F472693

General Info

Members Datasets Scaffolds Average Seq Length
652 281 1304 117

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100068406|Ga0307408_1000684061
Length 127
Sequence MKTYLLGMYQPEGPTPTEEQLEPVMRELGAITQDMADVGALVFNGGLVPPASSTVVRYSSGIGPVDGSFAHGRVEETLLTDGPFTEGKEYLGGLWIIRVADLDDALGYARRITAATTLPMEVRPFWG

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
208 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
262 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.92
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 3.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100068406 3300031548 Bacteria 2615
2 JGI25406J46586_10142707 3300003203 Bacteria 700
3 JGI25407J50210_10002846 3300003373 Bacteria 4118
4 Ga0070676_10027831 3300005328 Bacteria 3209
5 Ga0070676_10073454 3300005328 Bacteria 2057
6 Ga0070676_10074600 3300005328 Bacteria 2043
7 Ga0070683_100007034 3300005329 Bacteria 9470
8 Ga0070683_100024842 3300005329 Bacteria 5373
9 Ga0070683_100093414 3300005329 Bacteria 2826
10 Ga0070683_100108092 3300005329 Bacteria 2623
11 Ga0070683_100117507 3300005329 Bacteria 2511
12 Ga0070683_100304386 3300005329 Bacteria 1517
13 Ga0070683_100377910 3300005329 Unclassified 1350
14 Ga0070683_100812240 3300005329 Bacteria 897
15 Ga0070690_100050276 3300005330 Bacteria 2659
16 Ga0070690_100401343 3300005330 Bacteria 1007
17 Ga0070670_100018431 3300005331 Bacteria 5989
18 Ga0070670_100070826 3300005331 Bacteria 2993
19 Ga0070670_100088694 3300005331 Bacteria 2659
20 Ga0070670_101783655 3300005331 Bacteria 566
21 Ga0070677_10033194 3300005333 Bacteria 1986
22 Ga0070677_10099457 3300005333 Bacteria 1280
23 Ga0070677_10681277 3300005333 Unclassified 577
24 Ga0068869_100013265 3300005334 Bacteria 5476
25 Ga0068869_100065297 3300005334 Bacteria 2679
26 Ga0068869_100106823 3300005334 Bacteria 2125
27 Ga0070666_10076832 3300005335 Bacteria 2279
28 Ga0070666_10115867 3300005335 Bacteria 1856
29 Ga0070666_10430569 3300005335 Bacteria 951
30 Ga0070666_10819592 3300005335 Bacteria 686
31 Ga0070666_11468481 3300005335 Bacteria 510
32 Ga0070680_100000749 3300005336 Bacteria 22682
33 Ga0070680_100020637 3300005336 Bacteria 5230
34 Ga0070680_100050312 3300005336 Bacteria 3399
35 Ga0070680_101993623 3300005336 Bacteria 503
36 Ga0070682_100284827 3300005337 Bacteria 1206
37 Ga0070682_100400335 3300005337 Bacteria 1038
38 Ga0070682_101006423 3300005337 Bacteria 692
39 Ga0068868_100010115 3300005338 Bacteria 6815
40 Ga0068868_100253239 3300005338 Bacteria 1482
41 Ga0070660_101033459 3300005339 Unclassified 695
42 Ga0070660_101356479 3300005339 Bacteria 604
43 Ga0070689_100067877 3300005340 Bacteria 2780
44 Ga0070689_100137678 3300005340 Bacteria 1962
45 Ga0070689_100445736 3300005340 Bacteria 1101
46 Ga0070691_10486753 3300005341 Bacteria 711
47 Ga0070687_100016010 3300005343 Bacteria 3407
48 Ga0070687_100047191 3300005343 Bacteria 2208
49 Ga0070687_100324791 3300005343 Bacteria 984
50 Ga0070661_100001264 3300005344 Bacteria 17763
51 Ga0070661_100007632 3300005344 Bacteria 7464
52 Ga0070661_100068669 3300005344 Bacteria 2605
53 Ga0070661_100626986 3300005344 Unclassified 871
54 Ga0070661_100775996 3300005344 Bacteria 785
55 Ga0070692_10002460 3300005345 Bacteria 7199
56 Ga0070692_10447574 3300005345 Bacteria 826
57 Ga0070692_10475429 3300005345 Bacteria 805
58 Ga0070668_100197391 3300005347 Bacteria 1651
59 Ga0070668_100298863 3300005347 Bacteria 1350
60 Ga0070668_100404971 3300005347 Bacteria 1165
61 Ga0070668_100486350 3300005347 Bacteria 1066
62 Ga0070669_100002280 3300005353 Bacteria 13912
63 Ga0070669_100006275 3300005353 Bacteria 8579
64 Ga0070669_100041559 3300005353 Bacteria 3344
65 Ga0070669_100068709 3300005353 Bacteria 2616
66 Ga0070669_100097407 3300005353 Bacteria 2214
67 Ga0070669_100735085 3300005353 Bacteria 835
68 Ga0070669_101115571 3300005353 Bacteria 680
69 Ga0070675_100007811 3300005354 Bacteria 8289
70 Ga0070675_100019344 3300005354 Bacteria 5426
71 Ga0070675_100035036 3300005354 Bacteria 4076
72 Ga0070675_100135814 3300005354 Bacteria 2099
73 Ga0070675_100182604 3300005354 Bacteria 1814
74 Ga0070671_100003195 3300005355 Bacteria 12775
75 Ga0070671_100235924 3300005355 Bacteria 1552
76 Ga0070671_100880696 3300005355 Bacteria 782
77 Ga0070671_100931534 3300005355 Bacteria 759
78 Ga0070671_101612602 3300005355 Bacteria 575
79 Ga0070674_100145651 3300005356 Bacteria 1783
80 Ga0070674_100523728 3300005356 Bacteria 991
81 Ga0070673_100004747 3300005364 Bacteria 8637
82 Ga0070673_100007897 3300005364 Bacteria 7052
83 Ga0070673_100014063 3300005364 Bacteria 5559
84 Ga0070673_100527606 3300005364 Bacteria 1071
85 Ga0070673_100770314 3300005364 Bacteria 887
86 Ga0070673_101380698 3300005364 Bacteria 663
87 Ga0070673_102376202 3300005364 Bacteria 504
88 Ga0070688_100013292 3300005365 Bacteria 4636
89 Ga0070688_100154185 3300005365 Bacteria 1573
90 Ga0070659_100003260 3300005366 Bacteria 11550
91 Ga0070659_100031565 3300005366 Bacteria 4103
92 Ga0070667_100014377 3300005367 Bacteria 6540
93 Ga0070667_100214789 3300005367 Bacteria 1710
94 Ga0070667_100450446 3300005367 Bacteria 1176
95 Ga0070667_100851528 3300005367 Bacteria 848
96 Ga0070709_10114536 3300005434 Bacteria 1817
97 Ga0070713_100335303 3300005436 Bacteria 1400
98 Ga0070701_10008444 3300005438 Bacteria 4456
99 Ga0070701_10072776 3300005438 Bacteria 1841
100 Ga0070701_10145719 3300005438 Bacteria 1359
101 Ga0070701_10281883 3300005438 Bacteria 1015
102 Ga0070711_100914882 3300005439 Unclassified 749
103 Ga0070705_100001750 3300005440 Bacteria 11278
104 Ga0070705_100564434 3300005440 Bacteria 875
105 Ga0070700_100021510 3300005441 Bacteria 3750
106 Ga0070700_100057566 3300005441 Bacteria 2439
107 Ga0070700_100127559 3300005441 Bacteria 1712
108 Ga0070694_100017687 3300005444 Bacteria 4506
109 Ga0070694_100245119 3300005444 Bacteria 1353
110 Ga0070708_100021503 3300005445 Bacteria 5455
111 Ga0070663_100034743 3300005455 Bacteria 3493
112 Ga0070663_100142715 3300005455 Bacteria 1830
113 Ga0070663_102074676 3300005455 Bacteria 512
114 Ga0070678_100151510 3300005456 Bacteria 1868
115 Ga0070678_100382731 3300005456 Bacteria 1218
