F472663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 425 | 532 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100420255|Ga0070674_1004202552 |
| Length | 263 |
| Sequence | MSLKLFELVGTDASRPFSPFCWRTRMALAHKGLSAETIPWCFTDKPAIAPHGSEKVPVLLDDDTAVVDSWTIANHLEDRYPDRPSLFGGEGGRAVGRMLNWWGDGLIGGMFPLIIADIPLNLKPDDAAYFRRTREARFKRPLEEVMADRDKAVEGFRKSLDPLRLTLKTQAFLGGAAPNYADDIVFGAFQWARVVSPFKLLAEDDPVYAWRERLLDAFDGLARKVAELPRLTSAAPRCGRNGDIGGCNDRQRLRGHAPSRSFN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 13 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 14 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 15 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 16 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 17 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 18 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 19 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 20 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 21 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 22 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 23 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 24 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 25 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 26 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 27 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 28 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 29 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 30 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 31 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 32 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 33 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 34 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 35 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 36 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 37 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 38 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 39 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 40 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 41 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 42 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 43 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 44 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 45 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 46 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 47 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 48 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 49 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 50 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 51 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 52 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 53 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 54 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 55 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 56 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 57 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 58 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 59 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 60 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 61 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 62 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 63 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 64 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 65 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 66 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 67 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 68 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 69 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 70 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 71 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 72 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 73 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 74 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 75 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 76 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 77 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 78 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 79 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 80 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 81 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 82 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 83 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 84 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 85 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 86 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 87 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 88 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 89 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 90 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 91 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 92 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 93 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 94 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 95 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 97 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 102 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 127 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 128 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 131 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 132 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 133 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 134 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 135 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 137 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 138 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 139 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 140 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 141 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 143 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 144 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 145 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 146 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 147 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 148 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 149 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 150 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 151 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 152 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 154 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 155 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 156 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 157 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 167 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 178 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 179 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 180 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 181 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 182 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 256 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 257 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 258 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 259 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 263 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 334 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 369 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 370 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 375 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 376 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 379 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 380 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 382 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 383 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 384 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 385 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 387 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 388 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 389 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 390 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 393 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 398 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 399 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 400 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 401 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 402 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 403 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 404 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 405 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 406 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 407 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 408 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 409 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 410 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 411 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 412 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 413 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 414 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 415 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 416 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 417 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 418 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 419 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 420 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 421 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 422 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 423 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 424 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 425 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.72 |
| Metatranscriptomes | 0 |
| Isolates | 18.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.12 |
| Nodule | 14.42 |
| Rhizoplane | 7.52 |
| Rhizosphere | 54.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10038959 | 3300003215 | Bacteria | 1491 |
| 2 | JGI25404J52841_10001888 | 3300003659 | Unclassified | 3831 |
| 3 | Ga0065712_10244589 | 3300005290 | Bacteria | 932 |
| 4 | Ga0070676_10114933 | 3300005328 | Bacteria | 1681 |
| 5 | Ga0070683_100083841 | 3300005329 | Bacteria | 2986 |
| 6 | Ga0070690_100474184 | 3300005330 | Bacteria | 932 |
| 7 | Ga0070666_10421842 | 3300005335 | Bacteria | 961 |
| 8 | Ga0068868_100042710 | 3300005338 | Bacteria | 3539 |
| 9 | Ga0068868_100060031 | 3300005338 | Bacteria | 3009 |
| 10 | Ga0068868_100656136 | 3300005338 | Bacteria | 935 |
| 11 | Ga0070661_100067210 | 3300005344 | Bacteria | 2634 |
| 12 | Ga0070668_100292083 | 3300005347 | Bacteria | 1365 |
| 13 | Ga0070674_100420255 | 3300005356 | Bacteria | 1097 |
| 14 | Ga0070673_100532200 | 3300005364 | Bacteria | 1066 |
| 15 | Ga0070659_100656581 | 3300005366 | Bacteria | 904 |
| 16 | Ga0070709_10003877 | 3300005434 | Bacteria | 8059 |
| 17 | Ga0070714_100002400 | 3300005435 | Bacteria | 13793 |
