga05p37_13680_c2
1233 nmdc:mga05p37_156986_c1
1234 nmdc:mga05p37_16043_c1
1235 nmdc:mga05p37_161507_c1
1236 nmdc:mga05p37_238886_c1
1237 nmdc:mga05p37_25_c1
1238 nmdc:mga05p37_29615_c1
1239 nmdc:mga05p37_39925_c1
1240 nmdc:mga05p37_74378_c1
1241 nmdc:mga05p37_7521_c1
1242 nmdc:mga09592_10873_c1
1243 nmdc:mga09592_251611_c1
1244 nmdc:mga09592_29858_c1
1245 nmdc:mga09592_306579_c1
1246 nmdc:mga0qj67_34027_c1
1247 nmdc:mga0qj67_7606_c1
1248 nmdc:mga0qj67_92127_c1
1249 nmdc:mga06r32_123732_c1
1250 nmdc:mga06r32_16004_c1
1251 nmdc:mga06r32_208717_c1
1252 nmdc:mga06r32_2567_c1
1253 nmdc:mga06r32_372405_c1
1254 nmdc:mga06r32_52838_c1
1255 nmdc:mga06r32_63797_c1
1256 nmdc:mga08y16_2366_c1
1257 nmdc:mga08y16_27336_c1
1258 nmdc:mga08y16_351569_c1
1259 nmdc:mga08y16_411857_c1
1260 nmdc:mga08y16_55953_c1
1261 nmdc:mga08y16_8313_c1
1262 nmdc:mga08y16_9568_c1
1263 nmdc:mga0n895_195859_c1
1264 nmdc:mga0n895_26876_c1
1265 nmdc:mga0n895_80539_c1
1266 nmdc:mga0n895_89628_c1
1267 nmdc:mga0n895_91535_c1
1268 nmdc:mga0n895_9594_c1
1269 nmdc:mga0rr50_104359_c1
1270 nmdc:mga0rr50_15179_c1
1271 nmdc:mga0rr50_172466_c1
1272 nmdc:mga0rr50_177963_c1
1273 nmdc:mga0rr50_285161_c1
1274 nmdc:mga0rr50_39026_c1
1275 nmdc:mga0rr50_5_c1
1276 nmdc:mga0rr50_827_c1
1277 nmdc:mga08x19_191697_c1
1278 nmdc:mga08x19_406_c1
1279 nmdc:mga08x19_45161_c1
1280 nmdc:mga08x19_53182_c1
1281 nmdc:mga0a205_102267_c1
1282 nmdc:mga0a205_23002_c1
1283 nmdc:mga0a205_23560_c1
1284 nmdc:mga0a205_368499_c1
1285 Ga0495601_0070286
1286 Ga0495601_0116879
1287 Ga0495655_0016048
1288 Ga0495619_0098371
1289 Ga0501084_0010125
1290 Ga0501084_0014250
1291 Ga0501084_0069902
1292 Ga0501084_0073748
1293 Ga0590071_004537
1294 Ga0590071_011091
1295 Ga0590071_015291
1296 Ga0590075_006293
1297 Ga0590075_014344
1298 Ga0590077_004700
1299 Ga0590077_007858
1300 Ga0501082_0003081
1301 Ga0501082_0017364
1302 Ga0501082_0038198
1303 Ga0501082_0096496
1304 Ga0501082_0213709
1305 Ga0530510_0001425
1306 Ga0530510_0046683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00988

CPSase_sm_chain

Carbamoyl-phosphate synthase small chain, CPSase domain

36

161

0.99

PF00117

GATase

Glutamine amidotransferase class-I

222

400

0.98

PF07722

Peptidase_C26

Peptidase C26

265

382

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.9338 2 379
1cs0-assembly4.cif.gz_B crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde 0.9329 2 379
1a9x-assembly1.cif.gz_B carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis 0.9324 2 379
1m6v-assembly1.cif.gz_D crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase 0.9319 2 379
1jdb-assembly1.cif.gz_F carbamoyl phosphate synthetase from escherichia coli 0.9318 2 379
ID Description Score Start End Superfamily
af_P0A6F1_2_151_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9852 2 148 3.50.30.20
af_P9WPK5_1_155_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9829 2 149 3.50.30.20
af_C6TIQ8_51_199_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9784 3 148 3.50.30.20
af_Q2FZ73_3_150_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9674 1 148 3.50.30.20
af_Q2FZ73_3_150_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.961 1 148 3.50.30.20
ID Description Score Start End GO Terms
AF-A0A3D0XPS4-F1-model_v4 Carbamoyl phosphate synthase small subunit 0.9919 2 133 GO:0005524
GO:0016874
AF-A0A7V5CKH4-F1-model_v4 Carbamoyl phosphate synthase small subunit 0.9914 1 106
AF-A0A382VHM2-F1-model_v4 Carbamoyl-phosphate synthase small subunit N-terminal domain-containing protein 0.9902 1 118 GO:0005524
GO:0016874
AF-A0A352NS93-F1-model_v4 Carbamoyl phosphate synthase small subunit (EC 6.3.5.5) 0.9895 1 111 GO:0004088
AF-A0A6L6CDH6-F1-model_v4 Carbamoyl phosphate synthase small subunit 0.9884 1 122 GO:0005524
GO:0006221
GO:0016874

Map