116 Ga0070678_100558285 3300005456 Bacteria 1017
117 Ga0070678_101108609 3300005456 Bacteria 731
118 Ga0070662_100023584 3300005457 Bacteria 4228
119 Ga0070662_100312961 3300005457 Bacteria 1278
120 Ga0070681_10001540 3300005458 Bacteria 20418
121 Ga0070681_10013864 3300005458 Bacteria 8021
122 Ga0070681_10032470 3300005458 Bacteria 5239
123 Ga0068867_100002350 3300005459 Bacteria 13304
124 Ga0068867_100314770 3300005459 Bacteria 1295
125 Ga0068867_100372355 3300005459 Bacteria 1198
126 Ga0068867_100615359 3300005459 Bacteria 949
127 Ga0068867_101446086 3300005459 Bacteria 639
128 Ga0070685_10052770 3300005466 Bacteria 2353
129 Ga0070685_10082492 3300005466 Bacteria 1930
130 Ga0070685_10116604 3300005466 Bacteria 1653
131 Ga0070685_10374614 3300005466 Bacteria 979
132 Ga0070706_100000937 3300005467 Bacteria 31912
133 Ga0070706_101005258 3300005467 Bacteria 769
134 Ga0070707_100016397 3300005468 Bacteria 6950
135 Ga0070698_100005982 3300005471 Bacteria 13261
136 Ga0070698_100868800 3300005471 Bacteria 847
137 Ga0070698_101437273 3300005471 Bacteria 641
138 Ga0070699_100004649 3300005518 Bacteria 12148
139 Ga0070679_100000050 3300005530 Bacteria 88045
140 Ga0070679_100017016 3300005530 Bacteria 7028
141 Ga0070684_100008956 3300005535 Bacteria 7861
142 Ga0070684_100014438 3300005535 Bacteria 6400
143 Ga0070684_100043899 3300005535 Bacteria 3863
144 Ga0070684_100058607 3300005535 Bacteria 3366
145 Ga0070684_100335063 3300005535 Bacteria 1391
146 Ga0070684_100549798 3300005535 Bacteria 1071
147 Ga0070684_100585709 3300005535 Bacteria 1037
148 Ga0070697_100095983 3300005536 Bacteria 2459
149 Ga0068853_100099719 3300005539 Bacteria 2566
150 Ga0068853_100969404 3300005539 Bacteria 818
151 Ga0070672_100024624 3300005543 Bacteria 4452
152 Ga0070672_100030023 3300005543 Bacteria 4081
153 Ga0070672_100538578 3300005543 Bacteria 1013
154 Ga0070672_100577526 3300005543 Bacteria 978
155 Ga0070672_101262604 3300005543 Bacteria 659
156 Ga0070686_100354677 3300005544 Bacteria 1103
157 Ga0070686_100916562 3300005544 Bacteria 714
158 Ga0070695_100194999 3300005545 Bacteria 1444
159 Ga0070665_100015167 3300005548 Bacteria 7737
160 Ga0070665_100028832 3300005548 Bacteria 5588
161 Ga0070665_101331329 3300005548 Unclassified 728
162 Ga0070704_101185055 3300005549 Bacteria 696
163 Ga0070704_101275145 3300005549 Bacteria 672
164 Ga0068855_100403953 3300005563 Bacteria 1497
165 Ga0070664_100023131 3300005564 Bacteria 5130
166 Ga0070664_100048560 3300005564 Bacteria 3586
167 Ga0070664_100132228 3300005564 Bacteria 2192
168 Ga0070664_100141934 3300005564 Bacteria 2115
169 Ga0070664_100283686 3300005564 Bacteria 1494
170 Ga0070664_100382741 3300005564 Bacteria 1284
171 Ga0070664_101441926 3300005564 Bacteria 651
172 Ga0068857_100005460 3300005577 Bacteria 10843
173 Ga0068857_100216511 3300005577 Bacteria 1749
174 Ga0068857_100256741 3300005577 Bacteria 1603
175 Ga0068857_100989250 3300005577 Bacteria 809
176 Ga0068857_101946535 3300005577 Bacteria 576
177 Ga0068854_100171374 3300005578 Bacteria 1689
178 Ga0068854_100390021 3300005578 Bacteria 1150
179 Ga0068856_100513658 3300005614 Bacteria 1219
180 Ga0068856_101863263 3300005614 Bacteria 613
181 Ga0070702_100211932 3300005615 Bacteria 1290
182 Ga0070702_100373089 3300005615 Bacteria 1012
183 Ga0070702_100443246 3300005615 Bacteria 940
184 Ga0070702_100469116 3300005615 Bacteria 917
185 Ga0070702_100523574 3300005615 Bacteria 875
186 Ga0068852_100517145 3300005616 Bacteria 1191
187 Ga0068852_100899118 3300005616 Bacteria 902
188 Ga0068859_100014453 3300005617 Bacteria 7923
189 Ga0068859_100219579 3300005617 Bacteria 1988
190 Ga0068859_100441135 3300005617 Bacteria 1398
191 Ga0068859_100470034 3300005617 Bacteria 1353
192 Ga0068859_101320987 3300005617 Bacteria 795
193 Ga0068864_100792366 3300005618 Bacteria 931
194 Ga0068864_100805073 3300005618 Bacteria 924
195 Ga0068864_100971670 3300005618 Bacteria 841
196 Ga0068866_10005464 3300005718 Bacteria 5246
197 Ga0068866_10099769 3300005718 Bacteria 1600
198 Ga0068866_10798108 3300005718 Bacteria 656
199 Ga0068861_100002142 3300005719 Bacteria 12775
200 Ga0068861_100117592 3300005719 Bacteria 2139
201 Ga0068861_100235804 3300005719 Bacteria 1554
202 Ga0068861_100520250 3300005719 Bacteria 1079
203 Ga0068861_100615034 3300005719 Bacteria 999
204 Ga0068851_10002466 3300005834 Bacteria 8130
205 Ga0068851_10155494 3300005834 Bacteria 1253
206 Ga0068851_10656932 3300005834 Bacteria 642
207 Ga0068870_10000605 3300005840 Bacteria 13657
208 Ga0068870_10357984 3300005840 Bacteria 938
209 Ga0068863_100039464 3300005841 Bacteria 4491
210 Ga0068863_100695771 3300005841 Bacteria 1010
211 Ga0068858_100294735 3300005842 Bacteria 1547
212 Ga0068858_100319346 3300005842 Bacteria 1484
213 Ga0068858_100673106 3300005842 Bacteria 1006
214 Ga0068860_100110436 3300005843 Bacteria 2628
215 Ga0068860_100204560 3300005843 Bacteria 1914
216 Ga0068862_100005495 3300005844 Bacteria 10589
217 Ga0068862_100374502 3300005844 Bacteria 1326
218 Ga0068862_100496757 3300005844 Bacteria 1157
219 Ga0081538_10000424 3300005981 Bacteria 47554
220 Ga0081539_10001312 3300005985 Bacteria 43508
221 Ga0070716_100145608 3300006173 Bacteria 1517
222 Ga0070712_100367259 3300006175 Bacteria 1182
223 Ga0097621_100052905 3300006237 Bacteria 3309
224 Ga0097621_100171535 3300006237 Bacteria 1870
225 Ga0097621_100345528 3300006237 Bacteria 1322
226 Ga0097621_100976169 3300006237 Bacteria 792
227 Ga0068871_100438045 3300006358 Bacteria 1169
228 Ga0068871_101213840 3300006358 Bacteria 708
229 Ga0075428_100010127 3300006844 Bacteria 10473
230 Ga0075428_100151332 3300006844 Bacteria 2521
231 Ga0075428_100165245 3300006844 Bacteria 2401
232 Ga0075428_100589242 3300006844 Bacteria 1188
233 Ga0075428_100646793 3300006844 Bacteria 1128
234 Ga0075428_101504043 3300006844 Bacteria 705
235 Ga0075430_100001430 3300006846 Bacteria 19417
236 Ga0075430_100039688 3300006846 Bacteria 3985
237 Ga0075430_100178617 3300006846 Bacteria 1766
238 Ga0075431_100063570 3300006847 Bacteria 3809
239 Ga0075431_100105575 3300006847 Bacteria 2907