| 18 | Ga0070714_100026447 | 3300005435 | Bacteria | 4796 |
| 19 | Ga0070714_100212405 | 3300005435 | Bacteria | 1774 |
| 20 | Ga0070714_100413579 | 3300005435 | Bacteria | 1277 |
| 21 | Ga0070713_100013610 | 3300005436 | Bacteria | 6015 |
| 22 | Ga0070713_100066523 | 3300005436 | Bacteria | 3031 |
| 23 | Ga0070713_100409671 | 3300005436 | Bacteria | 1267 |
| 24 | Ga0070710_10011512 | 3300005437 | Bacteria | 4371 |
| 25 | Ga0070710_10051623 | 3300005437 | Bacteria | 2309 |
| 26 | Ga0070711_100032102 | 3300005439 | Bacteria | 3489 |
| 27 | Ga0070711_100139720 | 3300005439 | Bacteria | 1814 |
| 28 | Ga0070711_100153290 | 3300005439 | Bacteria | 1740 |
| 29 | Ga0070700_100155547 | 3300005441 | Bacteria | 1568 |
| 30 | Ga0070663_100049222 | 3300005455 | Bacteria | 2991 |
| 31 | Ga0070663_100091376 | 3300005455 | Bacteria | 2255 |
| 32 | Ga0070663_100193042 | 3300005455 | Bacteria | 1586 |
| 33 | Ga0070663_100483433 | 3300005455 | Bacteria | 1025 |
| 34 | Ga0070678_100044155 | 3300005456 | Bacteria | 3181 |
| 35 | Ga0070678_100172718 | 3300005456 | Bacteria | 1762 |
| 36 | Ga0070662_100047414 | 3300005457 | Bacteria | 3091 |
| 37 | Ga0070698_100026383 | 3300005471 | Bacteria | 6047 |
| 38 | Ga0070699_100128562 | 3300005518 | Bacteria | 2232 |
| 39 | Ga0070679_100523308 | 3300005530 | Bacteria | 1130 |
| 40 | Ga0070697_100347379 | 3300005536 | Bacteria | 1281 |
| 41 | Ga0070665_100008468 | 3300005548 | Bacteria | 10406 |
| 42 | Ga0070665_100015135 | 3300005548 | Bacteria | 7743 |
| 43 | Ga0070665_100042136 | 3300005548 | Bacteria | 4589 |
| 44 | Ga0070665_100108212 | 3300005548 | Bacteria | 2782 |
| 45 | Ga0070665_100213535 | 3300005548 | Bacteria | 1930 |
| 46 | Ga0070664_100675758 | 3300005564 | Bacteria | 961 |
| 47 | Ga0068854_100284844 | 3300005578 | Bacteria | 1332 |
| 48 | Ga0068856_100025081 | 3300005614 | Bacteria | 5810 |
| 49 | Ga0068856_100261325 | 3300005614 | Bacteria | 1747 |
| 50 | Ga0068856_100693134 | 3300005614 | Bacteria | 1039 |
| 51 | Ga0070702_100275393 | 3300005615 | Bacteria | 1153 |
| 52 | Ga0068859_100061016 | 3300005617 | Bacteria | 3799 |
| 53 | Ga0068864_100075214 | 3300005618 | Bacteria | 2948 |
| 54 | Ga0068864_100273776 | 3300005618 | Bacteria | 1574 |
| 55 | Ga0068866_10141008 | 3300005718 | Bacteria | 1383 |
| 56 | Ga0068861_100054256 | 3300005719 | Bacteria | 3053 |
| 57 | Ga0068861_100343230 | 3300005719 | Bacteria | 1307 |
| 58 | Ga0068863_100110330 | 3300005841 | Bacteria | 2620 |
| 59 | Ga0068858_100411470 | 3300005842 | Bacteria | 1300 |
| 60 | Ga0068860_100053416 | 3300005843 | Bacteria | 3841 |
| 61 | Ga0068860_100100200 | 3300005843 | Bacteria | 2763 |
| 62 | Ga0068862_100099944 | 3300005844 | Bacteria | 2536 |
| 63 | Ga0068862_100338703 | 3300005844 | Bacteria | 1392 |
| 64 | Ga0081455_10022998 | 3300005937 | Bacteria | 5811 |
| 65 | Ga0081540_1001462 | 3300005983 | Bacteria | 20401 |
| 66 | Ga0081540_1003095 | 3300005983 | Bacteria | 13322 |
| 67 | Ga0081540_1004104 | 3300005983 | Bacteria | 11240 |
| 68 | Ga0081540_1004610 | 3300005983 | Bacteria | 10431 |
| 69 | Ga0081540_1027653 | 3300005983 | Bacteria | 3207 |
| 70 | Ga0070717_10006671 | 3300006028 | Bacteria | 8512 |
| 71 | Ga0070717_10037568 | 3300006028 | Bacteria | 3933 |
| 72 | Ga0075365_10236458 | 3300006038 | Bacteria | 1283 |
| 73 | Ga0075363_100000680 | 3300006048 | Bacteria | 11427 |
| 74 | Ga0075363_100095017 | 3300006048 | Bacteria | 1644 |
| 75 | Ga0075363_100115001 | 3300006048 | Bacteria | 1498 |
| 76 | Ga0075364_10010772 | 3300006051 | Bacteria | 5531 |
| 77 | Ga0075364_10123240 | 3300006051 | Bacteria | 1736 |
| 78 | Ga0070715_10019909 | 3300006163 | Bacteria | 2580 |
| 79 | Ga0070716_100127202 | 3300006173 | Bacteria | 1605 |
| 80 | Ga0070712_100002146 | 3300006175 | Bacteria | 12130 |
| 81 | Ga0070712_100017104 | 3300006175 | Bacteria | 4689 |
| 82 | Ga0070712_100069089 | 3300006175 | Bacteria | 2519 |
| 83 | Ga0075362_10185222 | 3300006177 | Bacteria | 1010 |
| 84 | Ga0075367_10095026 | 3300006178 | Bacteria | 1818 |
| 85 | Ga0075367_10205996 | 3300006178 | Bacteria | 1229 |
| 86 | Ga0075369_10005761 | 3300006186 | Bacteria | 4652 |
| 87 | Ga0075366_10131820 | 3300006195 | Bacteria | 1508 |
| 88 | Ga0075370_10007368 | 3300006353 | Bacteria | 5602 |
| 89 | Ga0075370_10018197 | 3300006353 | Bacteria | 3808 |
| 90 | Ga0068871_100081794 | 3300006358 | Bacteria | 2677 |
| 91 | Ga0075433_10845213 | 3300006852 | Bacteria | 799 |
| 92 | Ga0075434_100379761 | 3300006871 | Bacteria | 1434 |
| 93 | Ga0068865_100048318 | 3300006881 | Bacteria | 2928 |
| 94 | Ga0075436_100052807 | 3300006914 | Bacteria | 2805 |
| 95 | Ga0075436_100108224 | 3300006914 | Bacteria | 1939 |
| 96 | Ga0097620_100061013 | 3300006931 | Bacteria | 3799 |
| 97 | Ga0099823_1004804 | 3300006944 | Bacteria | 13310 |
| 98 | Ga0075435_100316466 | 3300007076 | Bacteria | 1336 |
| 99 | Ga0099794_10118282 | 3300007265 | Bacteria | 1332 |
| 100 | Ga0099795_10005305 | 3300007788 | Bacteria | 3413 |
| 101 | Ga0099795_10028541 | 3300007788 | Bacteria | 1898 |
| 102 | Ga0099795_10028831 | 3300007788 | Bacteria | 1892 |
| 103 | Ga0105240_10080848 | 3300009093 | Bacteria | 3995 |
| 104 | Ga0105240_10355506 | 3300009093 | Bacteria | 1661 |
| 105 | Ga0111539_10281499 | 3300009094 | Bacteria | 1935 |
| 106 | Ga0105247_10038309 | 3300009101 | Bacteria | 2926 |
| 107 | Ga0105247_10519229 | 3300009101 | Bacteria | 871 |
| 108 | Ga0105243_10075123 | 3300009148 | Bacteria | 2742 |
| 109 | Ga0105241_10047563 | 3300009174 | Bacteria | 3262 |
| 110 | Ga0105241_10068508 | 3300009174 | Bacteria | 2750 |
| 111 | Ga0105242_10089639 | 3300009176 | Bacteria | 2586 |
| 112 | Ga0105242_10158533 | 3300009176 | Bacteria | 1979 |
| 113 | Ga0105248_10069294 | 3300009177 | Bacteria | 3960 |
| 114 | Ga0105237_10616336 | 3300009545 | Bacteria | 1092 |
| 115 | Ga0105249_10030441 | 3300009553 | Bacteria | 4879 |
| 116 | Ga0105249_10363467 | 3300009553 | Bacteria | 1469 |
| 117 | Ga0099796_10006541 | 3300010159 | Bacteria | 2990 |
| 118 | Ga0099796_10010931 | 3300010159 | Bacteria | 2514 |
| 119 | Ga0099796_10021110 | 3300010159 | Bacteria | 2001 |
| 120 | Ga0099796_10093418 | 3300010159 | Bacteria | 1121 |
| 121 | Ga0105239_10059371 | 3300010375 | Bacteria | 4197 |
| 122 | Ga0105239_10067144 | 3300010375 | Bacteria | 3939 |
| 123 | Ga0105239_10086663 | 3300010375 | Bacteria | 3452 |
| 124 | Ga0105239_10144870 | 3300010375 | Bacteria | 2649 |
| 125 | Ga0105239_10694130 | 3300010375 | Bacteria | 1164 |
| 126 | Ga0105239_10901000 | 3300010375 | Bacteria | 1015 |
| 127 | Ga0105246_10009096 | 3300011119 | Bacteria | 6117 |
| 128 | Ga0105246_10066091 | 3300011119 | Bacteria | 2531 |
| 129 | Ga0157374_10015314 | 3300013296 | Bacteria | 6725 |
| 130 | Ga0157374_10229435 | 3300013296 | Bacteria | 1823 |
| 131 | Ga0163162_10025914 | 3300013306 | Bacteria | 5795 |
| 132 | Ga0157375_10057754 | 3300013308 | Bacteria | 3836 |
| 133 | Ga0157375_10153627 | 3300013308 | Bacteria | 2439 |
| 134 | Ga0163163_10070756 | 3300014325 | Bacteria | 3475 |
| 135 | Ga0163163_10099788 | 3300014325 | Bacteria | 2925 |
| 136 | Ga0163163_10991486 | 3300014325 | Bacteria | 903 |
| 137 | Ga0157380_10042815 | 3300014326 | Bacteria | 3541 |
| 138 | Ga0157380_10082126 | 3300014326 | Unclassified | 2637 |
| 139 | Ga0182008_10075648 | 3300014497 | Bacteria | 1656 |
| 140 | Ga0157379_10160337 | 3300014968 | Bacteria | 2030 |
| 141 | Ga0157376_10005988 | 3300014969 | Bacteria | 8545 |
| 142 | Ga0157376_10107194 | 3300014969 | Bacteria | 2452 |
| 143 | Ga0157376_10339132 | 3300014969 | Bacteria | 1435 |
| 144 | Ga0213873_10074724 | 3300021358 | Bacteria | 939 |
| 145 | Ga0213872_10113163 | 3300021361 | Bacteria | 1204 |
| 146 | Ga0213874_10062906 | 3300021377 | Bacteria | 1167 |
| 147 | Ga0213875_10000011 | 3300021388 | Bacteria | 332447 |
| 148 | Ga0213875_10000480 | 3300021388 | Bacteria | 34004 |
| 149 | Ga0213875_10002319 | 3300021388 | Bacteria | 11514 |
| 150 | Ga0213871_10014576 | 3300021441 | Bacteria | 1867 |
| 151 | Ga0209677_100991 | 3300025253 | Bacteria | 13698 |
| 152 | Ga0209677_102002 | 3300025253 | Bacteria | 8106 |
| 153 | Ga0209233_1003959 | 3300025261 | Bacteria | 5131 |
| 154 | Ga0209564_1000397 | 3300025295 | Bacteria | 77778 |
| 155 | Ga0207697_10058291 | 3300025315 | Bacteria | 1604 |
| 156 | Ga0207697_10089141 | 3300025315 | Bacteria | 1306 |
| 157 | Ga0207692_10012176 | 3300025898 | Bacteria | 3687 |
| 158 | Ga0207692_10126262 | 3300025898 | Bacteria | 1439 |
| 159 | Ga0207642_10078429 | 3300025899 | Bacteria | 1596 |
| 160 | Ga0207642_10253003 | 3300025899 | Bacteria | 1001 |
| 161 | Ga0207710_10093872 | 3300025900 | Bacteria | 1408 |
| 162 | Ga0207688_10227034 | 3300025901 | Bacteria | 1126 |
| 163 | Ga0207699_10037669 | 3300025906 | Unclassified | 2766 |
| 164 | Ga0207699_10067760 | 3300025906 | Bacteria | 2171 |
| 165 | Ga0207645_10037451 | 3300025907 | Bacteria | 3112 |
| 166 | Ga0207705_10033478 | 3300025909 | Bacteria | 3671 |
| 167 | Ga0207707_10245404 | 3300025912 | Bacteria | 1556 |
| 168 | Ga0207707_10543706 | 3300025912 | Bacteria | 987 |
| 169 | Ga0207693_10002609 | 3300025915 | Bacteria | 15668 |
| 170 | Ga0207693_10028370 | 3300025915 | Bacteria | 4422 |
| 171 | Ga0207693_10085965 | 3300025915 | Bacteria | 2464 |
| 172 | Ga0207693_10481881 | 3300025915 | Bacteria | 969 |
| 173 | Ga0207663_10005220 | 3300025916 | Bacteria | 6536 |
| 174 | Ga0207649_10204128 | 3300025920 | Bacteria | 1398 |
| 175 | Ga0207652_10361797 | 3300025921 | Bacteria | 1310 |
| 176 | Ga0207646_10077708 | 3300025922 | Bacteria | 2966 |
| 177 | Ga0207694_10040558 | 3300025924 | Bacteria | 3585 |
| 178 | Ga0207659_10194451 | 3300025926 | Bacteria | 1616 |
| 179 | Ga0207659_10671919 | 3300025926 | Bacteria | 886 |
| 180 | Ga0207687_10012936 | 3300025927 | Bacteria | 5454 |
| 181 | Ga0207700_10019561 | 3300025928 | Bacteria | 4575 |
| 182 | Ga0207700_10206584 | 3300025928 | Unclassified | 1658 |
| 183 | Ga0207700_10215507 | 3300025928 | Unclassified | 1625 |
| 184 | Ga0207664_10025742 | 3300025929 | Bacteria | 4437 |
| 185 | Ga0207664_10038577 | 3300025929 | Bacteria | 3705 |
| 186 | Ga0207664_10106974 | 3300025929 | Bacteria | 2320 |
| 187 | Ga0207664_10110197 | 3300025929 | Bacteria | 2289 |
| 188 | Ga0207664_10346465 | 3300025929 | Unclassified | 1314 |
| 189 | Ga0207664_10453600 | 3300025929 | Bacteria | 1145 |
| 190 | Ga0207644_10252591 | 3300025931 | Bacteria | 1407 |
| 191 | Ga0207690_10553710 | 3300025932 | Bacteria | 935 |
| 192 | Ga0207706_10026773 | 3300025933 | Bacteria | 5161 |
| 193 | Ga0207686_10221627 | 3300025934 | Bacteria | 1366 |
| 194 | Ga0207709_10135121 | 3300025935 | Bacteria | 1687 |
| 195 | Ga0207670_10142712 | 3300025936 | Bacteria | 1767 |
| 196 | Ga0207669_10009924 | 3300025937 | Bacteria | 4559 |
| 197 | Ga0207704_10100374 | 3300025938 | Bacteria | 1928 |
| 198 | Ga0207665_10023995 | 3300025939 | Bacteria | 4019 |
| 199 | Ga0207665_10055525 | 3300025939 | Bacteria | 2672 |
| 200 | Ga0207665_10094022 | 3300025939 | Bacteria | 2082 |
| 201 | Ga0207665_10184925 | 3300025939 | Bacteria | 1511 |
| 202 | Ga0207691_10091519 | 3300025940 | Bacteria | 2725 |
| 203 | Ga0207711_10099749 | 3300025941 | Bacteria | 2568 |
| 204 | Ga0207689_10056672 | 3300025942 | Bacteria | 3225 |
| 205 | Ga0207689_10480185 | 3300025942 | Bacteria | 1040 |
| 206 | Ga0207661_10052779 | 3300025944 | Bacteria | 3250 |
| 207 | Ga0207679_10102978 | 3300025945 | Bacteria | 2236 |
| 208 | Ga0207651_10598823 | 3300025960 | Bacteria | 963 |
| 209 | Ga0207712_10161695 | 3300025961 | Bacteria | 1741 |
| 210 | Ga0207712_10285906 | 3300025961 | Bacteria | 1348 |
| 211 | Ga0207668_10131577 | 3300025972 | Bacteria | 1911 |
| 212 | Ga0207677_10062898 | 3300026023 | Bacteria | 2577 |
| 213 | Ga0207703_10451093 | 3300026035 | Bacteria | 1201 |
| 214 | Ga0207678_10004916 | 3300026067 | Bacteria | 12003 |
| 215 | Ga0207678_10015307 | 3300026067 | Bacteria | 6746 |
| 216 | Ga0207678_10025216 | 3300026067 | Bacteria | 5190 |
| 217 | Ga0207678_10095014 | 3300026067 | Bacteria | 2547 |
| 218 | Ga0207678_10265681 | 3300026067 | Bacteria | 1471 |
| 219 | Ga0207708_10255226 | 3300026075 | Bacteria | 1414 |
| 220 | Ga0207708_10290064 | 3300026075 | Bacteria | 1328 |
| 221 | Ga0207702_10071413 | 3300026078 | Bacteria | 2989 |
| 222 | Ga0207702_10615743 | 3300026078 | Bacteria | 1066 |
| 223 | Ga0207641_10313628 | 3300026088 | Bacteria | 1485 |
| 224 | Ga0207648_10051602 | 3300026089 | Bacteria | 3595 |
| 225 | Ga0207648_10431007 | 3300026089 | Bacteria | 1198 |
| 226 | Ga0207676_10008501 | 3300026095 | Bacteria | 7300 |
| 227 | Ga0207676_10063964 | 3300026095 | Bacteria | 2923 |
| 228 | Ga0207674_10196401 | 3300026116 | Bacteria | 1967 |
| 229 | Ga0207675_100068830 | 3300026118 | Bacteria | 3308 |
| 230 | Ga0207683_10008816 | 3300026121 | Bacteria | 8607 |
| 231 | Ga0207683_10051830 | 3300026121 | Bacteria | 3595 |
| 232 | Ga0207683_10699674 | 3300026121 | Bacteria | 939 |
| 233 | Ga0207428_10260382 | 3300027907 | Bacteria | 1292 |
| 234 | Ga0268266_10006857 | 3300028379 | Bacteria | 10370 |
| 235 | Ga0268266_10024242 | 3300028379 | Bacteria | 5163 |
| 236 | Ga0268266_10601225 | 3300028379 | Bacteria | 1056 |
| 237 | Ga0268265_10111732 | 3300028380 | Bacteria | 2232 |
| 238 | Ga0268264_10045022 | 3300028381 | Bacteria | 3663 |
| 239 | Ga0268264_10686124 | 3300028381 | Bacteria | 1016 |
| 240 | Ga0268264_10716668 | 3300028381 | Bacteria | 994 |
| 241 | Ga0265334_10025685 | 3300028573 | Bacteria | 2383 |
| 242 | Ga0265328_10048818 | 3300031239 | Bacteria | 1555 |
| 243 | Ga0316575_10089195 | 3300031665 | Bacteria | 1248 |
| 244 | Ga0307409_100119359 | 3300031995 | Bacteria | 2229 |
| 245 | Ga0307409_100269743 | 3300031995 | Bacteria | 1566 |
| 246 | Ga0307415_100021174 | 3300032126 | Bacteria | 3990 |
| 247 | Ga0307415_100247425 | 3300032126 | Bacteria | 1446 |
| 248 | Ga0307415_100711575 | 3300032126 | Bacteria | 907 |
| 249 | Ga0373930_0010637 | 3300034816 | Unclassified | 1649 |
| 250 | Ga0373938_0051523 | 3300034957 | Bacteria | 941 |
| 251 | Ga0373934_0036382 | 3300035086 | Unclassified | 1939 |
| 252 | Ga0373941_0141572 | 3300035115 | Unclassified | 875 |
| 253 | Ga0373945_0135081 | 3300035116 | Bacteria | 991 |
| 254 | Ga0373956_0055684 | 3300035119 | Bacteria | 1784 |
| 255 | Ga0373956_0129969 | 3300035119 | Bacteria | 1179 |
| 256 | Ga0373960_0031327 | 3300035121 | Unclassified | 1487 |
| 257 | Ga0373943_0129611 | 3300035170 | Bacteria | 1349 |
| 258 | Ga0373931_0019943 | 3300035691 | Bacteria | 3350 |
| 259 | Ga0373931_0198817 | 3300035691 | Unclassified | 1196 |
| 260 | Ga0373935_0391751 | 3300035692 | Bacteria | 996 |
| 261 | Ga0373927_0026463 | 3300035695 | Bacteria | 3791 |
| 262 | Ga0373933_0308472 | 3300035724 | Bacteria | 1025 |
| 263 | Ga0373937_0048835 | 3300036401 | Bacteria | 3874 |
| 264 | Ga0373937_0079077 | 3300036401 | Bacteria | 3039 |
| 265 | Ga0373937_0557001 | 3300036401 | Bacteria | 1089 |
| 266 | Ga0373937_0558471 | 3300036401 | Bacteria | 1087 |
| 267 | Ga0373925_0176925 | 3300037068 | Bacteria | 1687 |
| 268 | Ga0395899_0179696 | 3300037312 | Bacteria | 1486 |
| 269 | Ga0395900_0124721 | 3300037418 | Bacteria | 2641 |
| 270 | Ga0395900_0193035 | 3300037418 | Bacteria | 2065 |
| 271 | Ga0395898_0094516 | 3300037466 | Bacteria | 2873 |
| 272 | Ga0395905_0032137 | 3300037471 | Bacteria | 4937 |
| 273 | Ga0395905_0317645 | 3300037471 | Bacteria | 1447 |
| 274 | Ga0436364_0010042 | 3300037853 | Bacteria | 102214 |
| 275 | Ga0436364_0151134 | 3300037853 | Bacteria | 972 |
| 276 | Ga0436364_0232280 | 3300037853 | Bacteria | 88632 |
| 277 | Ga0436364_0616684 | 3300037853 | Bacteria | 34041 |
| 278 | Ga0436364_0887813 | 3300037853 | Bacteria | 1998 |
| 279 | Ga0436364_0960005 | 3300037853 | Bacteria | 2630 |
| 280 | Ga0436364_1224135 | 3300037853 | Bacteria | 88093 |
| 281 | Ga0395901_0015566 | 3300038443 | Bacteria | 7747 |
| 282 | Ga0395901_0382188 | 3300038443 | Bacteria | 1449 |
| 283 | Ga0436365_1051823 | 3300039437 | Bacteria | 3339 |
| 284 | Ga0436365_1917762 | 3300039437 | Bacteria | 904 |
| 285 | Ga0436360_0135729 | 3300039438 | Bacteria | 1339 |
| 286 | Ga0436360_0285178 | 3300039438 | Bacteria | 1429 |
| 287 | Ga0436360_0372949 | 3300039438 | Bacteria | 1326 |
| 288 | Ga0436360_0381517 | 3300039438 | Bacteria | 1372 |
| 289 | Ga0436360_1299321 | 3300039438 | Unclassified | 924 |
| 290 | Ga0436361_0240505 | 3300039447 | Bacteria | 1370 |
| 291 | Ga0436363_0956567 | 3300039450 | Bacteria | 2265 |
| 292 | Ga0436363_1095549 | 3300039450 | Bacteria | 4623 |
| 293 | Ga0436363_1389662 | 3300039450 | Bacteria | 2702 |
| 294 | Ga0436362_0351741 | 3300039453 | Bacteria | 3061 |
| 295 | Ga0436362_0533801 | 3300039453 | Bacteria | 3927 |
| 296 | Ga0436362_0621117 | 3300039453 | Bacteria | 2053 |
| 297 | Ga0436362_0825752 | 3300039453 | Bacteria | 866 |
| 298 | Ga0436362_1206919 | 3300039453 | Bacteria | 1105 |
| 299 | Ga0451791_0231185 | 3300041451 | Bacteria | 901 |
| 300 | Ga0466970_0145823 | 3300044765 | Bacteria | 1306 |
| 301 | Ga0466960_0033755 | 3300044901 | Bacteria | 2380 |
| 302 | Ga0495592_0323100 | 3300046454 | Bacteria | 997 |
| 303 | Ga0495603_0011792 | 3300046455 | Bacteria | 5291 |
| 304 | Ga0495603_0053912 | 3300046455 | Bacteria | 2385 |
| 305 | Ga0495638_0047605 | 3300046460 | Bacteria | 2687 |
| 306 | Ga0495638_0120423 | 3300046460 | Bacteria | 1551 |
| 307 | Ga0495651_0067205 | 3300046462 | Bacteria | 2735 |
| 308 | Ga0495650_0082850 | 3300046471 | Bacteria | 1234 |
| 309 | Ga0495580_0396492 | 3300046472 | Bacteria | 931 |
| 310 | Ga0495605_0140721 | 3300046474 | Bacteria | 1083 |
| 311 | Ga0495605_0152741 | 3300046474 | Bacteria | 1029 |
| 312 | Ga0495664_0105598 | 3300046477 | Bacteria | 1698 |
| 313 | Ga0495584_0141793 | 3300046491 | Bacteria | 1220 |
| 314 | Ga0495585_0055858 | 3300046492 | Bacteria | 2181 |
| 315 | Ga0495596_0039854 | 3300046500 | Bacteria | 1855 |
| 316 | Ga0495607_0000007 | 3300046501 | Bacteria | 272517 |
| 317 | Ga0495583_0069063 | 3300046506 | Bacteria | 1557 |
| 318 | Ga0495610_0018929 | 3300046512 | Bacteria | 3870 |
| 319 | Ga0495616_0047660 | 3300046513 | Bacteria | 2157 |
| 320 | Ga0495616_0053634 | 3300046513 | Bacteria | 2003 |
| 321 | Ga0495620_0024529 | 3300046515 | Bacteria | 2867 |
| 322 | Ga0495620_0065975 | 3300046515 | Bacteria | 1492 |
| 323 | Ga0495631_0011197 | 3300046518 | Bacteria | 4418 |
| 324 | Ga0495631_0060301 | 3300046518 | Bacteria | 1646 |
| 325 | Ga0495632_0032104 | 3300046519 | Bacteria | 2708 |
| 326 | Ga0495632_0167237 | 3300046519 | Bacteria | 1011 |
| 327 | Ga0495644_0011772 | 3300046523 | Bacteria | 3367 |
| 328 | Ga0495644_0016014 | 3300046523 | Bacteria | 2873 |
| 329 | Ga0495648_0070221 | 3300046524 | Bacteria | 2036 |
| 330 | Ga0495648_0087547 | 3300046524 | Bacteria | 1753 |
| 331 | Ga0495648_0201016 | 3300046524 | Bacteria | 997 |
| 332 | Ga0495663_0050265 | 3300046525 | Bacteria | 1289 |
| 333 | Ga0495663_0100623 | 3300046525 | Bacteria | 951 |
| 334 | Ga0495642_0024956 | 3300046528 | Bacteria | 2367 |
| 335 | Ga0495609_0082791 | 3300046538 | Bacteria | 1401 |
| 336 | Ga0495622_0073983 | 3300046557 | Bacteria | 1571 |
| 337 | Ga0495668_0018733 | 3300046616 | Bacteria | 4001 |
| 338 | Ga0495668_0059067 | 3300046616 | Bacteria | 2116 |
| 339 | Ga0495668_0085120 | 3300046616 | Bacteria | 1734 |
| 340 | Ga0495668_0232173 | 3300046616 | Bacteria | 1010 |
| 341 | Ga0495611_0022187 | 3300046648 | Bacteria | 2746 |
| 342 | Ga0495611_0139750 | 3300046648 | Bacteria | 1131 |
| 343 | Ga0495635_0389154 | 3300046663 | Bacteria | 927 |
| 344 | Ga0495659_0023543 | 3300046664 | Bacteria | 2093 |
| 345 | Ga0495659_0048013 | 3300046664 | Bacteria | 1545 |
| 346 | Ga0495657_0174775 | 3300046675 | Bacteria | 1321 |
| 347 | Ga0495647_0083878 | 3300046681 | Bacteria | 1296 |
| 348 | Ga0495669_0002970 | 3300046684 | Bacteria | 6968 |
| 349 | Ga0495669_0039616 | 3300046684 | Bacteria | 2086 |
| 350 | Ga0495669_0121906 | 3300046684 | Bacteria | 1222 |
| 351 | Ga0495670_0038253 | 3300046691 | Bacteria | 2392 |
| 352 | Ga0495670_0119499 | 3300046691 | Bacteria | 1368 |
| 353 | Ga0495671_0049040 | 3300046692 | Bacteria | 2105 |
| 354 | Ga0495649_0087417 | 3300046694 | Bacteria | 1663 |
| 355 | Ga0495589_0060910 | 3300046794 | Bacteria | 1853 |
| 356 | Ga0495600_0061389 | 3300046809 | Bacteria | 2455 |
| 357 | Ga0495581_0184414 | 3300047315 | Bacteria | 1221 |
| 358 | Ga0495581_0203681 | 3300047315 | Bacteria | 1157 |
| 359 | Ga0495604_0409508 | 3300047317 | Bacteria | 892 |
| 360 | Ga0495636_0029940 | 3300047318 | Bacteria | 2224 |
| 361 | Ga0495675_0451184 | 3300047444 | Bacteria | 744 |
| 362 | Ga0495677_0025799 | 3300047445 | Bacteria | 2132 |
| 363 | Ga0495685_073006 | 3300047447 | Bacteria | 1148 |
| 364 | Ga0495673_0055712 | 3300047469 | Bacteria | 1714 |
| 365 | Ga0495681_0146919 | 3300047470 | Bacteria | 992 |
| 366 | Ga0495686_0077183 | 3300047472 | Bacteria | 2040 |
| 367 | Ga0495626_0086188 | 3300048091 | Bacteria | 1388 |
| 368 | Ga0496100_0046421 | 3300048903 | Bacteria | 2793 |
| 369 | Ga0496100_0254310 | 3300048903 | Bacteria | 1300 |
| 370 | Ga0496100_0913838 | 3300048903 | Bacteria | 689 |
| 371 | Ga0496102_0002173 | 3300048905 | Bacteria | 16844 |
| 372 | Ga0496102_0070854 | 3300048905 | Bacteria | 3201 |
| 373 | Ga0496102_0086365 | 3300048905 | Bacteria | 2897 |
| 374 | Ga0496102_0142725 | 3300048905 | Bacteria | 2246 |
| 375 | Ga0496103_0038357 | 3300048906 | Bacteria | 2939 |
| 376 | Ga0496103_0182523 | 3300048906 | Bacteria | 1349 |
| 377 | Ga0496103_0291695 | 3300048906 | Bacteria | 1049 |
| 378 | Ga0496104_0031262 | 3300048907 | Bacteria | 4950 |
| 379 | Ga0496104_0292055 | 3300048907 | Bacteria | 1543 |
| 380 | Ga0496104_0599746 | 3300048907 | Bacteria | 1011 |
| 381 | Ga0496105_0007814 | 3300048908 | Bacteria | 8300 |
| 382 | Ga0496105_0107803 | 3300048908 | Bacteria | 2300 |
| 383 | Ga0496105_0170813 | 3300048908 | Bacteria | 1782 |
| 384 | Ga0496106_0003947 | 3300048909 | Bacteria | 11081 |
| 385 | Ga0496106_0050798 | 3300048909 | Bacteria | 3125 |
| 386 | Ga0496106_0096539 | 3300048909 | Bacteria | 2287 |
| 387 | Ga0496107_0002755 | 3300048910 | Bacteria | 11565 |
| 388 | Ga0496107_0023427 | 3300048910 | Bacteria | 4365 |
| 389 | Ga0496108_0044462 | 3300048911 | Bacteria | 3707 |
| 390 | Ga0496108_0060454 | 3300048911 | Bacteria | 3188 |
| 391 | Ga0496109_0030271 | 3300048912 | Bacteria | 4852 |
| 392 | Ga0496109_0050679 | 3300048912 | Bacteria | 3780 |
| 393 | Ga0496110_0028973 | 3300048913 | Bacteria | 4760 |
| 394 | Ga0496110_0035330 | 3300048913 | Bacteria | 4336 |