240 Ga0075431_100305107 3300006847 Bacteria 1608
241 Ga0075431_100507985 3300006847 Bacteria 1196
242 Ga0075431_101409844 3300006847 Bacteria 656
243 Ga0075433_10022829 3300006852 Bacteria 5257
244 Ga0075433_10214829 3300006852 Bacteria 1709
245 Ga0075434_100007768 3300006871 Bacteria 9931
246 Ga0075434_100025973 3300006871 Bacteria 5735
247 Ga0075434_100729394 3300006871 Bacteria 1008
248 Ga0075429_100023889 3300006880 Bacteria 5304
249 Ga0075429_100331044 3300006880 Bacteria 1333
250 Ga0075429_100354767 3300006880 Bacteria 1284
251 Ga0075429_100427126 3300006880 Bacteria 1161
252 Ga0075429_100464398 3300006880 Bacteria 1109
253 Ga0068865_100001169 3300006881 Bacteria 15253
254 Ga0068865_100045168 3300006881 Bacteria 3019
255 Ga0068865_100547152 3300006881 Bacteria 972
256 Ga0068865_100790375 3300006881 Bacteria 818
257 Ga0068865_101581821 3300006881 Bacteria 589
258 Ga0097620_100014450 3300006931 Bacteria 7923
259 Ga0097620_100219584 3300006931 Bacteria 1988
260 Ga0097620_100441141 3300006931 Bacteria 1398
261 Ga0097620_100469982 3300006931 Bacteria 1353
262 Ga0097620_101321212 3300006931 Bacteria 795
263 Ga0075435_100155668 3300007076 Bacteria 1923
264 Ga0105240_10013209 3300009093 Bacteria 11362
265 Ga0105240_10662069 3300009093 Bacteria 1143
266 Ga0111539_10175261 3300009094 Bacteria 2505
267 Ga0111539_10220342 3300009094 Bacteria 2210
268 Ga0111539_10223637 3300009094 Bacteria 2192
269 Ga0105245_10077191 3300009098 Bacteria 3036
270 Ga0114129_10197822 3300009147 Bacteria 2724
271 Ga0114129_10614762 3300009147 Bacteria 1406
272 Ga0114129_12008543 3300009147 Bacteria 699
273 Ga0105243_10033783 3300009148 Bacteria 3956
274 Ga0105243_10800693 3300009148 Bacteria 929
275 Ga0105243_10963447 3300009148 Bacteria 853
276 Ga0105243_11775798 3300009148 Bacteria 647
277 Ga0105242_10011833 3300009176 Bacteria 6715
278 Ga0105242_10035546 3300009176 Bacteria 3995
279 Ga0105242_10077549 3300009176 Bacteria 2772
280 Ga0105242_10179022 3300009176 Bacteria 1869
281 Ga0105242_10571352 3300009176 Bacteria 1087
282 Ga0105242_11651150 3300009176 Bacteria 676
283 Ga0105248_10119139 3300009177 Bacteria 2977
284 Ga0105248_10319943 3300009177 Bacteria 1747
285 Ga0105248_10589392 3300009177 Bacteria 1254
286 Ga0105248_10728398 3300009177 Bacteria 1119
287 Ga0105248_12778666 3300009177 Bacteria 558
288 Ga0105237_10633515 3300009545 Bacteria 1076
289 Ga0105237_12277457 3300009545 Bacteria 551
290 Ga0105238_10217869 3300009551 Bacteria 1885
291 Ga0105238_10765710 3300009551 Bacteria 980
292 Ga0105238_11499374 3300009551 Bacteria 703
293 Ga0105249_10054515 3300009553 Bacteria 3657
294 Ga0105249_10350032 3300009553 Bacteria 1496
295 Ga0105249_11132220 3300009553 Bacteria 853
296 Ga0105239_10032629 3300010375 Bacteria 5723
297 Ga0105239_13570537 3300010375 Bacteria 505
298 Ga0105246_10065494 3300011119 Bacteria 2541
299 Ga0157371_10146563 3300013102 Bacteria 1682
300 Ga0157371_11411235 3300013102 Unclassified 541
301 Ga0157369_10024205 3300013105 Bacteria 6758
302 Ga0157369_10153752 3300013105 Unclassified 2431
303 Ga0157369_10520026 3300013105 Bacteria 1231
304 Ga0157374_10701271 3300013296 Unclassified 1025
305 Ga0157374_10795717 3300013296 Unclassified 961
306 Ga0157374_11841078 3300013296 Unclassified 631
307 Ga0157374_12034036 3300013296 Bacteria 601
308 Ga0163162_10199501 3300013306 Bacteria 2129
309 Ga0163162_10391644 3300013306 Bacteria 1522
310 Ga0163162_12452898 3300013306 Bacteria 600
311 Ga0157372_10969467 3300013307 Bacteria 985
312 Ga0157372_11064732 3300013307 Bacteria 936
313 Ga0157372_12460908 3300013307 Unclassified 598
314 Ga0157372_12727605 3300013307 Bacteria 567
315 Ga0157375_10013962 3300013308 Bacteria 7160
316 Ga0157375_10130638 3300013308 Bacteria 2630
317 Ga0157375_10419824 3300013308 Bacteria 1504
318 Ga0157375_10501556 3300013308 Bacteria 1378
319 Ga0157375_11048761 3300013308 Bacteria 953
320 Ga0157375_11202116 3300013308 Bacteria 889
321 Ga0163163_10164479 3300014325 Bacteria 2264
322 Ga0157380_10054053 3300014326 Bacteria 3185
323 Ga0157380_10105132 3300014326 Bacteria 2359
324 Ga0157380_10171023 3300014326 Bacteria 1899
325 Ga0157380_10234908 3300014326 Bacteria 1649
326 Ga0157380_11880855 3300014326 Bacteria 659
327 Ga0157380_12973958 3300014326 Bacteria 540
328 Ga0157377_10018546 3300014745 Bacteria 3618
329 Ga0157377_10218903 3300014745 Bacteria 1218
330 Ga0157376_10191791 3300014969 Bacteria 1874
331 Ga0182007_10155661 3300015262 Bacteria 779
332 Ga0182005_1053327 3300015265 Bacteria 1101
333 Ga0163161_10005100 3300017792 Bacteria 9140
334 Ga0163161_10285511 3300017792 Bacteria 1296
335 Ga0163161_10448789 3300017792 Bacteria 1042
336 Ga0224712_10522319 3300022467 Bacteria 575
337 Ga0207697_10006000 3300025315 Bacteria 5563
338 Ga0207697_10422499 3300025315 Unclassified 592
339 Ga0207656_10010755 3300025321 Bacteria 3438
340 Ga0207653_10011459 3300025885 Bacteria 2767
341 Ga0207682_10105718 3300025893 Bacteria 1235
342 Ga0207682_10348797 3300025893 Bacteria 697
343 Ga0207642_10008411 3300025899 Bacteria 3538
344 Ga0207642_10191855 3300025899 Bacteria 1122
345 Ga0207688_10199663 3300025901 Bacteria 1198
346 Ga0207688_10236633 3300025901 Bacteria 1103
347 Ga0207680_10021674 3300025903 Bacteria 3480
348 Ga0207647_10038330 3300025904 Bacteria 3031
349 Ga0207685_10294393 3300025905 Bacteria 801
350 Ga0207645_10002478 3300025907 Bacteria 14486
351 Ga0207645_10007793 3300025907 Bacteria 7536
352 Ga0207643_10007531 3300025908 Bacteria 5844
353 Ga0207643_10100193 3300025908 Bacteria 1698
354 Ga0207684_10000988 3300025910 Bacteria 31913
355 Ga0207707_10022740 3300025912 Bacteria 5482
356 Ga0207707_10100148 3300025912 Bacteria 2533
357 Ga0207707_10106036 3300025912 Bacteria 2456
358 Ga0207695_10661129 3300025913 Bacteria 926
359 Ga0207693_11060156 3300025915 Bacteria 617
360 Ga0207663_10761705 3300025916 Bacteria 769
361 Ga0207663_10816775 3300025916 Bacteria 743
362 Ga0207660_10003237 3300025917 Bacteria 10658
363 Ga0207660_10017009 3300025917 Bacteria 4824
364 Ga0207660_10057064 3300025917 Bacteria 2796
365 Ga0207660_11604614 3300025917 Bacteria 524
366 Ga0207662_10001560 3300025918 Bacteria 11197