| 395 | Ga0496110_0360028 | 3300048913 | Bacteria | 1325 |
| 396 | Ga0496111_0247491 | 3300048914 | Bacteria | 1323 |
| 397 | Ga0496111_0315364 | 3300048914 | Bacteria | 1158 |
| 398 | Ga0496111_0410030 | 3300048914 | Bacteria | 1001 |
| 399 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 400 | Ga0496112_0009639 | 3300048915 | Bacteria | 8713 |
| 401 | Ga0496112_0018433 | 3300048915 | Bacteria | 6572 |
| 402 | Ga0496112_0103896 | 3300048915 | Bacteria | 2811 |
| 403 | Ga0496112_0484326 | 3300048915 | Unclassified | 1173 |
| 404 | Ga0496113_0030732 | 3300048916 | Bacteria | 3890 |
| 405 | Ga0496113_0085238 | 3300048916 | Bacteria | 2426 |
| 406 | Ga0496113_0435732 | 3300048916 | Bacteria | 1053 |
| 407 | Ga0496114_0013788 | 3300048917 | Bacteria | 6478 |
| 408 | Ga0496114_0031526 | 3300048917 | Bacteria | 4361 |
| 409 | Ga0496114_0060221 | 3300048917 | Bacteria | 3173 |
| 410 | Ga0496115_0041290 | 3300048918 | Bacteria | 3670 |
| 411 | Ga0496115_0144035 | 3300048918 | Bacteria | 1966 |
| 412 | Ga0496115_0157050 | 3300048918 | Bacteria | 1879 |
| 413 | Ga0496115_0511624 | 3300048918 | Bacteria | 964 |
| 414 | Ga0496115_0639337 | 3300048918 | Bacteria | 842 |
| 415 | Ga0496116_0002981 | 3300048919 | Bacteria | 17210 |
| 416 | Ga0496116_0178608 | 3300048919 | Bacteria | 1140 |
| 417 | Ga0496117_0031961 | 3300048920 | Bacteria | 4009 |
| 418 | Ga0496117_0056787 | 3300048920 | Bacteria | 2723 |
| 419 | Ga0496117_0078028 | 3300048920 | Bacteria | 2188 |
| 420 | Ga0496118_0017807 | 3300048921 | Bacteria | 6447 |
| 421 | Ga0496118_0019373 | 3300048921 | Bacteria | 6083 |
| 422 | Ga0496118_0262790 | 3300048921 | Bacteria | 973 |
| 423 | Ga0496119_0143571 | 3300048922 | Bacteria | 1286 |
| 424 | Ga0496120_0045674 | 3300048923 | Bacteria | 2536 |
| 425 | Ga0496120_0121961 | 3300048923 | Bacteria | 1346 |
| 426 | Ga0496121_0000927 | 3300048924 | Bacteria | 53016 |
| 427 | Ga0496121_0023355 | 3300048924 | Bacteria | 5959 |
| 428 | Ga0496121_0108275 | 3300048924 | Bacteria | 2126 |
| 429 | Ga0496121_0148404 | 3300048924 | Bacteria | 1729 |
| 430 | Ga0496121_0435364 | 3300048924 | Bacteria | 849 |
| 431 | Ga0496122_0021553 | 3300048925 | Bacteria | 5763 |
| 432 | Ga0496122_0174725 | 3300048925 | Bacteria | 1289 |
| 433 | Ga0496123_0072850 | 3300048926 | Bacteria | 2134 |
| 434 | Ga0496123_0084827 | 3300048926 | Bacteria | 1908 |
| 435 | Ga0496124_0038116 | 3300048927 | Bacteria | 4175 |
| 436 | Ga0496124_0331242 | 3300048927 | Bacteria | 1086 |
| 437 | Ga0496124_0451036 | 3300048927 | Bacteria | 877 |
| 438 | Ga0496124_0530107 | 3300048927 | Bacteria | 782 |
| 439 | Ga0496125_0003941 | 3300048928 | Bacteria | 17516 |
| 440 | Ga0496125_0056844 | 3300048928 | Bacteria | 3173 |
| 441 | Ga0496126_0006232 | 3300048929 | Bacteria | 13329 |
| 442 | Ga0496126_0018704 | 3300048929 | Bacteria | 6855 |
| 443 | Ga0496126_0041131 | 3300048929 | Bacteria | 4280 |
| 444 | Ga0496126_0109334 | 3300048929 | Bacteria | 2409 |
| 445 | Ga0496126_0202932 | 3300048929 | Bacteria | 1673 |
| 446 | Ga0496126_0208722 | 3300048929 | Bacteria | 1645 |
| 447 | Ga0496126_0300205 | 3300048929 | Bacteria | 1325 |
| 448 | Ga0496126_0447327 | 3300048929 | Bacteria | 1040 |
| 449 | Ga0501031_0127006 | 3300049568 | Bacteria | 1666 |
| 450 | Ga0501033_0245167 | 3300049570 | Bacteria | 1271 |
| 451 | Ga0501034_0132424 | 3300049571 | Bacteria | 2476 |
| 452 | Ga0501036_0047624 | 3300049572 | Bacteria | 3630 |
| 453 | Ga0501046_0353459 | 3300049580 | Bacteria | 1067 |
| 454 | Ga0501047_0029826 | 3300049581 | Bacteria | 5258 |
| 455 | Ga0501047_0032550 | 3300049581 | Bacteria | 5033 |
| 456 | Ga0501047_0613812 | 3300049581 | Bacteria | 908 |
| 457 | Ga0501067_0023237 | 3300049583 | Bacteria | 3435 |
| 458 | Ga0501070_0072317 | 3300049586 | Bacteria | 2855 |
| 459 | Ga0501070_0541128 | 3300049586 | Bacteria | 933 |
| 460 | Ga0501073_0053128 | 3300049589 | Bacteria | 2836 |
| 461 | Ga0501073_0172852 | 3300049589 | Bacteria | 1496 |
| 462 | Ga0501074_0048319 | 3300049590 | Bacteria | 3074 |
| 463 | Ga0501080_0049397 | 3300049742 | Bacteria | 3915 |
| 464 | Ga0501081_0673098 | 3300049743 | Unclassified | 776 |
| 465 | Ga0501035_0069240 | 3300049822 | Bacteria | 3128 |
| 466 | Ga0501035_0129494 | 3300049822 | Bacteria | 2201 |
| 467 | Ga0501045_0405999 | 3300049824 | Bacteria | 1014 |
| 468 | nmdc:mga03683_148439_c1 | 3300050489 | Bacteria | 1057 |
| 469 | nmdc:mga03n38_4940_c1 | 3300050490 | Bacteria | 4479 |
| 470 | nmdc:mga00v17_155965_c1 | 3300050491 | Bacteria | 1468 |
| 471 | nmdc:mga00v17_31785_c1 | 3300050491 | Bacteria | 3115 |
| 472 | nmdc:mga0yw44_154756_c1 | 3300050492 | Bacteria | 1497 |
| 473 | nmdc:mga0yw44_16705_c2 | 3300050492 | Bacteria | 3446 |
| 474 | nmdc:mga06z11_261468_c1 | 3300050494 | Bacteria | 1021 |
| 475 | nmdc:mga06z11_77115_c1 | 3300050494 | Bacteria | 1779 |
| 476 | nmdc:mga04h51_55315_c1 | 3300050495 | Bacteria | 1344 |
| 477 | nmdc:mga07m45_52567_c1 | 3300050496 | Bacteria | 2300 |
| 478 | nmdc:mga07m45_8072_c1 | 3300050496 | Bacteria | 5397 |
| 479 | nmdc:mga08y16_401907_c1 | 3300050511 | Bacteria | 1402 |
| 480 | nmdc:mga0n895_661570_c1 | 3300050512 | Bacteria | 1042 |
| 481 | nmdc:mga08x19_93074_c1 | 3300050514 | Bacteria | 1992 |
| 482 | nmdc:mga0sz30_8457_c1 | 3300050516 | Bacteria | 3887 |
| 483 | Ga0495612_0302859 | 3300053078 | Bacteria | 717 |
| 484 | Ga0500610_0238015 | 3300053079 | Bacteria | 849 |
| 485 | Ga0500635_0018733 | 3300053080 | Bacteria | 2094 |
| 486 | Ga0500635_0044873 | 3300053080 | Bacteria | 1493 |
| 487 | Ga0500635_0223493 | 3300053080 | Bacteria | 735 |
| 488 | Ga0500643_022154 | 3300053087 | Bacteria | 2050 |
| 489 | Ga0500644_0008756 | 3300053088 | Bacteria | 2680 |
| 490 | Ga0500644_0196369 | 3300053088 | Bacteria | 833 |
| 491 | Ga0500651_0015119 | 3300053093 | Bacteria | 4733 |
| 492 | Ga0500566_0015016 | 3300053094 | Bacteria | 4547 |
| 493 | Ga0500566_0016743 | 3300053094 | Bacteria | 4303 |
| 494 | Ga0500566_0212795 | 3300053094 | Bacteria | 967 |
| 495 | Ga0500641_0025966 | 3300053096 | Bacteria | 2270 |
| 496 | Ga0500641_0113174 | 3300053096 | Bacteria | 1168 |
| 497 | Ga0500641_0166303 | 3300053096 | Bacteria | 950 |
| 498 | Ga0500650_0004546 | 3300053098 | Bacteria | 5030 |
| 499 | Ga0500554_009268 | 3300053102 | Bacteria | 2351 |
| 500 | Ga0500554_009322 | 3300053102 | Bacteria | 2347 |
| 501 | Ga0500556_0000029 | 3300053104 | Bacteria | 165326 |
| 502 | Ga0500572_000876 | 3300053111 | Bacteria | 9349 |
| 503 | Ga0500582_132356 | 3300053114 | Bacteria | 868 |
| 504 | Ga0500592_000648 | 3300053116 | Bacteria | 5721 |
| 505 | Ga0500594_0005769 | 3300053118 | Bacteria | 2754 |
| 506 | Ga0500595_001029 | 3300053119 | Bacteria | 15582 |
| 507 | Ga0500595_003049 | 3300053119 | Bacteria | 7962 |
| 508 | Ga0500595_010338 | 3300053119 | Bacteria | 3714 |
| 509 | Ga0500607_025602 | 3300053121 | Bacteria | 3282 |
| 510 | Ga0500642_0000020 | 3300053130 | Bacteria | 159498 |
| 511 | Ga0500642_0051040 | 3300053130 | Bacteria | 1826 |
| 512 | Ga0500652_000227 | 3300053131 | Bacteria | 21480 |
| 513 | Ga0500658_0010926 | 3300053134 | Bacteria | 3349 |
| 514 | Ga0500559_0001175 | 3300053136 | Bacteria | 15697 |
| 515 | Ga0500559_0005368 | 3300053136 | Bacteria | 5900 |
| 516 | Ga0500568_0013591 | 3300053139 | Bacteria | 3707 |
| 517 | Ga0500586_001025 | 3300053145 | Bacteria | 5789 |
| 518 | Ga0500588_0027359 | 3300053146 | Bacteria | 1606 |
| 519 | Ga0500603_000764 | 3300053150 | Bacteria | 7737 |
| 520 | Ga0500616_0000112 | 3300053153 | Bacteria | 151210 |
| 521 | Ga0500622_0001493 | 3300053156 | Bacteria | 18609 |
| 522 | Ga0500634_0145645 | 3300053161 | Bacteria | 1114 |
| 523 | Ga0500639_151777 | 3300053163 | Bacteria | 1066 |
| 524 | Ga0500636_0001494 | 3300053177 | Bacteria | 12722 |
| 525 | Ga0500636_0267473 | 3300053177 | Bacteria | 861 |
| 526 | Ga0500637_0002741 | 3300053178 | Bacteria | 7903 |
| 527 | Ga0500637_0041163 | 3300053178 | Bacteria | 2612 |
| 528 | Ga0500637_0090699 | 3300053178 | Bacteria | 1770 |
| 529 | Ga0500637_0093240 | 3300053178 | Bacteria | 1745 |
| 530 | Ga0500567_171323 | 3300053723 | Bacteria | 775 |
| 531 | Ga0500570_105554 | 3300053724 | Bacteria | 1165 |
| 532 | Ga0500596_003575 | 3300053735 | Bacteria | 2933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10184925 | Ga0207665_101849252 | 204 |
| 2 | 3300047447 | Ga0495685_073006 | Ga0495685_073006_66_782 | 204 |
| 3 | 3300005435 | Ga0070714_100413579 | Ga0070714_1004135792 | 205 |
| 4 | 3300005436 | Ga0070713_100013610 | Ga0070713_1000136103 | 205 |
| 5 | 3300006175 | Ga0070712_100017104 | Ga0070712_1000171042 | 205 |
| 6 | 3300007788 | Ga0099795_10005305 | Ga0099795_100053054 | 205 |
| 7 | 3300010159 | Ga0099796_10006541 | Ga0099796_100065413 | 205 |
| 8 | 3300025928 | Ga0207700_10019561 | Ga0207700_100195612 | 205 |
| 9 | 3300005338 | Ga0068868_100042710 | Ga0068868_1000427104 | 206 |
| 10 | 3300005456 | Ga0070678_100172718 | Ga0070678_1001727182 | 206 |
| 11 | 3300036401 | Ga0373937_0557001 | Ga0373937_0557001_459_1079 | 206 |
| 12 | 3300037471 | Ga0395905_0317645 | Ga0395905_0317645_48_668 | 206 |
| 13 | 3300038443 | Ga0395901_0382188 | Ga0395901_0382188_782_1402 | 206 |
| 14 | 3300039438 | Ga0436360_0285178 | Ga0436360_0285178_773_1393 | 206 |
| 15 | 3300046455 | Ga0495603_0011792 | Ga0495603_0011792_43_663 | 206 |
| 16 | 3300046524 | Ga0495648_0087547 | Ga0495648_0087547_1100_1720 | 206 |
| 17 | 3300047315 | Ga0495581_0184414 | Ga0495581_0184414_563_1183 | 206 |
| 18 | 3300047317 | Ga0495604_0409508 | Ga0495604_0409508_231_851 | 206 |
| 19 | 3300047470 | Ga0495681_0146919 | Ga0495681_0146919_308_928 | 206 |
| 20 | 3300048903 | Ga0496100_0913838 | Ga0496100_0913838_38_658 | 206 |
| 21 | 3300048906 | Ga0496103_0291695 | Ga0496103_0291695_386_1006 | 206 |
| 22 | 3300048929 | Ga0496126_0208722 | Ga0496126_0208722_34_654 | 206 |
| 23 | 3300053078 | Ga0495612_0302859 | Ga0495612_0302859_81_701 | 206 |
| 24 | 3300053088 | Ga0500644_0196369 | Ga0500644_0196369_146_766 | 206 |
| 25 | 3300053163 | Ga0500639_151777 | Ga0500639_151777_20_640 | 206 |
| 26 | 3300053724 | Ga0500570_105554 | Ga0500570_105554_525_1148 | 206 |
| 27 | 3300048907 | Ga0496104_0292055 | Ga0496104_0292055_720_1367 | 215 |
| 28 | 3300005328 | Ga0070676_10114933 | Ga0070676_101149332 | 216 |
| 29 | 3300006881 | Ga0068865_100048318 | Ga0068865_1000483181 | 216 |
| 30 | 3300025922 | Ga0207646_10077708 | Ga0207646_100777084 | 216 |
| 31 | 3300026075 | Ga0207708_10290064 | Ga0207708_102900643 | 216 |
| 32 | 3300026089 | Ga0207648_10051602 | Ga0207648_100516024 | 216 |
| 33 | 3300039450 | Ga0436363_1389662 | Ga0436363_1389662_269_952 | 216 |
| 34 | 3300046474 | Ga0495605_0140721 | Ga0495605_0140721_277_1068 | 216 |
| 35 | 3300005719 | Ga0068861_100054256 | Ga0068861_1000542562 | 217 |
| 36 | 3300006852 | Ga0075433_10845213 | Ga0075433_108452131 | 217 |
| 37 | 3300027907 | Ga0207428_10260382 | Ga0207428_102603822 | 217 |
| 38 | 3300025898 | Ga0207692_10126262 | Ga0207692_101262622 | 221 |
| 39 | iso_pu_bacteria | 2671180139 | 2671692746 | 221 |
| 40 | iso_pu_bacteria | 2837651117 | 2837652618 | 225 |
| 41 | 3300003659 | JGI25404J52841_10001888 | JGI25404J52841_100018884 | 226 |
| 42 | 3300005983 | Ga0081540_1001462 | Ga0081540_10014628 | 226 |
| 43 | 3300037853 | Ga0436364_0616684 | Ga0436364_0616684_26808_27488 | 226 |
| 44 | 3300046515 | Ga0495620_0065975 | Ga0495620_0065975_141_911 | 226 |
| 45 | 3300046524 | Ga0495648_0070221 | Ga0495648_0070221_400_1146 | 226 |
| 46 | 3300046694 | Ga0495649_0087417 | Ga0495649_0087417_12_692 | 226 |
| 47 | iso_pu_bacteria | 2513237101 | 2513697911 | 226 |
| 48 | iso_pu_bacteria | 2721755755 | 2723842790 | 226 |
| 49 | iso_pu_bacteria | 2874604998 | 2874606550 | 226 |
| 50 | iso_pu_bacteria | 2876808645 | 2876810877 | 226 |
| 51 | iso_pu_bacteria | 2879110137 | 2879114143 | 226 |
| 52 | iso_pu_bacteria | 2922361189 | 2922367311 | 226 |
| 53 | iso_pu_bacteria | 8006964411 | 8006966087 | 226 |
| 54 | iso_pu_bacteria | 8006994254 | 8006998139 | 226 |
| 55 | iso_pu_bacteria | 8056673599 | 8056675142 | 226 |
| 56 | 3300005290 | Ga0065712_10244589 | Ga0065712_102445891 | 227 |
| 57 | 3300005364 | Ga0070673_100532200 | Ga0070673_1005322002 | 227 |
| 58 | 3300025926 | Ga0207659_10671919 | Ga0207659_106719192 | 227 |
| 59 | 3300025960 | Ga0207651_10598823 | Ga0207651_105988232 | 227 |
| 60 | 3300039453 | Ga0436362_0825752 | Ga0436362_0825752_135_818 | 227 |
| 61 | 3300048091 | Ga0495626_0086188 | Ga0495626_0086188_225_914 | 227 |
| 62 | iso_pu_bacteria | 2508501042 | 2508694375 | 227 |
| 63 | iso_pu_bacteria | 2513237098 | 2513673512 | 227 |
| 64 | iso_pu_bacteria | 2513237104 | 2513717775 | 227 |
| 65 | iso_pu_bacteria | 2513237141 | 2513887747 | 227 |
| 66 | iso_pu_bacteria | 2517093001 | 2517104367 | 227 |
| 67 | iso_pu_bacteria | 2524023210 | 2524467535 | 227 |
| 68 | iso_pu_bacteria | 2602042107 | 2603857319 | 227 |
| 69 | iso_pu_bacteria | 2643221651 | 2644289787 | 227 |
| 70 | iso_pu_bacteria | 2824661429 | 2824669947 | 227 |
| 71 | iso_pu_bacteria | 2824679649 | 2824684304 | 227 |
| 72 | iso_pu_bacteria | 2841957949 | 2841960943 | 227 |
| 73 | iso_pu_bacteria | 2857524615 | 2857526697 | 227 |
| 74 | iso_pu_bacteria | 2879099564 | 2879101382 | 227 |
| 75 | iso_pu_bacteria | 2885383462 | 2885391283 | 227 |
| 76 | iso_pu_bacteria | 2893066018 | 2893069862 | 227 |
| 77 | iso_pu_bacteria | 2903768456 | 2903777367 | 227 |
| 78 | iso_pu_bacteria | 2919073203 | 2919077797 | 227 |
| 79 | iso_pu_bacteria | 2922393267 | 2922396456 | 227 |
| 80 | iso_pu_bacteria | 2932784394 | 2932791473 | 227 |
| 81 | iso_pu_bacteria | 2932794094 | 2932796873 | 227 |
| 82 | iso_pu_bacteria | 2932801729 | 2932802346 | 227 |
| 83 | iso_pu_bacteria | 2932809354 | 2932816729 | 227 |
| 84 | iso_pu_bacteria | 2932818245 | 2932824089 | 227 |
| 85 | iso_pu_bacteria | 2932828146 | 2932835375 | 227 |
| 86 | iso_pu_bacteria | 2935616580 | 2935621118 | 227 |
| 87 | iso_pu_bacteria | 2935638405 | 2935643575 | 227 |
| 88 | iso_pu_bacteria | 2935648319 | 2935650461 | 227 |
| 89 | iso_pu_bacteria | 2935656913 | 2935662903 | 227 |
| 90 | iso_pu_bacteria | 2935665750 | 2935671115 | 227 |
| 91 | iso_pu_bacteria | 2935703347 | 2935712116 | 227 |
| 92 | iso_pu_bacteria | 2935760218 | 2935763939 | 227 |
| 93 | iso_pu_bacteria | 2935801545 | 2935807916 | 227 |
| 94 | iso_pu_bacteria | 2935810662 | 2935818750 | 227 |
| 95 | iso_pu_bacteria | 2935827899 | 2935833092 | 227 |
| 96 | iso_pu_bacteria | 2935837841 | 2935844252 | 227 |
| 97 | iso_pu_bacteria | 2935855204 | 2935859689 | 227 |
| 98 | iso_pu_bacteria | 2935864058 | 2935872087 | 227 |
| 99 | iso_pu_bacteria | 2935873716 | 2935878989 | 227 |
| 100 | iso_pu_bacteria | 2935883170 | 2935887215 | 227 |
| 101 | iso_pu_bacteria | 2935908558 | 2935911252 | 227 |
| 102 | iso_pu_bacteria | 2935926038 | 2935928281 | 227 |
| 103 | iso_pu_bacteria | 2935934488 | 2935937926 | 227 |
| 104 | iso_pu_bacteria | 2935942939 | 2935945208 | 227 |
| 105 | iso_pu_bacteria | 2935951376 | 2935954286 | 227 |
| 106 | iso_pu_bacteria | 2935959822 | 2935965635 | 227 |
| 107 | iso_pu_bacteria | 2935967501 | 2935971446 | 227 |
| 108 | iso_pu_bacteria | 2935984226 | 2935990595 | 227 |
| 109 | iso_pu_bacteria | 2935992306 | 2936000336 | 227 |
| 110 | iso_pu_bacteria | 2936002035 | 2936008494 | 227 |
| 111 | iso_pu_bacteria | 2936011229 | 2936017183 | 227 |
| 112 | iso_pu_bacteria | 2936019824 | 2936026682 | 227 |
| 113 | iso_pu_bacteria | 2936028420 | 2936035425 | 227 |
| 114 | iso_pu_bacteria | 2936037263 | 2936045560 | 227 |
| 115 | iso_pu_bacteria | 2936046547 | 2936053574 | 227 |
| 116 | iso_pu_bacteria | 2936055302 | 2936063283 | 227 |
| 117 | iso_pu_bacteria | 2941538514 | 2941542584 | 227 |
| 118 | iso_pu_bacteria | 8016630954 | 8016637170 | 227 |
| 119 | iso_pu_bacteria | 8017057580 | 8017066051 | 227 |
| 120 | iso_pu_bacteria | 8019576017 | 8019578583 | 227 |
| 121 | iso_pu_bacteria | 8019586578 | 8019596633 | 227 |
| 122 | iso_pu_bacteria | 8019597564 | 8019605071 | 227 |
| 123 | iso_pu_bacteria | 8019608314 | 8019613463 | 227 |
| 124 | iso_pu_bacteria | 8019687851 | 8019695011 | 227 |
| 125 | iso_pu_bacteria | 8056681323 | 8056684598 | 227 |
| 126 | 3300014326 | Ga0157380_10082126 | Ga0157380_100821262 | 228 |
| 127 | 3300035086 | Ga0373934_0036382 | Ga0373934_0036382_345_1031 | 228 |
| 128 | 3300035119 | Ga0373956_0055684 | Ga0373956_0055684_798_1484 | 228 |
| 129 | 3300036401 | Ga0373937_0048835 | Ga0373937_0048835_1116_1802 | 228 |
| 130 | iso_pu_bacteria | 2513237102 | 2513699507 | 228 |
| 131 | iso_pu_bacteria | 2524023205 | 2524438334 | 228 |
| 132 | iso_pu_bacteria | 2744054633 | 2745078518 | 228 |
| 133 | iso_pu_bacteria | 2791355196 | 2793059616 | 228 |
| 134 | iso_pu_bacteria | 2824617872 | 2824625202 | 228 |
| 135 | iso_pu_bacteria | 2824626560 | 2824635087 | 228 |
| 136 | iso_pu_bacteria | 2824635225 | 2824643623 | 228 |
| 137 | iso_pu_bacteria | 2824644064 | 2824652696 | 228 |
| 138 | iso_pu_bacteria | 2824714736 | 2824723251 | 228 |
| 139 | iso_pu_bacteria | 2824723954 | 2824732605 | 228 |
| 140 | iso_pu_bacteria | 2842038055 | 2842041986 | 228 |
| 141 | iso_pu_bacteria | 2842045827 | 2842050029 | 228 |
| 142 | iso_pu_bacteria | 2847930680 | 2847932290 | 228 |
| 143 | iso_pu_bacteria | 2857576091 | 2857577539 | 228 |
| 144 | iso_pu_bacteria | 2879083081 | 2879091545 | 228 |
| 145 | iso_pu_bacteria | 2885366525 | 2885374046 | 228 |
| 146 | iso_pu_bacteria | 2885409591 | 2885412920 | 228 |
| 147 | iso_pu_bacteria | 2888388044 | 2888391797 | 228 |
| 148 | iso_pu_bacteria | 2906643746 | 2906645359 | 228 |
| 149 | iso_pu_bacteria | 2922368715 | 2922370541 | 228 |
| 150 | iso_pu_bacteria | 2929615660 | 2929620118 | 228 |
| 151 | iso_pu_bacteria | 2929624759 | 2929629431 | 228 |
| 152 | iso_pu_bacteria | 2933577622 | 2933582035 | 228 |
| 153 | iso_pu_bacteria | 2935694250 | 2935699953 | 228 |
| 154 | iso_pu_bacteria | 2935769743 | 2935776659 | 228 |
| 155 | iso_pu_bacteria | 2935777560 | 2935781552 | 228 |
| 156 | iso_pu_bacteria | 2935785616 | 2935789870 | 228 |
| 157 | iso_pu_bacteria | 2935793552 | 2935798364 | 228 |
| 158 | iso_pu_bacteria | 2941531003 | 2941537285 | 228 |
| 159 | iso_pu_bacteria | 8016522445 | 8016524885 | 228 |
| 160 | iso_pu_bacteria | 8016530956 | 8016538462 | 228 |
| 161 | iso_pu_bacteria | 8016539877 | 8016542743 | 228 |
| 162 | iso_pu_bacteria | 8016557553 | 8016558958 | 228 |
| 163 | iso_pu_bacteria | 8016566248 | 8016568128 | 228 |
| 164 | iso_pu_bacteria | 8016575299 | 8016580802 | 228 |
| 165 | iso_pu_bacteria | 8016595262 | 8016596922 | 228 |
| 166 | iso_pu_bacteria | 8016603502 | 8016607826 | 228 |
| 167 | iso_pu_bacteria | 8016613128 | 8016619610 | 228 |
| 168 | iso_pu_bacteria | 8016622563 | 8016629994 | 228 |
| 169 | iso_pu_bacteria | 8019530166 | 8019538125 | 228 |
| 170 | iso_pu_bacteria | 8019538911 | 8019541858 | 228 |
| 171 | iso_pu_bacteria | 8019547302 | 8019548939 | 228 |
| 172 | iso_pu_bacteria | 8019648815 | 8019653653 | 228 |
| 173 | iso_pu_bacteria | 8055742211 | 8055750129 | 228 |
| 174 | 3300005356 | Ga0070674_100420255 | Ga0070674_1004202552 | 229 |
| 175 | 3300005435 | Ga0070714_100026447 | Ga0070714_1000264472 | 229 |
| 176 | 3300005456 | Ga0070678_100044155 | Ga0070678_1000441552 | 229 |
| 177 | 3300006028 | Ga0070717_10006671 | Ga0070717_100066717 | 229 |
| 178 | 3300006163 | Ga0070715_10019909 | Ga0070715_100199094 | 229 |
| 179 | 3300006173 | Ga0070716_100127202 | Ga0070716_1001272022 | 229 |
| 180 | 3300009148 | Ga0105243_10075123 | Ga0105243_100751232 | 229 |
| 181 | 3300009176 | Ga0105242_10089639 | Ga0105242_100896393 | 229 |
| 182 | 3300009553 | Ga0105249_10030441 | Ga0105249_100304416 | 229 |
| 183 | 3300010375 | Ga0105239_10694130 | Ga0105239_106941302 | 229 |
| 184 | 3300013308 | Ga0157375_10057754 | Ga0157375_100577542 | 229 |
| 185 | 3300014326 | Ga0157380_10042815 | Ga0157380_100428155 | 229 |
| 186 | 3300014969 | Ga0157376_10339132 | Ga0157376_103391321 | 229 |
| 187 | 3300021388 | Ga0213875_10000011 | Ga0213875_1000001129 | 229 |
| 188 | 3300025315 | Ga0207697_10089141 | Ga0207697_100891412 | 229 |
| 189 | 3300025899 | Ga0207642_10078429 | Ga0207642_100784293 | 229 |
| 190 | 3300025926 | Ga0207659_10194451 | Ga0207659_101944514 | 229 |
| 191 | 3300025929 | Ga0207664_10025742 | Ga0207664_100257425 | 229 |
| 192 | 3300025934 | Ga0207686_10221627 | Ga0207686_102216273 | 229 |
| 193 | 3300025935 | Ga0207709_10135121 | Ga0207709_101351213 | 229 |
| 194 | 3300025937 | Ga0207669_10009924 | Ga0207669_100099244 | 229 |
| 195 | 3300025939 | Ga0207665_10055525 | Ga0207665_100555253 | 229 |
| 196 | 3300025961 | Ga0207712_10285906 | Ga0207712_102859062 | 229 |
| 197 | 3300026121 | Ga0207683_10051830 | Ga0207683_100518303 | 229 |
| 198 | 3300035695 | Ga0373927_0026463 | Ga0373927_0026463_988_1677 | 229 |
| 199 | 3300037068 | Ga0373925_0176925 | Ga0373925_0176925_896_1585 | 229 |
| 200 | 3300037853 | Ga0436364_0232280 | Ga0436364_0232280_33283_33972 | 229 |
| 201 | 3300037853 | Ga0436364_0887813 | Ga0436364_0887813_480_1169 | 229 |
| 202 | 3300037853 | Ga0436364_1224135 | Ga0436364_1224135_45624_46313 | 229 |
| 203 | 3300039453 | Ga0436362_1206919 | Ga0436362_1206919_172_861 | 229 |
| 204 | 3300046523 | Ga0495644_0011772 | Ga0495644_0011772_2070_2861 | 229 |
| 205 | 3300046525 | Ga0495663_0100623 | Ga0495663_0100623_21_812 | 229 |
| 206 | 3300046684 | Ga0495669_0002970 | Ga0495669_0002970_4491_5282 | 229 |
| 207 | 3300047445 | Ga0495677_0025799 | Ga0495677_0025799_134_925 | 229 |
| 208 | 3300048905 | Ga0496102_0070854 | Ga0496102_0070854_1541_2332 | 229 |
| 209 | 3300048917 | Ga0496114_0060221 | Ga0496114_0060221_640_1431 | 229 |
| 210 | 3300049583 | Ga0501067_0023237 | Ga0501067_0023237_1550_2242 | 229 |
| 211 | 3300049589 | Ga0501073_0053128 | Ga0501073_0053128_2082_2774 | 229 |
| 212 | 3300049743 | Ga0501081_0673098 | Ga0501081_0673098_67_759 | 229 |
| 213 | 3300005330 | Ga0070690_100474184 | Ga0070690_1004741841 | 230 |
| 214 | 3300005338 | Ga0068868_100060031 | Ga0068868_1000600314 | 230 |
| 215 | 3300005347 | Ga0070668_100292083 | Ga0070668_1002920832 | 230 |
| 216 | 3300005366 | Ga0070659_100656581 | Ga0070659_1006565811 | 230 |
| 217 | 3300005441 | Ga0070700_100155547 | Ga0070700_1001555472 | 230 |
| 218 | 3300005455 | Ga0070663_100049222 | Ga0070663_1000492222 | 230 |
| 219 | 3300005455 | Ga0070663_100091376 | Ga0070663_1000913761 | 230 |
| 220 | 3300005455 | Ga0070663_100483433 | Ga0070663_1004834331 | 230 |
| 221 | 3300005457 | Ga0070662_100047414 | Ga0070662_1000474143 | 230 |