367 Ga0207662_10022672 3300025918 Bacteria 3602
368 Ga0207662_10081420 3300025918 Bacteria 1976
369 Ga0207662_10086192 3300025918 Bacteria 1924
370 Ga0207657_10119367 3300025919 Bacteria 2170
371 Ga0207657_10163094 3300025919 Bacteria 1809
372 Ga0207649_10015706 3300025920 Bacteria 4255
373 Ga0207649_11072528 3300025920 Bacteria 635
374 Ga0207652_10047241 3300025921 Bacteria 3677
375 Ga0207652_10052835 3300025921 Bacteria 3489
376 Ga0207646_10242728 3300025922 Bacteria 1627
377 Ga0207681_10040365 3300025923 Bacteria 3105
378 Ga0207681_10123990 3300025923 Bacteria 1899
379 Ga0207681_10219572 3300025923 Bacteria 1470
380 Ga0207681_10260071 3300025923 Bacteria 1358
381 Ga0207681_10604690 3300025923 Bacteria 906
382 Ga0207681_10662441 3300025923 Bacteria 866
383 Ga0207681_10746726 3300025923 Bacteria 815
384 Ga0207694_11026598 3300025924 Bacteria 698
385 Ga0207650_10108081 3300025925 Bacteria 2150
386 Ga0207650_10188509 3300025925 Bacteria 1647
387 Ga0207650_11663665 3300025925 Bacteria 541
388 Ga0207650_11676941 3300025925 Unclassified 539
389 Ga0207659_10011466 3300025926 Bacteria 5600
390 Ga0207659_10018004 3300025926 Bacteria 4624
391 Ga0207659_10139748 3300025926 Bacteria 1879
392 Ga0207659_10150540 3300025926 Bacteria 1816
393 Ga0207659_10191701 3300025926 Bacteria 1627
394 Ga0207659_10229321 3300025926 Bacteria 1497
395 Ga0207687_10153599 3300025927 Bacteria 1759
396 Ga0207700_10376612 3300025928 Bacteria 1240
397 Ga0207644_10111898 3300025931 Bacteria 2066
398 Ga0207690_10079528 3300025932 Bacteria 2285
399 Ga0207690_10167992 3300025932 Bacteria 1641
400 Ga0207706_10002275 3300025933 Bacteria 18748
401 Ga0207706_10084577 3300025933 Bacteria 2789
402 Ga0207706_10639712 3300025933 Bacteria 911
403 Ga0207686_10013181 3300025934 Bacteria 4569
404 Ga0207686_10017128 3300025934 Bacteria 4077
405 Ga0207686_10216047 3300025934 Bacteria 1381
406 Ga0207686_10313766 3300025934 Bacteria 1169
407 Ga0207686_11270816 3300025934 Bacteria 604
408 Ga0207709_10048039 3300025935 Bacteria 2599
409 Ga0207709_10155200 3300025935 Bacteria 1590
410 Ga0207709_11595153 3300025935 Bacteria 542
411 Ga0207670_10165745 3300025936 Bacteria 1653
412 Ga0207670_10253892 3300025936 Bacteria 1360
413 Ga0207670_10579391 3300025936 Bacteria 920
414 Ga0207669_10180008 3300025937 Bacteria 1514
415 Ga0207669_11173805 3300025937 Bacteria 650
416 Ga0207704_10005396 3300025938 Bacteria 5893
417 Ga0207704_11381570 3300025938 Bacteria 603
418 Ga0207665_10025345 3300025939 Bacteria 3912
419 Ga0207665_10347698 3300025939 Unclassified 1119
420 Ga0207691_10002158 3300025940 Bacteria 19247
421 Ga0207691_10015270 3300025940 Bacteria 7307
422 Ga0207691_10028529 3300025940 Bacteria 5225
423 Ga0207691_10079493 3300025940 Bacteria 2951
424 Ga0207691_10115676 3300025940 Bacteria 2381
425 Ga0207691_10168561 3300025940 Bacteria 1918
426 Ga0207691_10271956 3300025940 Bacteria 1459
427 Ga0207691_10466844 3300025940 Bacteria 1073
428 Ga0207711_10058128 3300025941 Bacteria 3327
429 Ga0207711_10123661 3300025941 Bacteria 2312
430 Ga0207689_10003393 3300025942 Bacteria 14553
431 Ga0207689_10011342 3300025942 Bacteria 7644
432 Ga0207689_10084325 3300025942 Bacteria 2612
433 Ga0207689_10172966 3300025942 Bacteria 1781
434 Ga0207689_10561660 3300025942 Bacteria 959
435 Ga0207661_10033075 3300025944 Bacteria 4011
436 Ga0207661_10151930 3300025944 Bacteria 2002
437 Ga0207661_10236836 3300025944 Bacteria 1618
438 Ga0207661_10392035 3300025944 Bacteria 1258
439 Ga0207679_10021928 3300025945 Bacteria 4340
440 Ga0207679_10078050 3300025945 Bacteria 2521
441 Ga0207679_10222243 3300025945 Bacteria 1589
442 Ga0207679_11633522 3300025945 Bacteria 590
443 Ga0207667_10612075 3300025949 Bacteria 1097
444 Ga0207667_12027171 3300025949 Bacteria 535
445 Ga0207651_10004168 3300025960 Bacteria 7232
446 Ga0207651_10008840 3300025960 Bacteria 5468
447 Ga0207651_10063210 3300025960 Bacteria 2584
448 Ga0207651_10074862 3300025960 Bacteria 2413
449 Ga0207651_10184367 3300025960 Bacteria 1659
450 Ga0207651_10264480 3300025960 Bacteria 1414
451 Ga0207651_10423666 3300025960 Bacteria 1137
452 Ga0207651_10519963 3300025960 Bacteria 1031
453 Ga0207712_10062534 3300025961 Bacteria 2647
454 Ga0207712_10207958 3300025961 Bacteria 1556
455 Ga0207668_10001609 3300025972 Bacteria 13176
456 Ga0207668_10264140 3300025972 Bacteria 1404
457 Ga0207668_10341573 3300025972 Bacteria 1249
458 Ga0207668_10479896 3300025972 Bacteria 1066
459 Ga0207640_10528328 3300025981 Bacteria 987
460 Ga0207640_11070420 3300025981 Bacteria 712
461 Ga0207658_10083445 3300025986 Bacteria 2456
462 Ga0207658_10175794 3300025986 Bacteria 1768
463 Ga0207658_10332627 3300025986 Bacteria 1318
464 Ga0207677_10005781 3300026023 Bacteria 6727
465 Ga0207677_10212957 3300026023 Bacteria 1544
466 Ga0207677_11094004 3300026023 Unclassified 726
467 Ga0207703_10397586 3300026035 Bacteria 1278
468 Ga0207703_10652126 3300026035 Bacteria 999
469 Ga0207703_10778914 3300026035 Bacteria 912
470 Ga0207639_10604097 3300026041 Bacteria 1012
471 Ga0207639_10754416 3300026041 Bacteria 905
472 Ga0207678_10099662 3300026067 Bacteria 2482
473 Ga0207678_10118192 3300026067 Bacteria 2262
474 Ga0207678_10410557 3300026067 Bacteria 1173
475 Ga0207708_10011867 3300026075 Bacteria 6489
476 Ga0207708_10035146 3300026075 Bacteria 3813
477 Ga0207708_10165536 3300026075 Bacteria 1748
478 Ga0207708_10331184 3300026075 Bacteria 1245
479 Ga0207702_10552743 3300026078 Bacteria 1126
480 Ga0207641_10090369 3300026088 Bacteria 2678
481 Ga0207641_10473897 3300026088 Bacteria 1212
482 Ga0207641_11240170 3300026088 Bacteria 746
483 Ga0207648_10000551 3300026089 Bacteria 41986
484 Ga0207648_10051204 3300026089 Bacteria 3609
485 Ga0207648_10120443 3300026089 Bacteria 2307
486 Ga0207648_10154837 3300026089 Bacteria 2023
487 Ga0207648_11014767 3300026089 Bacteria 777
488 Ga0207676_10046057 3300026095 Bacteria 3373
489 Ga0207676_10293769 3300026095 Bacteria 1481
490 Ga0207676_10618875 3300026095 Bacteria 1042
491 Ga0207676_10715341 3300026095 Bacteria 971
492 Ga0207674_10024415 3300026116 Bacteria 6461
493 Ga0207674_10171768 3300026116 Bacteria 2121
494 Ga0207674_10232570 3300026116 Bacteria 1791
495 Ga0207674_10494334 3300026116 Bacteria 1182
496 Ga0207674_11149652 3300026116 Bacteria 746
497 Ga0207675_100003331 3300026118 Bacteria 15730
498 Ga0207675_100025392 3300026118 Bacteria 5515
499 Ga0207675_100089032 3300026118 Bacteria 2900
500 Ga0207675_100218796 3300026118 Bacteria 1834
501 Ga0207675_100369417 3300026118 Bacteria 1409
502 Ga0207683_10032151 3300026121 Bacteria 4557
503 Ga0207683_10033162 3300026121 Bacteria 4485
504 Ga0207683_10074271 3300026121 Bacteria 3008
505 Ga0207683_10392724 3300026121 Bacteria 1276
506 Ga0207698_10100132 3300026142 Bacteria 2399
507 Ga0207698_10843538 3300026142 Bacteria 921
508 Ga0207428_10293590 3300027907 Bacteria 1204
509 Ga0268266_10014931 3300028379 Bacteria 6669
510 Ga0268266_12009131 3300028379 Bacteria 551
511 Ga0268266_12352312 3300028379 Bacteria 504
512 Ga0268265_10003200 3300028380 Bacteria 11889
513 Ga0268265_10479239 3300028380 Bacteria 1168
514 Ga0268265_10501893 3300028380 Bacteria 1143
515 Ga0268265_11072417 3300028380 Bacteria 799
516 Ga0268265_11624558 3300028380 Bacteria 651
517 Ga0268264_10062415 3300028381 Bacteria 3129
518 Ga0268264_10525666 3300028381 Bacteria 1157
519 Ga0265326_10000030 3300028558 Bacteria 96518
520 Ga0265334_10000156 3300028573 Bacteria 42408
521 Ga0265336_10000515 3300028666 Bacteria 22427
522 Ga0307515_10254904 3300028794 Bacteria 1501
523 Ga0265338_10000536 3300028800 Bacteria 66434
524 Ga0265324_10001136 3300029957 Bacteria 15983
525 Ga0307408_100031663 3300031548 Bacteria 3684
526 Ga0307508_10063620 3300031616 Bacteria 3255
527 Ga0307405_10039360 3300031731 Bacteria 2857
528 Ga0307405_10606284 3300031731 Bacteria 894
529 Ga0307413_11154184 3300031824 Bacteria 671
530 Ga0307410_10024983 3300031852 Bacteria 3741
531 Ga0307410_10261172 3300031852 Bacteria 1351
532 Ga0326468_10000021 3300031889 Bacteria 12165
533 Ga0307406_10001677 3300031901 Bacteria 12178
534 Ga0307406_10027792 3300031901 Bacteria 3412
535 Ga0307406_10234806 3300031901 Bacteria 1372
536 Ga0307407_10086159 3300031903 Bacteria 1913
537 Ga0307407_10579370 3300031903 Bacteria 833
538 Ga0307412_11069980 3300031911 Bacteria 716
539 Ga0307409_100350091 3300031995 Bacteria 1393
540 Ga0307409_102006196 3300031995 Bacteria 608
541 Ga0307416_100004545 3300032002 Bacteria 8383
542 Ga0307414_10009606 3300032004 Bacteria 5566
543 Ga0307414_10636522 3300032004 Bacteria 960
544 Ga0307414_10768065 3300032004 Bacteria 877
545 Ga0307411_10078535 3300032005 Bacteria 2263
546 Ga0307411_10725761 3300032005 Bacteria 868
547 Ga0307415_100002990 3300032126 Bacteria 8501
548 Ga0373932_0191331 3300035112 Bacteria 723
549 Ga0373953_0116379 3300035117 Bacteria 1133
550 Ga0373935_0624804 3300035692 Bacteria 789
551 Ga0373935_0643922 3300035692 Bacteria 777
552 Ga0373937_0115815 3300036401 Bacteria 2496
553 Ga0373925_0791518 3300037068 Unclassified 782
554 Ga0395905_0623205 3300037471 Bacteria 981
555 Ga0395905_0856254 3300037471 Bacteria 812
556 Ga0395905_1646933 3300037471 Bacteria 547
557 Ga0436364_0441591 3300037853 Bacteria 4519
558 Ga0242420_022093 3300038996 Bacteria 1143
559 Ga0451853_1677095 3300041512 Unclassified 790
560 Ga0439451_013466 3300042009 Bacteria 1653
561 Ga0439455_0032029 3300042012 Bacteria 1312
562 Ga0439464_0295205 3300042439 Bacteria 529
563 Ga0453683_0497904 3300044673 Bacteria 791
564 Ga0466963_0041002 3300044694 Bacteria 3035
565 Ga0466971_0161754 3300044719 Bacteria 1048
566 Ga0466970_0395261 3300044765 Bacteria 788
567 Ga0466957_0076831 3300044842 Bacteria 2074
568 Ga0466957_0159806 3300044842 Unclassified 1463
569 Ga0451576_0145820 3300045051 Bacteria 2468
570 Ga0451576_0227352 3300045051 Bacteria 1948
571 Ga0466967_0038607 3300045976 Bacteria 4097
572 Ga0495629_0031961 3300046459 Bacteria 3727
573 Ga0495580_0180394 3300046472 Bacteria 1458
574 Ga0495582_0780886 3300046473 Bacteria 553
575 Ga0495639_0176371 3300046475 Bacteria 1039
576 Ga0495662_0000113 3300046476 Bacteria 30181
577 Ga0495664_0017515 3300046477 Bacteria 4097
578 Ga0495594_0225536 3300046499 Bacteria 1068
579 Ga0495594_0723865 3300046499 Bacteria 562
580 Ga0495608_0004231 3300046511 Bacteria 10290
581 Ga0495628_0031464 3300046516 Bacteria 4291
582 Ga0495630_0068328 3300046517 Bacteria 2671
583 Ga0495666_0003996 3300046526 Bacteria 7457
584 Ga0495665_0034266 3300046531 Bacteria 2715
585 Ga0495640_0010651 3300046533 Bacteria 7094
586 Ga0495587_0036118 3300046536 Bacteria 2973
587 Ga0495645_0003695 3300046543 Bacteria 10401
588 Ga0495622_0327639 3300046557 Bacteria 665
589 Ga0495633_0321670 3300046558 Bacteria 702
590 Ga0495667_0012980 3300046559 Bacteria 5647
591 Ga0495635_0015424 3300046663 Bacteria 5343
592 Ga0495588_0341859 3300046674 Unclassified 787
593 Ga0495657_0006227 3300046675 Bacteria 9354
594 Ga0495599_0172608 3300046678 Bacteria 1333
595 Ga0495646_0000915 3300046680 Bacteria 16761
596 Ga0495613_0126606 3300046689 Bacteria 1831
597 Ga0495670_0712401 3300046691 Bacteria 547
598 Ga0495600_0840276 3300046809 Bacteria 545
599 Ga0495581_0039480 3300047315 Bacteria 2732
600 Ga0495604_0000185 3300047317 Bacteria 55651
601 Ga0495672_0029189 3300047320 Bacteria 3477
602 Ga0495675_0808364 3300047444 Bacteria 518
603 Ga0495684_0436641 3300047471 Bacteria 912
604 Ga0495593_0336782 3300047673 Bacteria 754
605 Ga0495602_0045575 3300048088 Bacteria 3967
606 Ga0496102_0783826 3300048905 Bacteria 876
607 Ga0496108_0421939 3300048911 Bacteria 1165
608 Ga0496111_0935837 3300048914 Bacteria 623
609 Ga0496112_0475198 3300048915 Bacteria 1187
610 Ga0496113_0458045 3300048916 Bacteria 1025
611 Ga0496114_1686246 3300048917 Bacteria 522
612 Ga0501036_0059601 3300049572 Bacteria 3234
613 Ga0501043_1314091 3300049579 Bacteria 504
614 Ga0501067_0850787 3300049583 Unclassified 514
615 Ga0501071_0642990 3300049587 Bacteria 816
616 Ga0501075_0031066 3300049591 Bacteria 3962
617 Ga0501202_105325 3300049652 Bacteria 692
618 Ga0501216_092154 3300049660 Bacteria 656
619 Ga0501217_110055 3300049661 Bacteria 791
620 Ga0501249_119657 3300049679 Bacteria 642
621 Ga0501045_0050786 3300049824 Bacteria 3026
622 nmdc:mga05p37_1178920_c1 3300050507 Bacteria 794
623 nmdc:mga05p37_372488_c1 3300050507 Bacteria 1675
624 nmdc:mga09592_126830_c1 3300050508 Bacteria 2194
625 nmdc:mga09592_1733832_c1 3300050508 Bacteria 503
626 nmdc:mga09592_219694_c1 3300050508 Bacteria 1646
627 nmdc:mga09592_320870_c1 3300050508 Bacteria 1342
628 nmdc:mga09592_333994_c1 3300050508 Bacteria 1312
629 nmdc:mga09592_386545_c1 3300050508 Bacteria 1210
630 nmdc:mga09592_912184_c1 3300050508 Bacteria 738
631 nmdc:mga0qj67_150811_c1 3300050509 Bacteria 1886
632 nmdc:mga0qj67_6744_c1 3300050509 Bacteria 8439
633 nmdc:mga0qj67_81603_c1 3300050509 Bacteria 2593
634 nmdc:mga06r32_1022688_c1 3300050510 Bacteria 778
635 nmdc:mga06r32_59648_c1 3300050510 Bacteria 3670
636 nmdc:mga06r32_71409_c1 3300050510 Bacteria 3359
637 nmdc:mga08y16_122391_c1 3300050511 Bacteria 2707
638 nmdc:mga08y16_147752_c1 3300050511 Bacteria 2443
639 nmdc:mga08y16_158540_c1 3300050511 Bacteria 2351
640 nmdc:mga0n895_23303_c1 3300050512 Bacteria 5816
641 nmdc:mga0n895_32489_c1 3300050512 Bacteria 5009
642 nmdc:mga0rr50_116243_c1 3300050513 Bacteria 2123
643 nmdc:mga0a205_56794_c1 3300050515 Bacteria 3779
644 Ga0495601_0004999 3300053077 Bacteria 7694
645 Ga0495619_0014081 3300053085 Bacteria 5047
646 Ga0495619_0028530 3300053085 Bacteria 3601
647 Ga0500646_0000656 3300053090 Bacteria 9896
648 Ga0500616_0000627 3300053153 Bacteria 42906
649 Ga0501084_0945627 3300054114 Bacteria 725
650 Ga0590077_076580 3300059426 Bacteria 767
651 Ga0501082_0102089 3300060353 Bacteria 2481
652 Ga0530510_0505600 3300061734 Bacteria 916
653 Ga0307408_100068406
654 JGI25406J46586_10142707
655 JGI25407J50210_10002846
656 Ga0070676_10027831
657 Ga0070676_10073454
658 Ga0070676_10074600
659 Ga0070683_100007034
660 Ga0070683_100024842
661 Ga0070683_100093414
662 Ga0070683_100108092
663 Ga0070683_100117507
664 Ga0070683_100304386
665 Ga0070683_100377910
666 Ga0070683_100812240
667 Ga0070690_100050276
668 Ga0070690_100401343
669 Ga0070670_100018431
670 Ga0070670_100070826
671 Ga0070670_100088694
672 Ga0070670_101783655
673 Ga0070677_10033194
674 Ga0070677_10099457
675 Ga0070677_10681277
676 Ga0068869_100013265
677 Ga0068869_100065297
678 Ga0068869_100106823
679 Ga0070666_10076832
680 Ga0070666_10115867
681 Ga0070666_10430569
682 Ga0070666_10819592
683 Ga0070666_11468481
684 Ga0070680_100000749
685 Ga0070680_100020637
686 Ga0070680_100050312
687 Ga0070680_101993623
688 Ga0070682_100284827
689 Ga0070682_100400335
690 Ga0070682_101006423
691 Ga0068868_100010115
692 Ga0068868_100253239
693 Ga0070660_101033459
694 Ga0070660_101356479
695 Ga0070689_100067877
696 Ga0070689_100137678
697 Ga0070689_100445736
698 Ga0070691_10486753
699 Ga0070687_100016010
700 Ga0070687_100047191
701 Ga0070687_100324791
702 Ga0070661_100001264
703 Ga0070661_100007632
704 Ga0070661_100068669
705 Ga0070661_100626986
706 Ga0070661_100775996
707 Ga0070692_10002460
708 Ga0070692_10447574
709 Ga0070692_10475429
710 Ga0070668_100197391
711 Ga0070668_100298863
712 Ga0070668_100404971
713 Ga0070668_100486350
714 Ga0070669_100002280
715 Ga0070669_100006275
716 Ga0070669_100041559
717 Ga0070669_100068709
718 Ga0070669_100097407
719 Ga0070669_100735085
720 Ga0070669_101115571
721 Ga0070675_100007811
722 Ga0070675_100019344
723 Ga0070675_100035036
724 Ga0070675_100135814
725 Ga0070675_100182604
726 Ga0070671_100003195
727 Ga0070671_100235924
728 Ga0070671_100880696
729 Ga0070671_100931534
730 Ga0070671_101612602
731 Ga0070674_100145651
732 Ga0070674_100523728
733 Ga0070673_100004747
734 Ga0070673_100007897
735 Ga0070673_100014063
736 Ga0070673_100527606
737 Ga0070673_100770314
738 Ga0070673_101380698
739 Ga0070673_102376202
740 Ga0070688_100013292
741 Ga0070688_100154185
742 Ga0070659_100003260
743 Ga0070659_100031565
744 Ga0070667_100014377
745 Ga0070667_100214789
746 Ga0070667_100450446
747 Ga0070667_100851528
748 Ga0070709_10114536
749 Ga0070713_100335303
750 Ga0070701_10008444
751 Ga0070701_10072776
752 Ga0070701_10145719
753 Ga0070701_10281883
754 Ga0070711_100914882
755 Ga0070705_100001750
756 Ga0070705_100564434
757 Ga0070700_100021510
758 Ga0070700_100057566
759 Ga0070700_100127559
760 Ga0070694_100017687
761 Ga0070694_100245119
762 Ga0070708_100021503
763 Ga0070663_100034743
764 Ga0070663_100142715
765 Ga0070663_102074676
766 Ga0070678_100151510
767 Ga0070678_100382731
768 Ga0070678_100558285
769 Ga0070678_101108609
770 Ga0070662_100023584
771 Ga0070662_100312961
772 Ga0070681_10001540
773 Ga0070681_10013864
774 Ga0070681_10032470
775 Ga0068867_100002350
776 Ga0068867_100314770
777 Ga0068867_100372355
778 Ga0068867_100615359
779 Ga0068867_101446086
780 Ga0070685_10052770
781 Ga0070685_10082492
782 Ga0070685_10116604
783 Ga0070685_10374614
784 Ga0070706_100000937
785 Ga0070706_101005258
786 Ga0070707_100016397
787 Ga0070698_100005982
788 Ga0070698_100868800
789 Ga0070698_101437273
790 Ga0070699_100004649
791 Ga0070679_100000050
792 Ga0070679_100017016
793 Ga0070684_100008956
794 Ga0070684_100014438
795 Ga0070684_100043899
796 Ga0070684_100058607
797 Ga0070684_100335063
798 Ga0070684_100549798
799 Ga0070684_100585709
800 Ga0070697_100095983
801 Ga0068853_100099719
802 Ga0068853_100969404
803 Ga0070672_100024624
804 Ga0070672_100030023
805 Ga0070672_100538578
806 Ga0070672_100577526
807 Ga0070672_101262604
808 Ga0070686_100354677
809 Ga0070686_100916562
810 Ga0070695_100194999
811 Ga0070665_100015167
812 Ga0070665_100028832
813 Ga0070665_101331329
814 Ga0070704_101185055
815 Ga0070704_101275145
816 Ga0068855_100403953
817 Ga0070664_100023131
818 Ga0070664_100048560
819 Ga0070664_100132228
820 Ga0070664_100141934
821 Ga0070664_100283686
822 Ga0070664_100382741
823 Ga0070664_101441926
824 Ga0068857_100005460
825 Ga0068857_100216511
826 Ga0068857_100256741
827 Ga0068857_100989250
828 Ga0068857_101946535
829 Ga0068854_100171374
830 Ga0068854_100390021
831 Ga0068856_100513658
832 Ga0068856_101863263
833 Ga0070702_100211932
834 Ga0070702_100373089
835 Ga0070702_100443246
836 Ga0070702_100469116
837 Ga0070702_100523574
838 Ga0068852_100517145
839 Ga0068852_100899118
840 Ga0068859_100014453
841 Ga0068859_100219579
842 Ga0068859_100441135
843 Ga0068859_100470034
844 Ga0068859_101320987
845 Ga0068864_100792366
846 Ga0068864_100805073
847 Ga0068864_100971670
848 Ga0068866_10005464
849 Ga0068866_10099769
850 Ga0068866_10798108
851 Ga0068861_100002142
852 Ga0068861_100117592
853 Ga0068861_100235804
854 Ga0068861_100520250
855 Ga0068861_100615034
856 Ga0068851_10002466
857 Ga0068851_10155494
858 Ga0068851_10656932
859 Ga0068870_10000605
860 Ga0068870_10357984
861 Ga0068863_100039464
862 Ga0068863_100695771
863 Ga0068858_100294735
864 Ga0068858_100319346
865 Ga0068858_100673106
866 Ga0068860_100110436
867 Ga0068860_100204560
868 Ga0068862_100005495
869 Ga0068862_100374502
870 Ga0068862_100496757
871 Ga0081538_10000424
872 Ga0081539_10001312
873 Ga0070716_100145608
874 Ga0070712_100367259
875 Ga0097621_100052905
876 Ga0097621_100171535
877 Ga0097621_100345528
878 Ga0097621_100976169
879 Ga0068871_100438045
880 Ga0068871_101213840
881 Ga0075428_100010127
882 Ga0075428_100151332
883 Ga0075428_100165245
884 Ga0075428_100589242
885 Ga0075428_100646793
886 Ga0075428_101504043
887 Ga0075430_100001430
888 Ga0075430_100039688
889 Ga0075430_100178617
890 Ga0075431_100063570
891 Ga0075431_100105575
892 Ga0075431_100305107
893 Ga0075431_100507985
894 Ga0075431_101409844
895 Ga0075433_10022829
896 Ga0075433_10214829
897 Ga0075434_100007768
898 Ga0075434_100025973
899 Ga0075434_100729394
900 Ga0075429_100023889
901 Ga0075429_100331044
902 Ga0075429_100354767
903 Ga0075429_100427126
904 Ga0075429_100464398
905 Ga0068865_100001169
906 Ga0068865_100045168
907 Ga0068865_100547152
908 Ga0068865_100790375
909 Ga0068865_101581821
910 Ga0097620_100014450
911 Ga0097620_100219584
912 Ga0097620_100441141
913 Ga0097620_100469982
914 Ga0097620_101321212
915 Ga0075435_100155668
916 Ga0105240_10013209
917 Ga0105240_10662069
918 Ga0111539_10175261
919 Ga0111539_10220342
920 Ga0111539_10223637
921 Ga0105245_10077191
922 Ga0114129_10197822
923 Ga0114129_10614762
924 Ga0114129_12008543
925 Ga0105243_10033783
926 Ga0105243_10800693
927 Ga0105243_10963447
928 Ga0105243_11775798
929 Ga0105242_10011833
930 Ga0105242_10035546
931 Ga0105242_10077549
932 Ga0105242_10179022
933 Ga0105242_10571352
934 Ga0105242_11651150
935 Ga0105248_10119139
936 Ga0105248_10319943
937 Ga0105248_10589392
938 Ga0105248_10728398
939 Ga0105248_12778666
940 Ga0105237_10633515
941 Ga0105237_12277457
942 Ga0105238_10217869
943 Ga0105238_10765710
944 Ga0105238_11499374
945 Ga0105249_10054515
946 Ga0105249_10350032
947 Ga0105249_11132220
948 Ga0105239_10032629
949 Ga0105239_13570537
950 Ga0105246_10065494
951 Ga0157371_10146563
952 Ga0157371_11411235
953 Ga0157369_10024205
954 Ga0157369_10153752
955 Ga0157369_10520026
956 Ga0157374_10701271
957 Ga0157374_10795717
958 Ga0157374_11841078
959 Ga0157374_12034036
960 Ga0163162_10199501
961 Ga0163162_10391644
962 Ga0163162_12452898
963 Ga0157372_10969467
964 Ga0157372_11064732
965 Ga0157372_12460908
966 Ga0157372_12727605
967 Ga0157375_10013962
968 Ga0157375_10130638
969 Ga0157375_10419824
970 Ga0157375_10501556
971 Ga0157375_11048761
972 Ga0157375_11202116
973 Ga0163163_10164479
974 Ga0157380_10054053
975 Ga0157380_10105132
976 Ga0157380_10171023
977 Ga0157380_10234908
978 Ga0157380_11880855
979 Ga0157380_12973958
980 Ga0157377_10018546
981 Ga0157377_10218903
982 Ga0157376_10191791
983 Ga0182007_10155661
984 Ga0182005_1053327
985 Ga0163161_10005100
986 Ga0163161_10285511
987 Ga0163161_10448789
988 Ga0224712_10522319
989 Ga0207697_10006000
990 Ga0207697_10422499
991 Ga0207656_10010755
992 Ga0207653_10011459
993 Ga0207682_10105718
994 Ga0207682_10348797
995 Ga0207642_10008411
996 Ga0207642_10191855
997 Ga0207688_10199663
998 Ga0207688_10236633
999 Ga0207680_10021674
1000 Ga0207647_10038330
1001 Ga0207685_10294393
1002 Ga0207645_10002478
1003 Ga0207645_10007793
1004 Ga0207643_10007531
1005 Ga0207643_10100193
1006 Ga0207684_10000988
1007 Ga0207707_10022740
1008 Ga0207707_10100148
1009 Ga0207707_10106036
1010 Ga0207695_10661129
1011 Ga0207693_11060156
1012 Ga0207663_10761705
1013 Ga0207663_10816775
1014 Ga0207660_10003237
1015 Ga0207660_10017009
1016 Ga0207660_10057064
1017 Ga0207660_11604614
1018 Ga0207662_10001560
1019 Ga0207662_10022672
1020 Ga0207662_10081420
1021 Ga0207662_10086192
1022 Ga0207657_10119367
1023 Ga0207657_10163094
1024 Ga0207649_10015706
1025 Ga0207649_11072528
1026 Ga0207652_10047241
1027 Ga0207652_10052835
1028 Ga0207646_10242728
1029 Ga0207681_10040365
1030 Ga0207681_10123990
1031 Ga0207681_10219572
1032 Ga0207681_10260071
1033 Ga0207681_10604690
1034 Ga0207681_10662441
1035 Ga0207681_10746726
1036 Ga0207694_11026598
1037 Ga0207650_10108081
1038 Ga0207650_10188509
1039 Ga0207650_11663665
1040 Ga0207650_11676941
1041 Ga0207659_10011466
1042 Ga0207659_10018004
1043 Ga0207659_10139748
1044 Ga0207659_10150540
1045 Ga0207659_10191701
1046 Ga0207659_10229321
1047 Ga0207687_10153599
1048 Ga0207700_10376612
1049 Ga0207644_10111898
1050 Ga0207690_10079528
1051 Ga0207690_10167992
1052 Ga0207706_10002275
1053 Ga0207706_10084577
1054 Ga0207706_10639712
1055 Ga0207686_10013181
1056 Ga0207686_10017128
1057 Ga0207686_10216047
1058 Ga0207686_10313766
1059 Ga0207686_11270816
1060 Ga0207709_10048039
1061 Ga0207709_10155200
1062 Ga0207709_11595153
1063 Ga0207670_10165745
1064 Ga0207670_10253892
1065 Ga0207670_10579391
1066 Ga0207669_10180008
1067 Ga0207669_11173805
1068 Ga0207704_10005396
1069 Ga0207704_11381570
1070 Ga0207665_10025345
1071 Ga0207665_10347698
1072 Ga0207691_10002158
1073 Ga0207691_10015270
1074 Ga0207691_10028529
1075 Ga0207691_10079493
1076 Ga0207691_10115676
1077 Ga0207691_10168561
1078 Ga0207691_10271956
1079 Ga0207691_10466844
1080 Ga0207711_10058128
1081 Ga0207711_10123661
1082 Ga0207689_10003393
1083 Ga0207689_10011342
1084 Ga0207689_10084325
1085 Ga0207689_10172966
1086 Ga0207689_10561660
1087 Ga0207661_10033075
1088 Ga0207661_10151930
1089 Ga0207661_10236836
1090 Ga0207661_10392035
1091 Ga0207679_10021928
1092 Ga0207679_10078050
1093 Ga0207679_10222243
1094 Ga0207679_11633522
1095 Ga0207667_10612075
1096 Ga0207667_12027171
1097 Ga0207651_10004168
1098 Ga0207651_10008840
1099 Ga0207651_10063210
1100 Ga0207651_10074862
1101 Ga0207651_10184367
1102 Ga0207651_10264480
1103 Ga0207651_10423666
1104 Ga0207651_10519963
1105 Ga0207712_10062534
1106 Ga0207712_10207958
1107 Ga0207668_10001609
1108 Ga0207668_10264140
1109 Ga0207668_10341573
1110 Ga0207668_10479896
1111 Ga0207640_10528328
1112 Ga0207640_11070420
1113 Ga0207658_10083445
1114 Ga0207658_10175794
1115 Ga0207658_10332627
1116 Ga0207677_10005781
1117 Ga0207677_10212957
1118 Ga0207677_11094004
1119 Ga0207703_10397586
1120 Ga0207703_10652126
1121 Ga0207703_10778914
1122 Ga0207639_10604097
1123 Ga0207639_10754416
1124 Ga0207678_10099662
1125 Ga0207678_10118192
1126 Ga0207678_10410557
1127 Ga0207708_10011867
1128 Ga0207708_10035146
1129 Ga0207708_10165536
1130 Ga0207708_10331184
1131 Ga0207702_10552743
1132 Ga0207641_10090369
1133 Ga0207641_10473897
1134 Ga0207641_11240170
1135 Ga0207648_10000551
1136 Ga0207648_10051204
1137 Ga0207648_10120443
1138 Ga0207648_10154837
1139 Ga0207648_11014767
1140 Ga0207676_10046057
1141 Ga0207676_10293769
1142 Ga0207676_10618875
1143 Ga0207676_10715341
1144 Ga0207674_10024415
1145 Ga0207674_10171768
1146 Ga0207674_10232570
1147 Ga0207674_10494334
1148 Ga0207674_11149652
1149 Ga0207675_100003331
1150 Ga0207675_100025392
1151 Ga0207675_100089032
1152 Ga0207675_100218796
1153 Ga0207675_100369417
1154 Ga0207683_10032151
1155 Ga0207683_10033162
1156 Ga0207683_10074271
1157 Ga0207683_10392724
1158 Ga0207698_10100132
1159 Ga0207698_10843538
1160 Ga0207428_10293590
1161 Ga0268266_10014931
1162 Ga0268266_12009131
1163 Ga0268266_12352312
1164 Ga0268265_10003200
1165 Ga0268265_10479239
1166 Ga0268265_10501893
1167 Ga0268265_11072417
1168 Ga0268265_11624558
1169 Ga0268264_10062415
1170 Ga0268264_10525666
1171 Ga0265326_10000030
1172 Ga0265334_10000156
1173 Ga0265336_10000515
1174 Ga0307515_10254904
1175 Ga0265338_10000536
1176 Ga0265324_10001136
1177 Ga0307408_100031663
1178 Ga0307508_10063620
1179 Ga0307405_10039360
1180 Ga0307405_10606284
1181 Ga0307413_11154184
1182 Ga0307410_10024983
1183 Ga0307410_10261172
1184 Ga0326468_10000021
1185 Ga0307406_10001677
1186 Ga0307406_10027792
1187 Ga0307406_10234806
1188 Ga0307407_10086159
1189 Ga0307407_10579370
1190 Ga0307412_11069980
1191 Ga0307409_100350091
1192 Ga0307409_102006196
1193 Ga0307416_100004545
1194 Ga0307414_10009606
1195 Ga0307414_10636522
1196 Ga0307414_10768065
1197 Ga0307411_10078535
1198 Ga0307411_10725761
1199 Ga0307415_100002990
1200 Ga0373932_0191331
1201 Ga0373953_0116379
1202 Ga0373935_0624804
1203 Ga0373935_0643922
1204 Ga0373937_0115815
1205 Ga0373925_0791518
1206 Ga0395905_0623205
1207 Ga0395905_0856254
1208 Ga0395905_1646933
1209 Ga0436364_0441591
1210 Ga0242420_022093
1211 Ga0451853_1677095
1212 Ga0439451_013466
1213 Ga0439455_0032029
1214 Ga0439464_0295205
1215 Ga0453683_0497904
1216 Ga0466963_0041002
1217 Ga0466971_0161754
1218 Ga0466970_0395261
1219 Ga0466957_0076831
1220 Ga0466957_0159806
1221 Ga0451576_0145820
1222 Ga0451576_0227352
1223 Ga0466967_0038607
1224 Ga0495629_0031961
1225 Ga0495580_0180394
1226 Ga0495582_0780886
1227 Ga0495639_0176371
1228 Ga0495662_0000113
1229 Ga0495664_0017515
1230 Ga0495594_0225536
1231 Ga0495594_0723865
1232 Ga0495608_0004231
1233 Ga0495628_0031464
1234 Ga0495630_0068328
1235 Ga0495666_0003996
1236 Ga0495665_0034266
1237 Ga0495640_0010651
1238 Ga0495587_0036118
1239 Ga0495645_0003695
1240 Ga0495622_0327639
1241 Ga0495633_0321670
1242 Ga0495667_0012980
1243 Ga0495635_0015424
1244 Ga0495588_0341859
1245 Ga0495657_0006227
1246 Ga0495599_0172608
1247 Ga0495646_0000915
1248 Ga0495613_0126606
1249 Ga0495670_0712401
1250 Ga0495600_0840276
1251 Ga0495581_0039480
1252 Ga0495604_0000185
1253 Ga0495672_0029189
1254 Ga0495675_0808364
1255 Ga0495684_0436641
1256 Ga0495593_0336782
1257 Ga0495602_0045575
1258 Ga0496102_0783826
1259 Ga0496108_0421939
1260 Ga0496111_0935837
1261 Ga0496112_0475198
1262 Ga0496113_0458045
1263 Ga0496114_1686246
1264 Ga0501036_0059601
1265 Ga0501043_1314091
1266 Ga0501067_0850787
1267 Ga0501071_0642990
1268 Ga0501075_0031066
1269 Ga0501202_105325
1270 Ga0501216_092154
1271 Ga0501217_110055
1272 Ga0501249_119657
1273 Ga0501045_0050786
1274 nmdc:mga05p37_1178920_c1
1275 nmdc:mga05p37_372488_c1
1276 nmdc:mga09592_126830_c1
1277 nmdc:mga09592_1733832_c1
1278 nmdc:mga09592_219694_c1
1279 nmdc:mga09592_320870_c1
1280 nmdc:mga09592_333994_c1
1281 nmdc:mga09592_386545_c1
1282 nmdc:mga09592_912184_c1
1283 nmdc:mga0qj67_150811_c1
1284 nmdc:mga0qj67_6744_c1
1285 nmdc:mga0qj67_81603_c1
1286 nmdc:mga06r32_1022688_c1
1287 nmdc:mga06r32_59648_c1
1288 nmdc:mga06r32_71409_c1
1289 nmdc:mga08y16_122391_c1
1290 nmdc:mga08y16_147752_c1
1291 nmdc:mga08y16_158540_c1
1292 nmdc:mga0n895_23303_c1
1293 nmdc:mga0n895_32489_c1
1294 nmdc:mga0rr50_116243_c1
1295 nmdc:mga0a205_56794_c1
1296 Ga0495601_0004999
1297 Ga0495619_0014081
1298 Ga0495619_0028530
1299 Ga0500646_0000656
1300 Ga0500616_0000627
1301 Ga0501084_0945627
1302 Ga0590077_076580
1303 Ga0501082_0102089
1304 Ga0530510_0505600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

126

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8711 2 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8569 2 113
3pht-assembly1.cif.gz_A-2 crystal structure of h74a mutant of helicobacter pylori nikr 0.7313 2 113
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7004 3 113
3bkt-assembly1.cif.gz_C copper-bound c-terminal domain of nikr 0.6977 1 113
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8711 2 113 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8569 2 113 3.30.70.1060
3phtA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.7314 2 113 3.30.70.1150
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7178 3 113 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.709 4 113 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A399VG70-F1-model_v4 deleted 0.9212 1 113
AF-A0A6N8TM70-F1-model_v4 YciI family protein 0.9202 3 113
AF-A0A4Q3H0G5-F1-model_v4 YciI family protein 0.9189 3 113
AF-A0A3C0LY25-F1-model_v4 deleted 0.9181 3 98
AF-A0A0S3PS66-F1-model_v4 YCII-related domain protein 0.9161 2 113

Map