| 222 | 3300005548 | Ga0070665_100015135 | Ga0070665_1000151352 | 230 |
| 223 | 3300005548 | Ga0070665_100042136 | Ga0070665_1000421364 | 230 |
| 224 | 3300005548 | Ga0070665_100108212 | Ga0070665_1001082123 | 230 |
| 225 | 3300005548 | Ga0070665_100213535 | Ga0070665_1002135353 | 230 |
| 226 | 3300005564 | Ga0070664_100675758 | Ga0070664_1006757582 | 230 |
| 227 | 3300005578 | Ga0068854_100284844 | Ga0068854_1002848442 | 230 |
| 228 | 3300005614 | Ga0068856_100261325 | Ga0068856_1002613251 | 230 |
| 229 | 3300005615 | Ga0070702_100275393 | Ga0070702_1002753931 | 230 |
| 230 | 3300005617 | Ga0068859_100061016 | Ga0068859_1000610162 | 230 |
| 231 | 3300005618 | Ga0068864_100075214 | Ga0068864_1000752142 | 230 |
| 232 | 3300005718 | Ga0068866_10141008 | Ga0068866_101410082 | 230 |
| 233 | 3300005719 | Ga0068861_100343230 | Ga0068861_1003432301 | 230 |
| 234 | 3300005841 | Ga0068863_100110330 | Ga0068863_1001103302 | 230 |
| 235 | 3300005843 | Ga0068860_100053416 | Ga0068860_1000534162 | 230 |
| 236 | 3300005843 | Ga0068860_100100200 | Ga0068860_1001002002 | 230 |
| 237 | 3300005844 | Ga0068862_100099944 | Ga0068862_1000999443 | 230 |
| 238 | 3300005844 | Ga0068862_100338703 | Ga0068862_1003387032 | 230 |
| 239 | 3300005937 | Ga0081455_10022998 | Ga0081455_100229983 | 230 |
| 240 | 3300005983 | Ga0081540_1003095 | Ga0081540_10030952 | 230 |
| 241 | 3300005983 | Ga0081540_1004104 | Ga0081540_100410410 | 230 |
| 242 | 3300005983 | Ga0081540_1004610 | Ga0081540_100461012 | 230 |
| 243 | 3300005983 | Ga0081540_1027653 | Ga0081540_10276533 | 230 |
| 244 | 3300006048 | Ga0075363_100000680 | Ga0075363_10000068012 | 230 |
| 245 | 3300006048 | Ga0075363_100095017 | Ga0075363_1000950172 | 230 |
| 246 | 3300006051 | Ga0075364_10123240 | Ga0075364_101232402 | 230 |
| 247 | 3300006177 | Ga0075362_10185222 | Ga0075362_101852221 | 230 |
| 248 | 3300006178 | Ga0075367_10095026 | Ga0075367_100950262 | 230 |
| 249 | 3300006178 | Ga0075367_10205996 | Ga0075367_102059962 | 230 |
| 250 | 3300006195 | Ga0075366_10131820 | Ga0075366_101318202 | 230 |
| 251 | 3300006353 | Ga0075370_10007368 | Ga0075370_100073687 | 230 |
| 252 | 3300006353 | Ga0075370_10018197 | Ga0075370_100181974 | 230 |
| 253 | 3300006358 | Ga0068871_100081794 | Ga0068871_1000817944 | 230 |
| 254 | 3300006871 | Ga0075434_100379761 | Ga0075434_1003797613 | 230 |
| 255 | 3300006931 | Ga0097620_100061013 | Ga0097620_1000610132 | 230 |
| 256 | 3300007076 | Ga0075435_100316466 | Ga0075435_1003164662 | 230 |
| 257 | 3300009093 | Ga0105240_10355506 | Ga0105240_103555063 | 230 |
| 258 | 3300009174 | Ga0105241_10047563 | Ga0105241_100475632 | 230 |
| 259 | 3300009174 | Ga0105241_10068508 | Ga0105241_100685082 | 230 |
| 260 | 3300009177 | Ga0105248_10069294 | Ga0105248_100692945 | 230 |
| 261 | 3300009545 | Ga0105237_10616336 | Ga0105237_106163361 | 230 |
| 262 | 3300009553 | Ga0105249_10363467 | Ga0105249_103634672 | 230 |
| 263 | 3300010375 | Ga0105239_10067144 | Ga0105239_100671444 | 230 |
| 264 | 3300010375 | Ga0105239_10086663 | Ga0105239_100866634 | 230 |
| 265 | 3300010375 | Ga0105239_10901000 | Ga0105239_109010001 | 230 |
| 266 | 3300011119 | Ga0105246_10066091 | Ga0105246_100660915 | 230 |
| 267 | 3300013296 | Ga0157374_10229435 | Ga0157374_102294353 | 230 |
| 268 | 3300014325 | Ga0163163_10099788 | Ga0163163_100997883 | 230 |
| 269 | 3300014325 | Ga0163163_10991486 | Ga0163163_109914861 | 230 |
| 270 | 3300014968 | Ga0157379_10160337 | Ga0157379_101603373 | 230 |
| 271 | 3300014969 | Ga0157376_10107194 | Ga0157376_101071943 | 230 |
| 272 | 3300021388 | Ga0213875_10002319 | Ga0213875_1000231910 | 230 |
| 273 | 3300025899 | Ga0207642_10253003 | Ga0207642_102530031 | 230 |
| 274 | 3300025900 | Ga0207710_10093872 | Ga0207710_100938722 | 230 |
| 275 | 3300025901 | Ga0207688_10227034 | Ga0207688_102270341 | 230 |
| 276 | 3300025907 | Ga0207645_10037451 | Ga0207645_100374515 | 230 |
| 277 | 3300025909 | Ga0207705_10033478 | Ga0207705_100334784 | 230 |
| 278 | 3300025924 | Ga0207694_10040558 | Ga0207694_100405582 | 230 |
| 279 | 3300025927 | Ga0207687_10012936 | Ga0207687_100129364 | 230 |
| 280 | 3300025929 | Ga0207664_10110197 | Ga0207664_101101972 | 230 |
| 281 | 3300025931 | Ga0207644_10252591 | Ga0207644_102525911 | 230 |
| 282 | 3300025932 | Ga0207690_10553710 | Ga0207690_105537101 | 230 |
| 283 | 3300025933 | Ga0207706_10026773 | Ga0207706_100267736 | 230 |
| 284 | 3300025936 | Ga0207670_10142712 | Ga0207670_101427121 | 230 |
| 285 | 3300025940 | Ga0207691_10091519 | Ga0207691_100915194 | 230 |
| 286 | 3300025941 | Ga0207711_10099749 | Ga0207711_100997492 | 230 |
| 287 | 3300025942 | Ga0207689_10056672 | Ga0207689_100566725 | 230 |
| 288 | 3300025961 | Ga0207712_10161695 | Ga0207712_101616951 | 230 |
| 289 | 3300025972 | Ga0207668_10131577 | Ga0207668_101315773 | 230 |
| 290 | 3300026023 | Ga0207677_10062898 | Ga0207677_100628982 | 230 |
| 291 | 3300026067 | Ga0207678_10004916 | Ga0207678_1000491612 | 230 |
| 292 | 3300026067 | Ga0207678_10095014 | Ga0207678_100950144 | 230 |
| 293 | 3300026067 | Ga0207678_10265681 | Ga0207678_102656812 | 230 |
| 294 | 3300026075 | Ga0207708_10255226 | Ga0207708_102552261 | 230 |
| 295 | 3300026088 | Ga0207641_10313628 | Ga0207641_103136282 | 230 |
| 296 | 3300026089 | Ga0207648_10431007 | Ga0207648_104310071 | 230 |
| 297 | 3300026095 | Ga0207676_10063964 | Ga0207676_100639644 | 230 |
| 298 | 3300026116 | Ga0207674_10196401 | Ga0207674_101964011 | 230 |
| 299 | 3300026118 | Ga0207675_100068830 | Ga0207675_1000688302 | 230 |
| 300 | 3300026121 | Ga0207683_10699674 | Ga0207683_106996741 | 230 |
| 301 | 3300028379 | Ga0268266_10006857 | Ga0268266_100068574 | 230 |
| 302 | 3300028379 | Ga0268266_10601225 | Ga0268266_106012251 | 230 |
| 303 | 3300028380 | Ga0268265_10111732 | Ga0268265_101117321 | 230 |
| 304 | 3300028381 | Ga0268264_10045022 | Ga0268264_100450223 | 230 |
| 305 | 3300028381 | Ga0268264_10686124 | Ga0268264_106861242 | 230 |
| 306 | 3300031665 | Ga0316575_10089195 | Ga0316575_100891952 | 230 |
| 307 | 3300031995 | Ga0307409_100119359 | Ga0307409_1001193591 | 230 |
| 308 | 3300031995 | Ga0307409_100269743 | Ga0307409_1002697433 | 230 |
| 309 | 3300032126 | Ga0307415_100021174 | Ga0307415_1000211745 | 230 |
| 310 | 3300032126 | Ga0307415_100247425 | Ga0307415_1002474252 | 230 |
| 311 | 3300032126 | Ga0307415_100711575 | Ga0307415_1007115751 | 230 |
| 312 | 3300037312 | Ga0395899_0179696 | Ga0395899_0179696_64_759 | 230 |
| 313 | 3300037418 | Ga0395900_0124721 | Ga0395900_0124721_1270_1965 | 230 |
| 314 | 3300038443 | Ga0395901_0015566 | Ga0395901_0015566_4211_4906 | 230 |
| 315 | 3300041451 | Ga0451791_0231185 | Ga0451791_0231185_60_806 | 230 |
| 316 | 3300046455 | Ga0495603_0053912 | Ga0495603_0053912_647_1339 | 230 |
| 317 | 3300046460 | Ga0495638_0047605 | Ga0495638_0047605_458_1222 | 230 |
| 318 | 3300046471 | Ga0495650_0082850 | Ga0495650_0082850_431_1195 | 230 |
| 319 | 3300046472 | Ga0495580_0396492 | Ga0495580_0396492_68_760 | 230 |
| 320 | 3300046474 | Ga0495605_0152741 | Ga0495605_0152741_165_929 | 230 |
| 321 | 3300046491 | Ga0495584_0141793 | Ga0495584_0141793_432_1193 | 230 |
| 322 | 3300046492 | Ga0495585_0055858 | Ga0495585_0055858_581_1273 | 230 |
| 323 | 3300046500 | Ga0495596_0039854 | Ga0495596_0039854_621_1385 | 230 |
| 324 | 3300046513 | Ga0495616_0053634 | Ga0495616_0053634_193_957 | 230 |
| 325 | 3300046518 | Ga0495631_0011197 | Ga0495631_0011197_2172_2936 | 230 |
| 326 | 3300046519 | Ga0495632_0032104 | Ga0495632_0032104_495_1259 | 230 |
| 327 | 3300046519 | Ga0495632_0167237 | Ga0495632_0167237_31_810 | 230 |
| 328 | 3300046523 | Ga0495644_0016014 | Ga0495644_0016014_345_1037 | 230 |
| 329 | 3300046525 | Ga0495663_0050265 | Ga0495663_0050265_11_718 | 230 |
| 330 | 3300046528 | Ga0495642_0024956 | Ga0495642_0024956_821_1585 | 230 |
| 331 | 3300046538 | Ga0495609_0082791 | Ga0495609_0082791_284_1048 | 230 |
| 332 | 3300046557 | Ga0495622_0073983 | Ga0495622_0073983_37_831 | 230 |
| 333 | 3300046616 | Ga0495668_0018733 | Ga0495668_0018733_975_1739 | 230 |
| 334 | 3300046616 | Ga0495668_0059067 | Ga0495668_0059067_1074_1853 | 230 |
| 335 | 3300046648 | Ga0495611_0022187 | Ga0495611_0022187_581_1345 | 230 |
| 336 | 3300046664 | Ga0495659_0023543 | Ga0495659_0023543_382_1074 | 230 |
| 337 | 3300046664 | Ga0495659_0048013 | Ga0495659_0048013_672_1364 | 230 |
| 338 | 3300046681 | Ga0495647_0083878 | Ga0495647_0083878_390_1082 | 230 |
| 339 | 3300046684 | Ga0495669_0039616 | Ga0495669_0039616_14_751 | 230 |
| 340 | 3300046684 | Ga0495669_0121906 | Ga0495669_0121906_490_1182 | 230 |
| 341 | 3300046691 | Ga0495670_0038253 | Ga0495670_0038253_837_1529 | 230 |
| 342 | 3300046794 | Ga0495589_0060910 | Ga0495589_0060910_415_1179 | 230 |
| 343 | 3300047315 | Ga0495581_0203681 | Ga0495581_0203681_12_761 | 230 |
| 344 | 3300047318 | Ga0495636_0029940 | Ga0495636_0029940_1159_1851 | 230 |
| 345 | 3300047469 | Ga0495673_0055712 | Ga0495673_0055712_757_1521 | 230 |
| 346 | 3300048905 | Ga0496102_0142725 | Ga0496102_0142725_1388_2080 | 230 |
| 347 | 3300048906 | Ga0496103_0182523 | Ga0496103_0182523_327_1019 | 230 |
| 348 | 3300048908 | Ga0496105_0107803 | Ga0496105_0107803_1245_1937 | 230 |
| 349 | 3300048911 | Ga0496108_0060454 | Ga0496108_0060454_544_1236 | 230 |
| 350 | 3300048913 | Ga0496110_0035330 | Ga0496110_0035330_1909_2601 | 230 |
| 351 | 3300048914 | Ga0496111_0410030 | Ga0496111_0410030_156_890 | 230 |
| 352 | 3300048916 | Ga0496113_0435732 | Ga0496113_0435732_272_964 | 230 |
| 353 | 3300048918 | Ga0496115_0144035 | Ga0496115_0144035_643_1335 | 230 |
| 354 | 3300048918 | Ga0496115_0511624 | Ga0496115_0511624_233_925 | 230 |
| 355 | 3300048918 | Ga0496115_0639337 | Ga0496115_0639337_72_764 | 230 |
| 356 | 3300048919 | Ga0496116_0178608 | Ga0496116_0178608_321_1013 | 230 |
| 357 | 3300048921 | Ga0496118_0262790 | Ga0496118_0262790_110_802 | 230 |
| 358 | 3300048923 | Ga0496120_0121961 | Ga0496120_0121961_176_868 | 230 |
| 359 | 3300048924 | Ga0496121_0023355 | Ga0496121_0023355_2433_3125 | 230 |
| 360 | 3300048924 | Ga0496121_0108275 | Ga0496121_0108275_92_784 | 230 |
| 361 | 3300048927 | Ga0496124_0331242 | Ga0496124_0331242_354_1046 | 230 |
| 362 | 3300048927 | Ga0496124_0530107 | Ga0496124_0530107_35_727 | 230 |
| 363 | 3300048929 | Ga0496126_0018704 | Ga0496126_0018704_3607_4299 | 230 |
| 364 | 3300049572 | Ga0501036_0047624 | Ga0501036_0047624_989_1684 | 230 |
| 365 | 3300049580 | Ga0501046_0353459 | Ga0501046_0353459_186_881 | 230 |
| 366 | 3300049581 | Ga0501047_0613812 | Ga0501047_0613812_184_879 | 230 |
| 367 | 3300049822 | Ga0501035_0069240 | Ga0501035_0069240_2072_2767 | 230 |
| 368 | 3300049824 | Ga0501045_0405999 | Ga0501045_0405999_217_912 | 230 |
| 369 | 3300050489 | nmdc:mga03683_148439_c1 | nmdc:mga03683_148439_c1_280_972 | 230 |
| 370 | 3300050490 | nmdc:mga03n38_4940_c1 | nmdc:mga03n38_4940_c1_3207_3899 | 230 |
| 371 | 3300050491 | nmdc:mga00v17_155965_c1 | nmdc:mga00v17_155965_c1_352_1044 | 230 |
| 372 | 3300050494 | nmdc:mga06z11_261468_c1 | nmdc:mga06z11_261468_c1_263_1000 | 230 |
| 373 | 3300050494 | nmdc:mga06z11_77115_c1 | nmdc:mga06z11_77115_c1_589_1281 | 230 |
| 374 | 3300050495 | nmdc:mga04h51_55315_c1 | nmdc:mga04h51_55315_c1_478_1170 | 230 |
| 375 | 3300050496 | nmdc:mga07m45_52567_c1 | nmdc:mga07m45_52567_c1_1176_1868 | 230 |
| 376 | 3300050496 | nmdc:mga07m45_8072_c1 | nmdc:mga07m45_8072_c1_4324_5016 | 230 |
| 377 | 3300050512 | nmdc:mga0n895_661570_c1 | nmdc:mga0n895_661570_c1_189_881 | 230 |
| 378 | 3300053087 | Ga0500643_022154 | Ga0500643_022154_1117_1809 | 230 |
| 379 | 3300053096 | Ga0500641_0025966 | Ga0500641_0025966_425_1117 | 230 |
| 380 | 3300053096 | Ga0500641_0166303 | Ga0500641_0166303_114_806 | 230 |
| 381 | 3300053114 | Ga0500582_132356 | Ga0500582_132356_32_724 | 230 |
| 382 | 3300053130 | Ga0500642_0051040 | Ga0500642_0051040_526_1218 | 230 |
| 383 | 3300053134 | Ga0500658_0010926 | Ga0500658_0010926_2246_2938 | 230 |
| 384 | 3300053146 | Ga0500588_0027359 | Ga0500588_0027359_664_1356 | 230 |
| 385 | 3300053161 | Ga0500634_0145645 | Ga0500634_0145645_401_1093 | 230 |
| 386 | 3300053178 | Ga0500637_0093240 | Ga0500637_0093240_815_1573 | 230 |
| 387 | 3300005329 | Ga0070683_100083841 | Ga0070683_1000838413 | 231 |
| 388 | 3300005335 | Ga0070666_10421842 | Ga0070666_104218421 | 231 |
| 389 | 3300005338 | Ga0068868_100656136 | Ga0068868_1006561361 | 231 |
| 390 | 3300005344 | Ga0070661_100067210 | Ga0070661_1000672104 | 231 |
| 391 | 3300005434 | Ga0070709_10003877 | Ga0070709_100038777 | 231 |
| 392 | 3300005435 | Ga0070714_100002400 | Ga0070714_1000024004 | 231 |
| 393 | 3300005435 | Ga0070714_100212405 | Ga0070714_1002124052 | 231 |
| 394 | 3300005436 | Ga0070713_100066523 | Ga0070713_1000665233 | 231 |
| 395 | 3300005436 | Ga0070713_100409671 | Ga0070713_1004096712 | 231 |
| 396 | 3300005437 | Ga0070710_10011512 | Ga0070710_100115124 | 231 |
| 397 | 3300005437 | Ga0070710_10051623 | Ga0070710_100516233 | 231 |
| 398 | 3300005439 | Ga0070711_100032102 | Ga0070711_1000321023 | 231 |
| 399 | 3300005439 | Ga0070711_100139720 | Ga0070711_1001397202 | 231 |
| 400 | 3300005439 | Ga0070711_100153290 | Ga0070711_1001532902 | 231 |
| 401 | 3300005455 | Ga0070663_100193042 | Ga0070663_1001930421 | 231 |
| 402 | 3300005471 | Ga0070698_100026383 | Ga0070698_1000263838 | 231 |
| 403 | 3300005518 | Ga0070699_100128562 | Ga0070699_1001285622 | 231 |
| 404 | 3300005530 | Ga0070679_100523308 | Ga0070679_1005233081 | 231 |
| 405 | 3300005536 | Ga0070697_100347379 | Ga0070697_1003473792 | 231 |
| 406 | 3300005614 | Ga0068856_100025081 | Ga0068856_1000250814 | 231 |
| 407 | 3300005614 | Ga0068856_100693134 | Ga0068856_1006931341 | 231 |
| 408 | 3300005618 | Ga0068864_100273776 | Ga0068864_1002737762 | 231 |
| 409 | 3300005842 | Ga0068858_100411470 | Ga0068858_1004114701 | 231 |
| 410 | 3300006028 | Ga0070717_10037568 | Ga0070717_100375682 | 231 |
| 411 | 3300006038 | Ga0075365_10236458 | Ga0075365_102364582 | 231 |
| 412 | 3300006048 | Ga0075363_100115001 | Ga0075363_1001150012 | 231 |
| 413 | 3300006051 | Ga0075364_10010772 | Ga0075364_100107725 | 231 |
| 414 | 3300006175 | Ga0070712_100002146 | Ga0070712_1000021467 | 231 |
| 415 | 3300006175 | Ga0070712_100069089 | Ga0070712_1000690893 | 231 |
| 416 | 3300006186 | Ga0075369_10005761 | Ga0075369_100057615 | 231 |
| 417 | 3300006914 | Ga0075436_100052807 | Ga0075436_1000528072 | 231 |
| 418 | 3300006914 | Ga0075436_100108224 | Ga0075436_1001082241 | 231 |
| 419 | 3300007265 | Ga0099794_10118282 | Ga0099794_101182822 | 231 |
| 420 | 3300007788 | Ga0099795_10028541 | Ga0099795_100285412 | 231 |
| 421 | 3300007788 | Ga0099795_10028831 | Ga0099795_100288311 | 231 |
| 422 | 3300009093 | Ga0105240_10080848 | Ga0105240_100808484 | 231 |
| 423 | 3300009094 | Ga0111539_10281499 | Ga0111539_102814993 | 231 |
| 424 | 3300009101 | Ga0105247_10038309 | Ga0105247_100383095 | 231 |
| 425 | 3300009101 | Ga0105247_10519229 | Ga0105247_105192291 | 231 |
| 426 | 3300009176 | Ga0105242_10158533 | Ga0105242_101585331 | 231 |
| 427 | 3300010159 | Ga0099796_10010931 | Ga0099796_100109314 | 231 |
| 428 | 3300010159 | Ga0099796_10021110 | Ga0099796_100211103 | 231 |
| 429 | 3300010159 | Ga0099796_10093418 | Ga0099796_100934182 | 231 |
| 430 | 3300010375 | Ga0105239_10059371 | Ga0105239_100593713 | 231 |
| 431 | 3300010375 | Ga0105239_10144870 | Ga0105239_101448701 | 231 |
| 432 | 3300011119 | Ga0105246_10009096 | Ga0105246_100090966 | 231 |
| 433 | 3300013296 | Ga0157374_10015314 | Ga0157374_100153146 | 231 |
| 434 | 3300013306 | Ga0163162_10025914 | Ga0163162_100259143 | 231 |
| 435 | 3300013308 | Ga0157375_10153627 | Ga0157375_101536272 | 231 |
| 436 | 3300014325 | Ga0163163_10070756 | Ga0163163_100707562 | 231 |
| 437 | 3300014497 | Ga0182008_10075648 | Ga0182008_100756482 | 231 |
| 438 | 3300014969 | Ga0157376_10005988 | Ga0157376_100059886 | 231 |
| 439 | 3300021358 | Ga0213873_10074724 | Ga0213873_100747241 | 231 |
| 440 | 3300021361 | Ga0213872_10113163 | Ga0213872_101131631 | 231 |
| 441 | 3300021377 | Ga0213874_10062906 | Ga0213874_100629062 | 231 |
| 442 | 3300021388 | Ga0213875_10000480 | Ga0213875_1000048035 | 231 |
| 443 | 3300021441 | Ga0213871_10014576 | Ga0213871_100145762 | 231 |
| 444 | 3300025253 | Ga0209677_102002 | Ga0209677_1020028 | 231 |
| 445 | 3300025261 | Ga0209233_1003959 | Ga0209233_10039595 | 231 |
| 446 | 3300025295 | Ga0209564_1000397 | Ga0209564_100039735 | 231 |
| 447 | 3300025315 | Ga0207697_10058291 | Ga0207697_100582913 | 231 |
| 448 | 3300025898 | Ga0207692_10012176 | Ga0207692_100121763 | 231 |
| 449 | 3300025906 | Ga0207699_10037669 | Ga0207699_100376692 | 231 |
| 450 | 3300025906 | Ga0207699_10067760 | Ga0207699_100677602 | 231 |
| 451 | 3300025912 | Ga0207707_10245404 | Ga0207707_102454042 | 231 |
| 452 | 3300025912 | Ga0207707_10543706 | Ga0207707_105437062 | 231 |
| 453 | 3300025915 | Ga0207693_10002609 | Ga0207693_100026097 | 231 |
| 454 | 3300025915 | Ga0207693_10028370 | Ga0207693_100283705 | 231 |
| 455 | 3300025915 | Ga0207693_10085965 | Ga0207693_100859652 | 231 |
| 456 | 3300025915 | Ga0207693_10481881 | Ga0207693_104818812 | 231 |
| 457 | 3300025916 | Ga0207663_10005220 | Ga0207663_100052206 | 231 |
| 458 | 3300025920 | Ga0207649_10204128 | Ga0207649_102041282 | 231 |
| 459 | 3300025921 | Ga0207652_10361797 | Ga0207652_103617971 | 231 |
| 460 | 3300025928 | Ga0207700_10206584 | Ga0207700_102065842 | 231 |
| 461 | 3300025928 | Ga0207700_10215507 | Ga0207700_102155072 | 231 |
| 462 | 3300025929 | Ga0207664_10038577 | Ga0207664_100385773 | 231 |
| 463 | 3300025929 | Ga0207664_10106974 | Ga0207664_101069743 | 231 |
| 464 | 3300025929 | Ga0207664_10346465 | Ga0207664_103464652 | 231 |
| 465 | 3300025929 | Ga0207664_10453600 | Ga0207664_104536002 | 231 |
| 466 | 3300025938 | Ga0207704_10100374 | Ga0207704_101003742 | 231 |
| 467 | 3300025939 | Ga0207665_10023995 | Ga0207665_100239953 | 231 |
| 468 | 3300025939 | Ga0207665_10094022 | Ga0207665_100940221 | 231 |
| 469 | 3300025942 | Ga0207689_10480185 | Ga0207689_104801851 | 231 |
| 470 | 3300025944 | Ga0207661_10052779 | Ga0207661_100527794 | 231 |
| 471 | 3300025945 | Ga0207679_10102978 | Ga0207679_101029783 | 231 |
| 472 | 3300026035 | Ga0207703_10451093 | Ga0207703_104510932 | 231 |
| 473 | 3300026067 | Ga0207678_10015307 | Ga0207678_100153075 | 231 |
| 474 | 3300026067 | Ga0207678_10025216 | Ga0207678_100252162 | 231 |
| 475 | 3300026078 | Ga0207702_10071413 | Ga0207702_100714132 | 231 |
| 476 | 3300026078 | Ga0207702_10615743 | Ga0207702_106157432 | 231 |
| 477 | 3300026095 | Ga0207676_10008501 | Ga0207676_100085015 | 231 |
| 478 | 3300026121 | Ga0207683_10008816 | Ga0207683_100088163 | 231 |
| 479 | 3300028573 | Ga0265334_10025685 | Ga0265334_100256852 | 231 |
| 480 | 3300031239 | Ga0265328_10048818 | Ga0265328_100488182 | 231 |
| 481 | 3300034816 | Ga0373930_0010637 | Ga0373930_0010637_490_1185 | 231 |
| 482 | 3300034957 | Ga0373938_0051523 | Ga0373938_0051523_99_869 | 231 |
| 483 | 3300035115 | Ga0373941_0141572 | Ga0373941_0141572_61_756 | 231 |
| 484 | 3300035116 | Ga0373945_0135081 | Ga0373945_0135081_265_960 | 231 |
| 485 | 3300035119 | Ga0373956_0129969 | Ga0373956_0129969_100_807 | 231 |
| 486 | 3300035121 | Ga0373960_0031327 | Ga0373960_0031327_554_1249 | 231 |
| 487 | 3300035170 | Ga0373943_0129611 | Ga0373943_0129611_431_1195 | 231 |
| 488 | 3300035691 | Ga0373931_0019943 | Ga0373931_0019943_601_1371 | 231 |
| 489 | 3300035691 | Ga0373931_0198817 | Ga0373931_0198817_242_937 | 231 |
| 490 | 3300035692 | Ga0373935_0391751 | Ga0373935_0391751_275_970 | 231 |
| 491 | 3300035724 | Ga0373933_0308472 | Ga0373933_0308472_18_725 | 231 |
| 492 | 3300036401 | Ga0373937_0079077 | Ga0373937_0079077_1383_2090 | 231 |
| 493 | 3300036401 | Ga0373937_0558471 | Ga0373937_0558471_152_883 | 231 |
| 494 | 3300037466 | Ga0395898_0094516 | Ga0395898_0094516_2052_2747 | 231 |
| 495 | 3300037853 | Ga0436364_0010042 | Ga0436364_0010042_28720_29415 | 231 |
| 496 | 3300037853 | Ga0436364_0151134 | Ga0436364_0151134_265_960 | 231 |
| 497 | 3300037853 | Ga0436364_0960005 | Ga0436364_0960005_1696_2391 | 231 |
| 498 | 3300039437 | Ga0436365_1051823 | Ga0436365_1051823_855_1550 | 231 |
| 499 | 3300039437 | Ga0436365_1917762 | Ga0436365_1917762_14_709 | 231 |
| 500 | 3300039438 | Ga0436360_0135729 | Ga0436360_0135729_135_842 | 231 |
| 501 | 3300039438 | Ga0436360_0372949 | Ga0436360_0372949_483_1178 | 231 |
| 502 | 3300039438 | Ga0436360_0381517 | Ga0436360_0381517_195_890 | 231 |
| 503 | 3300039438 | Ga0436360_1299321 | Ga0436360_1299321_38_733 | 231 |
| 504 | 3300039447 | Ga0436361_0240505 | Ga0436361_0240505_210_905 | 231 |
| 505 | 3300039450 | Ga0436363_0956567 | Ga0436363_0956567_822_1517 | 231 |
| 506 | 3300039450 | Ga0436363_1095549 | Ga0436363_1095549_1367_2062 | 231 |
| 507 | 3300039453 | Ga0436362_0351741 | Ga0436362_0351741_896_1603 | 231 |
| 508 | 3300039453 | Ga0436362_0533801 | Ga0436362_0533801_704_1429 | 231 |
| 509 | 3300039453 | Ga0436362_0621117 | Ga0436362_0621117_401_1096 | 231 |
| 510 | 3300046454 | Ga0495592_0323100 | Ga0495592_0323100_10_705 | 231 |
| 511 | 3300046460 | Ga0495638_0120423 | Ga0495638_0120423_468_1163 | 231 |
| 512 | 3300046462 | Ga0495651_0067205 | Ga0495651_0067205_739_1434 | 231 |
| 513 | 3300046477 | Ga0495664_0105598 | Ga0495664_0105598_708_1403 | 231 |
| 514 | 3300046501 | Ga0495607_0000007 | Ga0495607_0000007_50419_51123 | 231 |
| 515 | 3300046506 | Ga0495583_0069063 | Ga0495583_0069063_742_1437 | 231 |
| 516 | 3300046512 | Ga0495610_0018929 | Ga0495610_0018929_1069_1764 | 231 |
| 517 | 3300046513 | Ga0495616_0047660 | Ga0495616_0047660_899_1594 | 231 |
| 518 | 3300046515 | Ga0495620_0024529 | Ga0495620_0024529_1216_1911 | 231 |
| 519 | 3300046518 | Ga0495631_0060301 | Ga0495631_0060301_537_1232 | 231 |
| 520 | 3300046524 | Ga0495648_0201016 | Ga0495648_0201016_25_720 | 231 |
| 521 | 3300046616 | Ga0495668_0085120 | Ga0495668_0085120_595_1290 | 231 |
| 522 | 3300046616 | Ga0495668_0232173 | Ga0495668_0232173_298_993 | 231 |
| 523 | 3300046648 | Ga0495611_0139750 | Ga0495611_0139750_89_784 | 231 |
| 524 | 3300046663 | Ga0495635_0389154 | Ga0495635_0389154_109_804 | 231 |
| 525 | 3300046675 | Ga0495657_0174775 | Ga0495657_0174775_555_1250 | 231 |
| 526 | 3300046691 | Ga0495670_0119499 | Ga0495670_0119499_198_893 | 231 |
| 527 | 3300046692 | Ga0495671_0049040 | Ga0495671_0049040_405_1100 | 231 |
| 528 | 3300046809 | Ga0495600_0061389 | Ga0495600_0061389_1512_2207 | 231 |
| 529 | 3300047444 | Ga0495675_0451184 | Ga0495675_0451184_38_733 | 231 |
| 530 | 3300048903 | Ga0496100_0046421 | Ga0496100_0046421_1062_1832 | 231 |
| 531 | 3300048903 | Ga0496100_0254310 | Ga0496100_0254310_497_1228 | 231 |
| 532 | 3300048905 | Ga0496102_0002173 | Ga0496102_0002173_11941_12672 | 231 |
| 533 | 3300048905 | Ga0496102_0086365 | Ga0496102_0086365_1362_2132 | 231 |
| 534 | 3300048906 | Ga0496103_0038357 | Ga0496103_0038357_831_1601 | 231 |
| 535 | 3300048907 | Ga0496104_0031262 | Ga0496104_0031262_462_1193 | 231 |
| 536 | 3300048907 | Ga0496104_0599746 | Ga0496104_0599746_53_823 | 231 |
| 537 | 3300048908 | Ga0496105_0007814 | Ga0496105_0007814_6107_6838 | 231 |
| 538 | 3300048908 | Ga0496105_0170813 | Ga0496105_0170813_878_1648 | 231 |
| 539 | 3300048909 | Ga0496106_0003947 | Ga0496106_0003947_7620_8351 | 231 |
| 540 | 3300048909 | Ga0496106_0050798 | Ga0496106_0050798_1581_2351 | 231 |
| 541 | 3300048909 | Ga0496106_0096539 | Ga0496106_0096539_1496_2191 | 231 |
| 542 | 3300048910 | Ga0496107_0002755 | Ga0496107_0002755_4913_5644 | 231 |
| 543 | 3300048910 | Ga0496107_0023427 | Ga0496107_0023427_1347_2117 | 231 |
| 544 | 3300048911 | Ga0496108_0044462 | Ga0496108_0044462_1357_2127 | 231 |
| 545 | 3300048912 | Ga0496109_0030271 | Ga0496109_0030271_548_1279 | 231 |
| 546 | 3300048912 | Ga0496109_0050679 | Ga0496109_0050679_272_1042 | 231 |
| 547 | 3300048913 | Ga0496110_0028973 | Ga0496110_0028973_3998_4693 | 231 |
| 548 | 3300048913 | Ga0496110_0360028 | Ga0496110_0360028_128_898 | 231 |
| 549 | 3300048914 | Ga0496111_0247491 | Ga0496111_0247491_123_893 | 231 |
| 550 | 3300048914 | Ga0496111_0315364 | Ga0496111_0315364_64_795 | 231 |
| 551 | 3300048915 | Ga0496112_0000023 | Ga0496112_0000023_63870_64565 | 231 |
| 552 | 3300048915 | Ga0496112_0009639 | Ga0496112_0009639_3574_4305 | 231 |
| 553 | 3300048915 | Ga0496112_0018433 | Ga0496112_0018433_1368_2063 | 231 |
| 554 | 3300048915 | Ga0496112_0103896 | Ga0496112_0103896_1459_2229 | 231 |
| 555 | 3300048915 | Ga0496112_0484326 | Ga0496112_0484326_424_1119 | 231 |
| 556 | 3300048916 | Ga0496113_0030732 | Ga0496113_0030732_995_1726 | 231 |
| 557 | 3300048916 | Ga0496113_0085238 | Ga0496113_0085238_1595_2365 | 231 |
| 558 | 3300048917 | Ga0496114_0013788 | Ga0496114_0013788_3321_4052 | 231 |
| 559 | 3300048917 | Ga0496114_0031526 | Ga0496114_0031526_397_1167 | 231 |
| 560 | 3300048918 | Ga0496115_0041290 | Ga0496115_0041290_2402_3133 | 231 |
| 561 | 3300048918 | Ga0496115_0157050 | Ga0496115_0157050_1057_1827 | 231 |
| 562 | 3300048919 | Ga0496116_0002981 | Ga0496116_0002981_11278_11973 | 231 |
| 563 | 3300048920 | Ga0496117_0031961 | Ga0496117_0031961_2854_3549 | 231 |
| 564 | 3300048920 | Ga0496117_0056787 | Ga0496117_0056787_390_1085 | 231 |
| 565 | 3300048920 | Ga0496117_0078028 | Ga0496117_0078028_1480_2175 | 231 |
| 566 | 3300048921 | Ga0496118_0017807 | Ga0496118_0017807_199_894 | 231 |
| 567 | 3300048921 | Ga0496118_0019373 | Ga0496118_0019373_2705_3400 | 231 |
| 568 | 3300048922 | Ga0496119_0143571 | Ga0496119_0143571_78_773 | 231 |
| 569 | 3300048923 | Ga0496120_0045674 | Ga0496120_0045674_44_739 | 231 |
| 570 | 3300048924 | Ga0496121_0000927 | Ga0496121_0000927_24186_24884 | 231 |
| 571 | 3300048924 | Ga0496121_0148404 | Ga0496121_0148404_493_1188 | 231 |
| 572 | 3300048924 | Ga0496121_0435364 | Ga0496121_0435364_71_766 | 231 |
| 573 | 3300048925 | Ga0496122_0021553 | Ga0496122_0021553_2553_3248 | 231 |
| 574 | 3300048925 | Ga0496122_0174725 | Ga0496122_0174725_583_1278 | 231 |
| 575 | 3300048926 | Ga0496123_0072850 | Ga0496123_0072850_673_1368 | 231 |
| 576 | 3300048926 | Ga0496123_0084827 | Ga0496123_0084827_573_1268 | 231 |
| 577 | 3300048927 | Ga0496124_0038116 | Ga0496124_0038116_886_1581 | 231 |
| 578 | 3300048927 | Ga0496124_0451036 | Ga0496124_0451036_149_844 | 231 |
| 579 | 3300048928 | Ga0496125_0003941 | Ga0496125_0003941_7202_7897 | 231 |
| 580 | 3300048928 | Ga0496125_0056844 | Ga0496125_0056844_1757_2452 | 231 |
| 581 | 3300048929 | Ga0496126_0006232 | Ga0496126_0006232_10933_11628 | 231 |
| 582 | 3300048929 | Ga0496126_0041131 | Ga0496126_0041131_3207_3902 | 231 |
| 583 | 3300048929 | Ga0496126_0109334 | Ga0496126_0109334_547_1242 | 231 |
| 584 | 3300048929 | Ga0496126_0202932 | Ga0496126_0202932_703_1398 | 231 |
| 585 | 3300048929 | Ga0496126_0300205 | Ga0496126_0300205_523_1218 | 231 |
| 586 | 3300048929 | Ga0496126_0447327 | Ga0496126_0447327_55_750 | 231 |
| 587 | 3300049568 | Ga0501031_0127006 | Ga0501031_0127006_614_1309 | 231 |
| 588 | 3300049570 | Ga0501033_0245167 | Ga0501033_0245167_485_1180 | 231 |
| 589 | 3300049571 | Ga0501034_0132424 | Ga0501034_0132424_675_1370 | 231 |
| 590 | 3300049581 | Ga0501047_0029826 | Ga0501047_0029826_1768_2463 | 231 |
| 591 | 3300049581 | Ga0501047_0032550 | Ga0501047_0032550_2746_3441 | 231 |
| 592 | 3300049586 | Ga0501070_0072317 | Ga0501070_0072317_1153_1848 | 231 |
| 593 | 3300049586 | Ga0501070_0541128 | Ga0501070_0541128_137_844 | 231 |
| 594 | 3300049589 | Ga0501073_0172852 | Ga0501073_0172852_214_909 | 231 |
| 595 | 3300049590 | Ga0501074_0048319 | Ga0501074_0048319_970_1665 | 231 |
| 596 | 3300049742 | Ga0501080_0049397 | Ga0501080_0049397_2946_3641 | 231 |
| 597 | 3300049822 | Ga0501035_0129494 | Ga0501035_0129494_1257_1952 | 231 |
| 598 | 3300050491 | nmdc:mga00v17_31785_c1 | nmdc:mga00v17_31785_c1_774_1469 | 231 |
| 599 | 3300050492 | nmdc:mga0yw44_154756_c1 | nmdc:mga0yw44_154756_c1_292_987 | 231 |
| 600 | 3300050492 | nmdc:mga0yw44_16705_c2 | nmdc:mga0yw44_16705_c2_766_1461 | 231 |
| 601 | 3300050511 | nmdc:mga08y16_401907_c1 | nmdc:mga08y16_401907_c1_662_1363 | 231 |
| 602 | 3300050514 | nmdc:mga08x19_93074_c1 | nmdc:mga08x19_93074_c1_1197_1892 | 231 |
| 603 | 3300050516 | nmdc:mga0sz30_8457_c1 | nmdc:mga0sz30_8457_c1_1979_2674 | 231 |
| 604 | 3300053079 | Ga0500610_0238015 | Ga0500610_0238015_59_754 | 231 |
| 605 | 3300053080 | Ga0500635_0018733 | Ga0500635_0018733_286_981 | 231 |
| 606 | 3300053080 | Ga0500635_0044873 | Ga0500635_0044873_508_1203 | 231 |
| 607 | 3300053080 | Ga0500635_0223493 | Ga0500635_0223493_17_712 | 231 |
| 608 | 3300053088 | Ga0500644_0008756 | Ga0500644_0008756_680_1375 | 231 |
| 609 | 3300053093 | Ga0500651_0015119 | Ga0500651_0015119_3671_4366 | 231 |
| 610 | 3300053094 | Ga0500566_0016743 | Ga0500566_0016743_3343_4038 | 231 |
| 611 | 3300053094 | Ga0500566_0212795 | Ga0500566_0212795_200_895 | 231 |
| 612 | 3300053096 | Ga0500641_0113174 | Ga0500641_0113174_462_1157 | 231 |
| 613 | 3300053098 | Ga0500650_0004546 | Ga0500650_0004546_459_1154 | 231 |
| 614 | 3300053102 | Ga0500554_009268 | Ga0500554_009268_1241_1936 | 231 |
| 615 | 3300053102 | Ga0500554_009322 | Ga0500554_009322_176_871 | 231 |
| 616 | 3300053104 | Ga0500556_0000029 | Ga0500556_0000029_55975_56670 | 231 |
| 617 | 3300053111 | Ga0500572_000876 | Ga0500572_000876_4347_5042 | 231 |
| 618 | 3300053116 | Ga0500592_000648 | Ga0500592_000648_3367_4062 | 231 |
| 619 | 3300053118 | Ga0500594_0005769 | Ga0500594_0005769_1356_2051 | 231 |
| 620 | 3300053119 | Ga0500595_001029 | Ga0500595_001029_9439_10134 | 231 |
| 621 | 3300053119 | Ga0500595_003049 | Ga0500595_003049_5847_6545 | 231 |
| 622 | 3300053119 | Ga0500595_010338 | Ga0500595_010338_1084_1863 | 231 |
| 623 | 3300053121 | Ga0500607_025602 | Ga0500607_025602_45_740 | 231 |
| 624 | 3300053130 | Ga0500642_0000020 | Ga0500642_0000020_57705_58400 | 231 |
| 625 | 3300053131 | Ga0500652_000227 | Ga0500652_000227_12804_13499 | 231 |
| 626 | 3300053136 | Ga0500559_0001175 | Ga0500559_0001175_2923_3618 | 231 |
| 627 | 3300053136 | Ga0500559_0005368 | Ga0500559_0005368_481_1176 | 231 |
| 628 | 3300053139 | Ga0500568_0013591 | Ga0500568_0013591_1807_2535 | 231 |
| 629 | 3300053145 | Ga0500586_001025 | Ga0500586_001025_308_1003 | 231 |
| 630 | 3300053150 | Ga0500603_000764 | Ga0500603_000764_847_1542 | 231 |
| 631 | 3300053153 | Ga0500616_0000112 | Ga0500616_0000112_58157_58852 | 231 |
| 632 | 3300053156 | Ga0500622_0001493 | Ga0500622_0001493_7490_8185 | 231 |
| 633 | 3300053177 | Ga0500636_0001494 | Ga0500636_0001494_1349_2044 | 231 |
| 634 | 3300053177 | Ga0500636_0267473 | Ga0500636_0267473_36_731 | 231 |
| 635 | 3300053178 | Ga0500637_0002741 | Ga0500637_0002741_6375_7070 | 231 |
| 636 | 3300053178 | Ga0500637_0041163 | Ga0500637_0041163_1700_2395 | 231 |
| 637 | 3300053178 | Ga0500637_0090699 | Ga0500637_0090699_616_1311 | 231 |
| 638 | 3300053723 | Ga0500567_171323 | Ga0500567_171323_21_716 | 231 |
| 639 | 3300053735 | Ga0500596_003575 | Ga0500596_003575_1393_2088 | 231 |
| 640 | iso_pu_bacteria | 2508501128 | 2509146609 | 231 |
| 641 | 3300003215 | JGI25153J46596_10038959 | JGI25153J46596_100389591 | 232 |
| 642 | 3300005548 | Ga0070665_100008468 | Ga0070665_10000846812 | 232 |
| 643 | 3300006944 | Ga0099823_1004804 | Ga0099823_100480412 | 232 |
| 644 | 3300025253 | Ga0209677_100991 | Ga0209677_10099114 | 232 |
| 645 | 3300028379 | Ga0268266_10024242 | Ga0268266_100242423 | 232 |
| 646 | 3300028381 | Ga0268264_10716668 | Ga0268264_107166681 | 232 |
| 647 | 3300037418 | Ga0395900_0193035 | Ga0395900_0193035_700_1398 | 232 |
| 648 | 3300037471 | Ga0395905_0032137 | Ga0395905_0032137_55_768 | 232 |
| 649 | 3300044765 | Ga0466970_0145823 | Ga0466970_0145823_578_1276 | 232 |
| 650 | 3300044901 | Ga0466960_0033755 | Ga0466960_0033755_1625_2323 | 232 |
| 651 | 3300047472 | Ga0495686_0077183 | Ga0495686_0077183_116_829 | 232 |
| 652 | 3300053094 | Ga0500566_0015016 | Ga0500566_0015016_3666_4364 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yam-assembly2.cif.gz_D | crystal structure of lige-apo form from sphingobium sp. strain syk-6 | 0.9009 | 2 | 231 |
| 6j3f-assembly1.cif.gz_B | crystal structure of the glutathione s-transferase, csgst63524, of ceriporiopsis subvermispora in complex with glutathione | 0.8934 | 1 | 221 |
| 4yam-assembly2.cif.gz_D | crystal structure of lige-apo form from sphingobium sp. strain syk-6 | 0.89 | 2 | 231 |
| 6j3f-assembly1.cif.gz_B | crystal structure of the glutathione s-transferase, csgst63524, of ceriporiopsis subvermispora in complex with glutathione | 0.8504 | 1 | 221 |
| 4o7h-assembly1.cif.gz_A | crystal structure of a glutathione s-transferase from rhodospirillum rubrum f11, target efi-507460 | 0.8061 | 3 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0JER7_1_73_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8871 | 19 | 86 | 3.40.30.10 |
| af_B6U5S1_5_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8803 | 2 | 84 | 3.40.30.10 |
| 4isdD01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8707 | 1 | 81 | 3.40.30.10 |
| 4lmwA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8679 | 1 | 87 | 3.40.30.10 |
| af_Q9FHX0_75_159_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8646 | 2 | 80 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3PUU6-F1-model_v4 | LigE protein | 0.9998 | 1 | 232 |
GO:0005737
|
| AF-A0A2U3PT86-F1-model_v4 | LigE protein | 0.9995 | 1 | 232 |
GO:0005737
|
| AF-A0A7Y9UE98-F1-model_v4 | Glutathione S-transferase (EC 2.5.1.18) | 0.9993 | 1 | 232 |
GO:0004364
GO:0005737 GO:0006749 GO:0045174 |
| AF-A0A1X3HCQ7-F1-model_v4 | Glutathione S-transferase | 0.999 | 1 | 232 |
GO:0005737
GO:0016740 |
| AF-A0A5S4WU61-F1-model_v4 | Glutathione S-transferase family protein | 0.9988 | 1 | 232 |
GO:0004364
GO:0005737 GO:0006749 GO:0045174 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar