F472663

General Info

Members Datasets Scaffolds Average Seq Length
652 425 532 233

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100420255|Ga0070674_1004202552
Length 263
Sequence MSLKLFELVGTDASRPFSPFCWRTRMALAHKGLSAETIPWCFTDKPAIAPHGSEKVPVLLDDDTAVVDSWTIANHLEDRYPDRPSLFGGEGGRAVGRMLNWWGDGLIGGMFPLIIADIPLNLKPDDAAYFRRTREARFKRPLEEVMADRDKAVEGFRKSLDPLRLTLKTQAFLGGAAPNYADDIVFGAFQWARVVSPFKLLAEDDPVYAWRERLLDAFDGLARKVAELPRLTSAAPRCGRNGDIGGCNDRQRLRGHAPSRSFN

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2643221651 Afipia sp. Root123D2 Isolate Unclassified
13 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
14 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
15 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
16 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
17 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
18 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
19 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
20 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
21 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
22 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
23 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
24 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
25 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
26 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
27 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
28 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
29 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
30 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
31 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
32 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
33 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
34 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
35 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
36 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
37 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
38 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
39 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
40 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
41 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
42 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
43 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
44 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
45 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
46 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
47 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
48 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
49 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
50 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
51 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
52 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
53 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
54 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
55 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
56 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
57 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
58 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
59 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
60 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
61 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
62 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
63 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
64 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
65 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
66 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
67 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
68 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
69 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
70 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
71 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
72 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
73 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
74 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
75 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
76 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
77 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
78 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
79 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
80 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
81 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
82 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
83 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
84 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
85 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
86 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
87 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
88 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
89 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
90 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
91 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
92 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
93 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
94 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
95 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
97 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
98 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
101 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
102 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
103 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
104 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
105 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
106 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
107 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
108 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
109 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
110 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
111 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
112 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
117 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
118 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
119 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
128 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
134 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
135 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
136 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
140 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
141 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
142 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
143 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
144 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
145 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
146 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
147 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
148 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
149 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
150 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
151 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
152 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
154 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
155 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
156 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
160 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
161 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
162 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
166 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
178 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
179 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
180 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
181 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
182 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
237 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
238 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
263 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
355 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
366 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
369 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
370 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
375 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
376 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
379 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
380 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
383 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
384 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
385 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
386 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
387 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
388 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
389 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
390 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
391 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
392 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
393 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
394 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
397 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
398 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
399 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
400 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
401 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
402 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
403 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
404 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
405 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
406 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
407 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
408 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
409 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
410 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
411 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
412 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
413 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
414 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
415 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
416 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
417 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
418 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
419 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
420 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
421 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
422 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
423 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
424 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
425 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.72
Metatranscriptomes 0
Isolates 18.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.12
Nodule 14.42
Rhizoplane 7.52
Rhizosphere 54.29
Stem 0
Stem Tuber 0
Unclassified 11.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10038959 3300003215 Bacteria 1491
2 JGI25404J52841_10001888 3300003659 Unclassified 3831
3 Ga0065712_10244589 3300005290 Bacteria 932
4 Ga0070676_10114933 3300005328 Bacteria 1681
5 Ga0070683_100083841 3300005329 Bacteria 2986
6 Ga0070690_100474184 3300005330 Bacteria 932
7 Ga0070666_10421842 3300005335 Bacteria 961
8 Ga0068868_100042710 3300005338 Bacteria 3539
9 Ga0068868_100060031 3300005338 Bacteria 3009
10 Ga0068868_100656136 3300005338 Bacteria 935
11 Ga0070661_100067210 3300005344 Bacteria 2634
12 Ga0070668_100292083 3300005347 Bacteria 1365
13 Ga0070674_100420255 3300005356 Bacteria 1097
14 Ga0070673_100532200 3300005364 Bacteria 1066
15 Ga0070659_100656581 3300005366 Bacteria 904
16 Ga0070709_10003877 3300005434 Bacteria 8059
17 Ga0070714_100002400 3300005435 Bacteria 13793
18 Ga0070714_100026447 3300005435 Bacteria 4796
19 Ga0070714_100212405 3300005435 Bacteria 1774
20 Ga0070714_100413579 3300005435 Bacteria 1277
21 Ga0070713_100013610 3300005436 Bacteria 6015
22 Ga0070713_100066523 3300005436 Bacteria 3031
23 Ga0070713_100409671 3300005436 Bacteria 1267
24 Ga0070710_10011512 3300005437 Bacteria 4371
25 Ga0070710_10051623 3300005437 Bacteria 2309
26 Ga0070711_100032102 3300005439 Bacteria 3489
27 Ga0070711_100139720 3300005439 Bacteria 1814
28 Ga0070711_100153290 3300005439 Bacteria 1740
29 Ga0070700_100155547 3300005441 Bacteria 1568
30 Ga0070663_100049222 3300005455 Bacteria 2991
31 Ga0070663_100091376 3300005455 Bacteria 2255
32 Ga0070663_100193042 3300005455 Bacteria 1586
33 Ga0070663_100483433 3300005455 Bacteria 1025
34 Ga0070678_100044155 3300005456 Bacteria 3181
35 Ga0070678_100172718 3300005456 Bacteria 1762
36 Ga0070662_100047414 3300005457 Bacteria 3091
37 Ga0070698_100026383 3300005471 Bacteria 6047
38 Ga0070699_100128562 3300005518 Bacteria 2232
39 Ga0070679_100523308 3300005530 Bacteria 1130
40 Ga0070697_100347379 3300005536 Bacteria 1281
41 Ga0070665_100008468 3300005548 Bacteria 10406
42 Ga0070665_100015135 3300005548 Bacteria 7743
43 Ga0070665_100042136 3300005548 Bacteria 4589
44 Ga0070665_100108212 3300005548 Bacteria 2782
45 Ga0070665_100213535 3300005548 Bacteria 1930
46 Ga0070664_100675758 3300005564 Bacteria 961
47 Ga0068854_100284844 3300005578 Bacteria 1332
48 Ga0068856_100025081 3300005614 Bacteria 5810
49 Ga0068856_100261325 3300005614 Bacteria 1747
50 Ga0068856_100693134 3300005614 Bacteria 1039
51 Ga0070702_100275393 3300005615 Bacteria 1153
52 Ga0068859_100061016 3300005617 Bacteria 3799
53 Ga0068864_100075214 3300005618 Bacteria 2948
54 Ga0068864_100273776 3300005618 Bacteria 1574
55 Ga0068866_10141008 3300005718 Bacteria 1383
56 Ga0068861_100054256 3300005719 Bacteria 3053
57 Ga0068861_100343230 3300005719 Bacteria 1307
58 Ga0068863_100110330 3300005841 Bacteria 2620
59 Ga0068858_100411470 3300005842 Bacteria 1300
60 Ga0068860_100053416 3300005843 Bacteria 3841
61 Ga0068860_100100200 3300005843 Bacteria 2763
62 Ga0068862_100099944 3300005844 Bacteria 2536
63 Ga0068862_100338703 3300005844 Bacteria 1392
64 Ga0081455_10022998 3300005937 Bacteria 5811
65 Ga0081540_1001462 3300005983 Bacteria 20401
66 Ga0081540_1003095 3300005983 Bacteria 13322
67 Ga0081540_1004104 3300005983 Bacteria 11240
68 Ga0081540_1004610 3300005983 Bacteria 10431
69 Ga0081540_1027653 3300005983 Bacteria 3207
70 Ga0070717_10006671 3300006028 Bacteria 8512
71 Ga0070717_10037568 3300006028 Bacteria 3933
72 Ga0075365_10236458 3300006038 Bacteria 1283
73 Ga0075363_100000680 3300006048 Bacteria 11427
74 Ga0075363_100095017 3300006048 Bacteria 1644
75 Ga0075363_100115001 3300006048 Bacteria 1498
76 Ga0075364_10010772 3300006051 Bacteria 5531
77 Ga0075364_10123240 3300006051 Bacteria 1736
78 Ga0070715_10019909 3300006163 Bacteria 2580
79 Ga0070716_100127202 3300006173 Bacteria 1605
80 Ga0070712_100002146 3300006175 Bacteria 12130
81 Ga0070712_100017104 3300006175 Bacteria 4689
82 Ga0070712_100069089 3300006175 Bacteria 2519
83 Ga0075362_10185222 3300006177 Bacteria 1010
84 Ga0075367_10095026 3300006178 Bacteria 1818
85 Ga0075367_10205996 3300006178 Bacteria 1229
86 Ga0075369_10005761 3300006186 Bacteria 4652
87 Ga0075366_10131820 3300006195 Bacteria 1508
88 Ga0075370_10007368 3300006353 Bacteria 5602
89 Ga0075370_10018197 3300006353 Bacteria 3808
90 Ga0068871_100081794 3300006358 Bacteria 2677
91 Ga0075433_10845213 3300006852 Bacteria 799
92 Ga0075434_100379761 3300006871 Bacteria 1434
93 Ga0068865_100048318 3300006881 Bacteria 2928
94 Ga0075436_100052807 3300006914 Bacteria 2805
95 Ga0075436_100108224 3300006914 Bacteria 1939
96 Ga0097620_100061013 3300006931 Bacteria 3799
97 Ga0099823_1004804 3300006944 Bacteria 13310
98 Ga0075435_100316466 3300007076 Bacteria 1336
99 Ga0099794_10118282 3300007265 Bacteria 1332
100 Ga0099795_10005305 3300007788 Bacteria 3413
101 Ga0099795_10028541 3300007788 Bacteria 1898
102 Ga0099795_10028831 3300007788 Bacteria 1892
103 Ga0105240_10080848 3300009093 Bacteria 3995
104 Ga0105240_10355506 3300009093 Bacteria 1661
105 Ga0111539_10281499 3300009094 Bacteria 1935
106 Ga0105247_10038309 3300009101 Bacteria 2926
107 Ga0105247_10519229 3300009101 Bacteria 871
108 Ga0105243_10075123 3300009148 Bacteria 2742
109 Ga0105241_10047563 3300009174 Bacteria 3262
110 Ga0105241_10068508 3300009174 Bacteria 2750
111 Ga0105242_10089639 3300009176 Bacteria 2586
112 Ga0105242_10158533 3300009176 Bacteria 1979
113 Ga0105248_10069294 3300009177 Bacteria 3960
114 Ga0105237_10616336 3300009545 Bacteria 1092
115 Ga0105249_10030441 3300009553 Bacteria 4879
116 Ga0105249_10363467 3300009553 Bacteria 1469
117 Ga0099796_10006541 3300010159 Bacteria 2990
118 Ga0099796_10010931 3300010159 Bacteria 2514
119 Ga0099796_10021110 3300010159 Bacteria 2001
120 Ga0099796_10093418 3300010159 Bacteria 1121
121 Ga0105239_10059371 3300010375 Bacteria 4197
122 Ga0105239_10067144 3300010375 Bacteria 3939
123 Ga0105239_10086663 3300010375 Bacteria 3452
124 Ga0105239_10144870 3300010375 Bacteria 2649
125 Ga0105239_10694130 3300010375 Bacteria 1164
126 Ga0105239_10901000 3300010375 Bacteria 1015
127 Ga0105246_10009096 3300011119 Bacteria 6117
128 Ga0105246_10066091 3300011119 Bacteria 2531
129 Ga0157374_10015314 3300013296 Bacteria 6725
130 Ga0157374_10229435 3300013296 Bacteria 1823
131 Ga0163162_10025914 3300013306 Bacteria 5795
132 Ga0157375_10057754 3300013308 Bacteria 3836
133 Ga0157375_10153627 3300013308 Bacteria 2439
134 Ga0163163_10070756 3300014325 Bacteria 3475
135 Ga0163163_10099788 3300014325 Bacteria 2925
136 Ga0163163_10991486 3300014325 Bacteria 903
137 Ga0157380_10042815 3300014326 Bacteria 3541
138 Ga0157380_10082126 3300014326 Unclassified 2637
139 Ga0182008_10075648 3300014497 Bacteria 1656
140 Ga0157379_10160337 3300014968 Bacteria 2030
141 Ga0157376_10005988 3300014969 Bacteria 8545
142 Ga0157376_10107194 3300014969 Bacteria 2452
143 Ga0157376_10339132 3300014969 Bacteria 1435
144 Ga0213873_10074724 3300021358 Bacteria 939
145 Ga0213872_10113163 3300021361 Bacteria 1204
146 Ga0213874_10062906 3300021377 Bacteria 1167
147 Ga0213875_10000011 3300021388 Bacteria 332447
148 Ga0213875_10000480 3300021388 Bacteria 34004
149 Ga0213875_10002319 3300021388 Bacteria 11514
150 Ga0213871_10014576 3300021441 Bacteria 1867
151 Ga0209677_100991 3300025253 Bacteria 13698
152 Ga0209677_102002 3300025253 Bacteria 8106
153 Ga0209233_1003959 3300025261 Bacteria 5131
154 Ga0209564_1000397 3300025295 Bacteria 77778
155 Ga0207697_10058291 3300025315 Bacteria 1604
156 Ga0207697_10089141 3300025315 Bacteria 1306
157 Ga0207692_10012176 3300025898 Bacteria 3687
158 Ga0207692_10126262 3300025898 Bacteria 1439
159 Ga0207642_10078429 3300025899 Bacteria 1596
160 Ga0207642_10253003 3300025899 Bacteria 1001
161 Ga0207710_10093872 3300025900 Bacteria 1408
162 Ga0207688_10227034 3300025901 Bacteria 1126
163 Ga0207699_10037669 3300025906 Unclassified 2766
164 Ga0207699_10067760 3300025906 Bacteria 2171
165 Ga0207645_10037451 3300025907 Bacteria 3112
166 Ga0207705_10033478 3300025909 Bacteria 3671
167 Ga0207707_10245404 3300025912 Bacteria 1556
168 Ga0207707_10543706 3300025912 Bacteria 987
169 Ga0207693_10002609 3300025915 Bacteria 15668
170 Ga0207693_10028370 3300025915 Bacteria 4422
171 Ga0207693_10085965 3300025915 Bacteria 2464
172 Ga0207693_10481881 3300025915 Bacteria 969
173 Ga0207663_10005220 3300025916 Bacteria 6536
174 Ga0207649_10204128 3300025920 Bacteria 1398
175 Ga0207652_10361797 3300025921 Bacteria 1310
176 Ga0207646_10077708 3300025922 Bacteria 2966
177 Ga0207694_10040558 3300025924 Bacteria 3585
178 Ga0207659_10194451 3300025926 Bacteria 1616
179 Ga0207659_10671919 3300025926 Bacteria 886
180 Ga0207687_10012936 3300025927 Bacteria 5454
181 Ga0207700_10019561 3300025928 Bacteria 4575
182 Ga0207700_10206584 3300025928 Unclassified 1658
183 Ga0207700_10215507 3300025928 Unclassified 1625
184 Ga0207664_10025742 3300025929 Bacteria 4437
185 Ga0207664_10038577 3300025929 Bacteria 3705
186 Ga0207664_10106974 3300025929 Bacteria 2320
187 Ga0207664_10110197 3300025929 Bacteria 2289
188 Ga0207664_10346465 3300025929 Unclassified 1314
189 Ga0207664_10453600 3300025929 Bacteria 1145
190 Ga0207644_10252591 3300025931 Bacteria 1407
191 Ga0207690_10553710 3300025932 Bacteria 935
192 Ga0207706_10026773 3300025933 Bacteria 5161
193 Ga0207686_10221627 3300025934 Bacteria 1366
194 Ga0207709_10135121 3300025935 Bacteria 1687
195 Ga0207670_10142712 3300025936 Bacteria 1767
196 Ga0207669_10009924 3300025937 Bacteria 4559
197 Ga0207704_10100374 3300025938 Bacteria 1928
198 Ga0207665_10023995 3300025939 Bacteria 4019
199 Ga0207665_10055525 3300025939 Bacteria 2672
200 Ga0207665_10094022 3300025939 Bacteria 2082
201 Ga0207665_10184925 3300025939 Bacteria 1511
202 Ga0207691_10091519 3300025940 Bacteria 2725
203 Ga0207711_10099749 3300025941 Bacteria 2568
204 Ga0207689_10056672 3300025942 Bacteria 3225
205 Ga0207689_10480185 3300025942 Bacteria 1040
206 Ga0207661_10052779 3300025944 Bacteria 3250
207 Ga0207679_10102978 3300025945 Bacteria 2236
208 Ga0207651_10598823 3300025960 Bacteria 963
209 Ga0207712_10161695 3300025961 Bacteria 1741
210 Ga0207712_10285906 3300025961 Bacteria 1348
211 Ga0207668_10131577 3300025972 Bacteria 1911
212 Ga0207677_10062898 3300026023 Bacteria 2577
213 Ga0207703_10451093 3300026035 Bacteria 1201
214 Ga0207678_10004916 3300026067 Bacteria 12003
215 Ga0207678_10015307 3300026067 Bacteria 6746
216 Ga0207678_10025216 3300026067 Bacteria 5190
217 Ga0207678_10095014 3300026067 Bacteria 2547
218 Ga0207678_10265681 3300026067 Bacteria 1471
219 Ga0207708_10255226 3300026075 Bacteria 1414
220 Ga0207708_10290064 3300026075 Bacteria 1328
221 Ga0207702_10071413 3300026078 Bacteria 2989
222 Ga0207702_10615743 3300026078 Bacteria 1066
223 Ga0207641_10313628 3300026088 Bacteria 1485
224 Ga0207648_10051602 3300026089 Bacteria 3595
225 Ga0207648_10431007 3300026089 Bacteria 1198
226 Ga0207676_10008501 3300026095 Bacteria 7300
227 Ga0207676_10063964 3300026095 Bacteria 2923
228 Ga0207674_10196401 3300026116 Bacteria 1967
229 Ga0207675_100068830 3300026118 Bacteria 3308
230 Ga0207683_10008816 3300026121 Bacteria 8607
231 Ga0207683_10051830 3300026121 Bacteria 3595
232 Ga0207683_10699674 3300026121 Bacteria 939
233 Ga0207428_10260382 3300027907 Bacteria 1292
234 Ga0268266_10006857 3300028379 Bacteria 10370
235 Ga0268266_10024242 3300028379 Bacteria 5163
236 Ga0268266_10601225 3300028379 Bacteria 1056
237 Ga0268265_10111732 3300028380 Bacteria 2232
238 Ga0268264_10045022 3300028381 Bacteria 3663
239 Ga0268264_10686124 3300028381 Bacteria 1016
240 Ga0268264_10716668 3300028381 Bacteria 994
241 Ga0265334_10025685 3300028573 Bacteria 2383
242 Ga0265328_10048818 3300031239 Bacteria 1555
243 Ga0316575_10089195 3300031665 Bacteria 1248
244 Ga0307409_100119359 3300031995 Bacteria 2229
245 Ga0307409_100269743 3300031995 Bacteria 1566
246 Ga0307415_100021174 3300032126 Bacteria 3990
247 Ga0307415_100247425 3300032126 Bacteria 1446
248 Ga0307415_100711575 3300032126 Bacteria 907
249 Ga0373930_0010637 3300034816 Unclassified 1649
250 Ga0373938_0051523 3300034957 Bacteria 941
251 Ga0373934_0036382 3300035086 Unclassified 1939
252 Ga0373941_0141572 3300035115 Unclassified 875
253 Ga0373945_0135081 3300035116 Bacteria 991
254 Ga0373956_0055684 3300035119 Bacteria 1784
255 Ga0373956_0129969 3300035119 Bacteria 1179
256 Ga0373960_0031327 3300035121 Unclassified 1487
257 Ga0373943_0129611 3300035170 Bacteria 1349
258 Ga0373931_0019943 3300035691 Bacteria 3350
259 Ga0373931_0198817 3300035691 Unclassified 1196
260 Ga0373935_0391751 3300035692 Bacteria 996
261 Ga0373927_0026463 3300035695 Bacteria 3791
262 Ga0373933_0308472 3300035724 Bacteria 1025
263 Ga0373937_0048835 3300036401 Bacteria 3874
264 Ga0373937_0079077 3300036401 Bacteria 3039
265 Ga0373937_0557001 3300036401 Bacteria 1089
266 Ga0373937_0558471 3300036401 Bacteria 1087
267 Ga0373925_0176925 3300037068 Bacteria 1687
268 Ga0395899_0179696 3300037312 Bacteria 1486
269 Ga0395900_0124721 3300037418 Bacteria 2641
270 Ga0395900_0193035 3300037418 Bacteria 2065
271 Ga0395898_0094516 3300037466 Bacteria 2873
272 Ga0395905_0032137 3300037471 Bacteria 4937
273 Ga0395905_0317645 3300037471 Bacteria 1447
274 Ga0436364_0010042 3300037853 Bacteria 102214
275 Ga0436364_0151134 3300037853 Bacteria 972
276 Ga0436364_0232280 3300037853 Bacteria 88632
277 Ga0436364_0616684 3300037853 Bacteria 34041
278 Ga0436364_0887813 3300037853 Bacteria 1998
279 Ga0436364_0960005 3300037853 Bacteria 2630
280 Ga0436364_1224135 3300037853 Bacteria 88093
281 Ga0395901_0015566 3300038443 Bacteria 7747
282 Ga0395901_0382188 3300038443 Bacteria 1449
283 Ga0436365_1051823 3300039437 Bacteria 3339
284 Ga0436365_1917762 3300039437 Bacteria 904
285 Ga0436360_0135729 3300039438 Bacteria 1339
286 Ga0436360_0285178 3300039438 Bacteria 1429
287 Ga0436360_0372949 3300039438 Bacteria 1326
288 Ga0436360_0381517 3300039438 Bacteria 1372
289 Ga0436360_1299321 3300039438 Unclassified 924
290 Ga0436361_0240505 3300039447 Bacteria 1370
291 Ga0436363_0956567 3300039450 Bacteria 2265
292 Ga0436363_1095549 3300039450 Bacteria 4623
293 Ga0436363_1389662 3300039450 Bacteria 2702
294 Ga0436362_0351741 3300039453 Bacteria 3061
295 Ga0436362_0533801 3300039453 Bacteria 3927
296 Ga0436362_0621117 3300039453 Bacteria 2053
297 Ga0436362_0825752 3300039453 Bacteria 866
298 Ga0436362_1206919 3300039453 Bacteria 1105
299 Ga0451791_0231185 3300041451 Bacteria 901
300 Ga0466970_0145823 3300044765 Bacteria 1306
301 Ga0466960_0033755 3300044901 Bacteria 2380
302 Ga0495592_0323100 3300046454 Bacteria 997
303 Ga0495603_0011792 3300046455 Bacteria 5291
304 Ga0495603_0053912 3300046455 Bacteria 2385
305 Ga0495638_0047605 3300046460 Bacteria 2687
306 Ga0495638_0120423 3300046460 Bacteria 1551
307 Ga0495651_0067205 3300046462 Bacteria 2735
308 Ga0495650_0082850 3300046471 Bacteria 1234
309 Ga0495580_0396492 3300046472 Bacteria 931
310 Ga0495605_0140721 3300046474 Bacteria 1083
311 Ga0495605_0152741 3300046474 Bacteria 1029
312 Ga0495664_0105598 3300046477 Bacteria 1698
313 Ga0495584_0141793 3300046491 Bacteria 1220
314 Ga0495585_0055858 3300046492 Bacteria 2181
315 Ga0495596_0039854 3300046500 Bacteria 1855
316 Ga0495607_0000007 3300046501 Bacteria 272517
317 Ga0495583_0069063 3300046506 Bacteria 1557
318 Ga0495610_0018929 3300046512 Bacteria 3870
319 Ga0495616_0047660 3300046513 Bacteria 2157
320 Ga0495616_0053634 3300046513 Bacteria 2003
321 Ga0495620_0024529 3300046515 Bacteria 2867
322 Ga0495620_0065975 3300046515 Bacteria 1492
323 Ga0495631_0011197 3300046518 Bacteria 4418
324 Ga0495631_0060301 3300046518 Bacteria 1646
325 Ga0495632_0032104 3300046519 Bacteria 2708
326 Ga0495632_0167237 3300046519 Bacteria 1011
327 Ga0495644_0011772 3300046523 Bacteria 3367
328 Ga0495644_0016014 3300046523 Bacteria 2873
329 Ga0495648_0070221 3300046524 Bacteria 2036
330 Ga0495648_0087547 3300046524 Bacteria 1753
331 Ga0495648_0201016 3300046524 Bacteria 997
332 Ga0495663_0050265 3300046525 Bacteria 1289
333 Ga0495663_0100623 3300046525 Bacteria 951
334 Ga0495642_0024956 3300046528 Bacteria 2367
335 Ga0495609_0082791 3300046538 Bacteria 1401
336 Ga0495622_0073983 3300046557 Bacteria 1571
337 Ga0495668_0018733 3300046616 Bacteria 4001
338 Ga0495668_0059067 3300046616 Bacteria 2116
339 Ga0495668_0085120 3300046616 Bacteria 1734
340 Ga0495668_0232173 3300046616 Bacteria 1010
341 Ga0495611_0022187 3300046648 Bacteria 2746
342 Ga0495611_0139750 3300046648 Bacteria 1131
343 Ga0495635_0389154 3300046663 Bacteria 927
344 Ga0495659_0023543 3300046664 Bacteria 2093
345 Ga0495659_0048013 3300046664 Bacteria 1545
346 Ga0495657_0174775 3300046675 Bacteria 1321
347 Ga0495647_0083878 3300046681 Bacteria 1296
348 Ga0495669_0002970 3300046684 Bacteria 6968
349 Ga0495669_0039616 3300046684 Bacteria 2086
350 Ga0495669_0121906 3300046684 Bacteria 1222
351 Ga0495670_0038253 3300046691 Bacteria 2392
352 Ga0495670_0119499 3300046691 Bacteria 1368
353 Ga0495671_0049040 3300046692 Bacteria 2105
354 Ga0495649_0087417 3300046694 Bacteria 1663
355 Ga0495589_0060910 3300046794 Bacteria 1853
356 Ga0495600_0061389 3300046809 Bacteria 2455
357 Ga0495581_0184414 3300047315 Bacteria 1221
358 Ga0495581_0203681 3300047315 Bacteria 1157
359 Ga0495604_0409508 3300047317 Bacteria 892
360 Ga0495636_0029940 3300047318 Bacteria 2224
361 Ga0495675_0451184 3300047444 Bacteria 744
362 Ga0495677_0025799 3300047445 Bacteria 2132
363 Ga0495685_073006 3300047447 Bacteria 1148
364 Ga0495673_0055712 3300047469 Bacteria 1714
365 Ga0495681_0146919 3300047470 Bacteria 992
366 Ga0495686_0077183 3300047472 Bacteria 2040
367 Ga0495626_0086188 3300048091 Bacteria 1388
368 Ga0496100_0046421 3300048903 Bacteria 2793
369 Ga0496100_0254310 3300048903 Bacteria 1300
370 Ga0496100_0913838 3300048903 Bacteria 689
371 Ga0496102_0002173 3300048905 Bacteria 16844
372 Ga0496102_0070854 3300048905 Bacteria 3201
373 Ga0496102_0086365 3300048905 Bacteria 2897
374 Ga0496102_0142725 3300048905 Bacteria 2246
375 Ga0496103_0038357 3300048906 Bacteria 2939
376 Ga0496103_0182523 3300048906 Bacteria 1349
377 Ga0496103_0291695 3300048906 Bacteria 1049
378 Ga0496104_0031262 3300048907 Bacteria 4950
379 Ga0496104_0292055 3300048907 Bacteria 1543
380 Ga0496104_0599746 3300048907 Bacteria 1011
381 Ga0496105_0007814 3300048908 Bacteria 8300
382 Ga0496105_0107803 3300048908 Bacteria 2300
383 Ga0496105_0170813 3300048908 Bacteria 1782
384 Ga0496106_0003947 3300048909 Bacteria 11081
385 Ga0496106_0050798 3300048909 Bacteria 3125
386 Ga0496106_0096539 3300048909 Bacteria 2287
387 Ga0496107_0002755 3300048910 Bacteria 11565
388 Ga0496107_0023427 3300048910 Bacteria 4365
389 Ga0496108_0044462 3300048911 Bacteria 3707
390 Ga0496108_0060454 3300048911 Bacteria 3188
391 Ga0496109_0030271 3300048912 Bacteria 4852
392 Ga0496109_0050679 3300048912 Bacteria 3780
393 Ga0496110_0028973 3300048913 Bacteria 4760
394 Ga0496110_0035330 3300048913 Bacteria 4336
395 Ga0496110_0360028 3300048913 Bacteria 1325
396 Ga0496111_0247491 3300048914 Bacteria 1323
397 Ga0496111_0315364 3300048914 Bacteria 1158
398 Ga0496111_0410030 3300048914 Bacteria 1001
399 Ga0496112_0000023 3300048915 Bacteria 156144
400 Ga0496112_0009639 3300048915 Bacteria 8713
401 Ga0496112_0018433 3300048915 Bacteria 6572
402 Ga0496112_0103896 3300048915 Bacteria 2811
403 Ga0496112_0484326 3300048915 Unclassified 1173
404 Ga0496113_0030732 3300048916 Bacteria 3890
405 Ga0496113_0085238 3300048916 Bacteria 2426
406 Ga0496113_0435732 3300048916 Bacteria 1053
407 Ga0496114_0013788 3300048917 Bacteria 6478
408 Ga0496114_0031526 3300048917 Bacteria 4361
409 Ga0496114_0060221 3300048917 Bacteria 3173
410 Ga0496115_0041290 3300048918 Bacteria 3670
411 Ga0496115_0144035 3300048918 Bacteria 1966
412 Ga0496115_0157050 3300048918 Bacteria 1879
413 Ga0496115_0511624 3300048918 Bacteria 964
414 Ga0496115_0639337 3300048918 Bacteria 842
415 Ga0496116_0002981 3300048919 Bacteria 17210
416 Ga0496116_0178608 3300048919 Bacteria 1140
417 Ga0496117_0031961 3300048920 Bacteria 4009
418 Ga0496117_0056787 3300048920 Bacteria 2723
419 Ga0496117_0078028 3300048920 Bacteria 2188
420 Ga0496118_0017807 3300048921 Bacteria 6447
421 Ga0496118_0019373 3300048921 Bacteria 6083
422 Ga0496118_0262790 3300048921 Bacteria 973
423 Ga0496119_0143571 3300048922 Bacteria 1286
424 Ga0496120_0045674 3300048923 Bacteria 2536
425 Ga0496120_0121961 3300048923 Bacteria 1346
426 Ga0496121_0000927 3300048924 Bacteria 53016
427 Ga0496121_0023355 3300048924 Bacteria 5959
428 Ga0496121_0108275 3300048924 Bacteria 2126
429 Ga0496121_0148404 3300048924 Bacteria 1729
430 Ga0496121_0435364 3300048924 Bacteria 849
431 Ga0496122_0021553 3300048925 Bacteria 5763
432 Ga0496122_0174725 3300048925 Bacteria 1289
433 Ga0496123_0072850 3300048926 Bacteria 2134
434 Ga0496123_0084827 3300048926 Bacteria 1908
435 Ga0496124_0038116 3300048927 Bacteria 4175
436 Ga0496124_0331242 3300048927 Bacteria 1086
437 Ga0496124_0451036 3300048927 Bacteria 877
438 Ga0496124_0530107 3300048927 Bacteria 782
439 Ga0496125_0003941 3300048928 Bacteria 17516
440 Ga0496125_0056844 3300048928 Bacteria 3173
441 Ga0496126_0006232 3300048929 Bacteria 13329
442 Ga0496126_0018704 3300048929 Bacteria 6855
443 Ga0496126_0041131 3300048929 Bacteria 4280
444 Ga0496126_0109334 3300048929 Bacteria 2409
445 Ga0496126_0202932 3300048929 Bacteria 1673
446 Ga0496126_0208722 3300048929 Bacteria 1645
447 Ga0496126_0300205 3300048929 Bacteria 1325
448 Ga0496126_0447327 3300048929 Bacteria 1040
449 Ga0501031_0127006 3300049568 Bacteria 1666
450 Ga0501033_0245167 3300049570 Bacteria 1271
451 Ga0501034_0132424 3300049571 Bacteria 2476
452 Ga0501036_0047624 3300049572 Bacteria 3630
453 Ga0501046_0353459 3300049580 Bacteria 1067
454 Ga0501047_0029826 3300049581 Bacteria 5258
455 Ga0501047_0032550 3300049581 Bacteria 5033
456 Ga0501047_0613812 3300049581 Bacteria 908
457 Ga0501067_0023237 3300049583 Bacteria 3435
458 Ga0501070_0072317 3300049586 Bacteria 2855
459 Ga0501070_0541128 3300049586 Bacteria 933
460 Ga0501073_0053128 3300049589 Bacteria 2836
461 Ga0501073_0172852 3300049589 Bacteria 1496
462 Ga0501074_0048319 3300049590 Bacteria 3074
463 Ga0501080_0049397 3300049742 Bacteria 3915
464 Ga0501081_0673098 3300049743 Unclassified 776
465 Ga0501035_0069240 3300049822 Bacteria 3128
466 Ga0501035_0129494 3300049822 Bacteria 2201
467 Ga0501045_0405999 3300049824 Bacteria 1014
468 nmdc:mga03683_148439_c1 3300050489 Bacteria 1057
469 nmdc:mga03n38_4940_c1 3300050490 Bacteria 4479
470 nmdc:mga00v17_155965_c1 3300050491 Bacteria 1468
471 nmdc:mga00v17_31785_c1 3300050491 Bacteria 3115
472 nmdc:mga0yw44_154756_c1 3300050492 Bacteria 1497
473 nmdc:mga0yw44_16705_c2 3300050492 Bacteria 3446
474 nmdc:mga06z11_261468_c1 3300050494 Bacteria 1021
475 nmdc:mga06z11_77115_c1 3300050494 Bacteria 1779
476 nmdc:mga04h51_55315_c1 3300050495 Bacteria 1344
477 nmdc:mga07m45_52567_c1 3300050496 Bacteria 2300
478 nmdc:mga07m45_8072_c1 3300050496 Bacteria 5397
479 nmdc:mga08y16_401907_c1 3300050511 Bacteria 1402
480 nmdc:mga0n895_661570_c1 3300050512 Bacteria 1042
481 nmdc:mga08x19_93074_c1 3300050514 Bacteria 1992
482 nmdc:mga0sz30_8457_c1 3300050516 Bacteria 3887
483 Ga0495612_0302859 3300053078 Bacteria 717
484 Ga0500610_0238015 3300053079 Bacteria 849
485 Ga0500635_0018733 3300053080 Bacteria 2094
486 Ga0500635_0044873 3300053080 Bacteria 1493
487 Ga0500635_0223493 3300053080 Bacteria 735
488 Ga0500643_022154 3300053087 Bacteria 2050
489 Ga0500644_0008756 3300053088 Bacteria 2680
490 Ga0500644_0196369 3300053088 Bacteria 833
491 Ga0500651_0015119 3300053093 Bacteria 4733
492 Ga0500566_0015016 3300053094 Bacteria 4547
493 Ga0500566_0016743 3300053094 Bacteria 4303
494 Ga0500566_0212795 3300053094 Bacteria 967
495 Ga0500641_0025966 3300053096 Bacteria 2270
496 Ga0500641_0113174 3300053096 Bacteria 1168
497 Ga0500641_0166303 3300053096 Bacteria 950
498 Ga0500650_0004546 3300053098 Bacteria 5030
499 Ga0500554_009268 3300053102 Bacteria 2351
500 Ga0500554_009322 3300053102 Bacteria 2347
501 Ga0500556_0000029 3300053104 Bacteria 165326
502 Ga0500572_000876 3300053111 Bacteria 9349
503 Ga0500582_132356 3300053114 Bacteria 868
504 Ga0500592_000648 3300053116 Bacteria 5721
505 Ga0500594_0005769 3300053118 Bacteria 2754
506 Ga0500595_001029 3300053119 Bacteria 15582
507 Ga0500595_003049 3300053119 Bacteria 7962
508 Ga0500595_010338 3300053119 Bacteria 3714
509 Ga0500607_025602 3300053121 Bacteria 3282
510 Ga0500642_0000020 3300053130 Bacteria 159498
511 Ga0500642_0051040 3300053130 Bacteria 1826
512 Ga0500652_000227 3300053131 Bacteria 21480
513 Ga0500658_0010926 3300053134 Bacteria 3349
514 Ga0500559_0001175 3300053136 Bacteria 15697
515 Ga0500559_0005368 3300053136 Bacteria 5900
516 Ga0500568_0013591 3300053139 Bacteria 3707
517 Ga0500586_001025 3300053145 Bacteria 5789
518 Ga0500588_0027359 3300053146 Bacteria 1606
519 Ga0500603_000764 3300053150 Bacteria 7737
520 Ga0500616_0000112 3300053153 Bacteria 151210
521 Ga0500622_0001493 3300053156 Bacteria 18609
522 Ga0500634_0145645 3300053161 Bacteria 1114
523 Ga0500639_151777 3300053163 Bacteria 1066
524 Ga0500636_0001494 3300053177 Bacteria 12722
525 Ga0500636_0267473 3300053177 Bacteria 861
526 Ga0500637_0002741 3300053178 Bacteria 7903
527 Ga0500637_0041163 3300053178 Bacteria 2612
528 Ga0500637_0090699 3300053178 Bacteria 1770
529 Ga0500637_0093240 3300053178 Bacteria 1745
530 Ga0500567_171323 3300053723 Bacteria 775
531 Ga0500570_105554 3300053724 Bacteria 1165
532 Ga0500596_003575 3300053735 Bacteria 2933

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10184925 Ga0207665_101849252 204
2 3300047447 Ga0495685_073006 Ga0495685_073006_66_782 204
3 3300005435 Ga0070714_100413579 Ga0070714_1004135792 205
4 3300005436 Ga0070713_100013610 Ga0070713_1000136103 205
5 3300006175 Ga0070712_100017104 Ga0070712_1000171042 205
6 3300007788 Ga0099795_10005305 Ga0099795_100053054 205
7 3300010159 Ga0099796_10006541 Ga0099796_100065413 205
8 3300025928 Ga0207700_10019561 Ga0207700_100195612 205
9 3300005338 Ga0068868_100042710 Ga0068868_1000427104 206
10 3300005456 Ga0070678_100172718 Ga0070678_1001727182 206
11 3300036401 Ga0373937_0557001 Ga0373937_0557001_459_1079 206
12 3300037471 Ga0395905_0317645 Ga0395905_0317645_48_668 206
13 3300038443 Ga0395901_0382188 Ga0395901_0382188_782_1402 206
14 3300039438 Ga0436360_0285178 Ga0436360_0285178_773_1393 206
15 3300046455 Ga0495603_0011792 Ga0495603_0011792_43_663 206
16 3300046524 Ga0495648_0087547 Ga0495648_0087547_1100_1720 206
17 3300047315 Ga0495581_0184414 Ga0495581_0184414_563_1183 206
18 3300047317 Ga0495604_0409508 Ga0495604_0409508_231_851 206
19 3300047470 Ga0495681_0146919 Ga0495681_0146919_308_928 206
20 3300048903 Ga0496100_0913838 Ga0496100_0913838_38_658 206
21 3300048906 Ga0496103_0291695 Ga0496103_0291695_386_1006 206
22 3300048929 Ga0496126_0208722 Ga0496126_0208722_34_654 206
23 3300053078 Ga0495612_0302859 Ga0495612_0302859_81_701 206
24 3300053088 Ga0500644_0196369 Ga0500644_0196369_146_766 206
25 3300053163 Ga0500639_151777 Ga0500639_151777_20_640 206
26 3300053724 Ga0500570_105554 Ga0500570_105554_525_1148 206
27 3300048907 Ga0496104_0292055 Ga0496104_0292055_720_1367 215
28 3300005328 Ga0070676_10114933 Ga0070676_101149332 216
29 3300006881 Ga0068865_100048318 Ga0068865_1000483181 216
30 3300025922 Ga0207646_10077708 Ga0207646_100777084 216
31 3300026075 Ga0207708_10290064 Ga0207708_102900643 216
32 3300026089 Ga0207648_10051602 Ga0207648_100516024 216
33 3300039450 Ga0436363_1389662 Ga0436363_1389662_269_952 216
34 3300046474 Ga0495605_0140721 Ga0495605_0140721_277_1068 216
35 3300005719 Ga0068861_100054256 Ga0068861_1000542562 217
36 3300006852 Ga0075433_10845213 Ga0075433_108452131 217
37 3300027907 Ga0207428_10260382 Ga0207428_102603822 217
38 3300025898 Ga0207692_10126262 Ga0207692_101262622 221
39 iso_pu_bacteria 2671180139 2671692746 221
40 iso_pu_bacteria 2837651117 2837652618 225
41 3300003659 JGI25404J52841_10001888 JGI25404J52841_100018884 226
42 3300005983 Ga0081540_1001462 Ga0081540_10014628 226
43 3300037853 Ga0436364_0616684 Ga0436364_0616684_26808_27488 226
44 3300046515 Ga0495620_0065975 Ga0495620_0065975_141_911 226
45 3300046524 Ga0495648_0070221 Ga0495648_0070221_400_1146 226
46 3300046694 Ga0495649_0087417 Ga0495649_0087417_12_692 226
47 iso_pu_bacteria 2513237101 2513697911 226
48 iso_pu_bacteria 2721755755 2723842790 226
49 iso_pu_bacteria 2874604998 2874606550 226
50 iso_pu_bacteria 2876808645 2876810877 226
51 iso_pu_bacteria 2879110137 2879114143 226
52 iso_pu_bacteria 2922361189 2922367311 226
53 iso_pu_bacteria 8006964411 8006966087 226
54 iso_pu_bacteria 8006994254 8006998139 226
55 iso_pu_bacteria 8056673599 8056675142 226
56 3300005290 Ga0065712_10244589 Ga0065712_102445891 227
57 3300005364 Ga0070673_100532200 Ga0070673_1005322002 227
58 3300025926 Ga0207659_10671919 Ga0207659_106719192 227
59 3300025960 Ga0207651_10598823 Ga0207651_105988232 227
60 3300039453 Ga0436362_0825752 Ga0436362_0825752_135_818 227
61 3300048091 Ga0495626_0086188 Ga0495626_0086188_225_914 227
62 iso_pu_bacteria 2508501042 2508694375 227
63 iso_pu_bacteria 2513237098 2513673512 227
64 iso_pu_bacteria 2513237104 2513717775 227
65 iso_pu_bacteria 2513237141 2513887747 227
66 iso_pu_bacteria 2517093001 2517104367 227
67 iso_pu_bacteria 2524023210 2524467535 227
68 iso_pu_bacteria 2602042107 2603857319 227
69 iso_pu_bacteria 2643221651 2644289787 227
70 iso_pu_bacteria 2824661429 2824669947 227
71 iso_pu_bacteria 2824679649 2824684304 227
72 iso_pu_bacteria 2841957949 2841960943 227
73 iso_pu_bacteria 2857524615 2857526697 227
74 iso_pu_bacteria 2879099564 2879101382 227
75 iso_pu_bacteria 2885383462 2885391283 227
76 iso_pu_bacteria 2893066018 2893069862 227
77 iso_pu_bacteria 2903768456 2903777367 227
78 iso_pu_bacteria 2919073203 2919077797 227
79 iso_pu_bacteria 2922393267 2922396456 227
80 iso_pu_bacteria 2932784394 2932791473 227
81 iso_pu_bacteria 2932794094 2932796873 227
82 iso_pu_bacteria 2932801729 2932802346 227
83 iso_pu_bacteria 2932809354 2932816729 227
84 iso_pu_bacteria 2932818245 2932824089 227
85 iso_pu_bacteria 2932828146 2932835375 227
86 iso_pu_bacteria 2935616580 2935621118 227
87 iso_pu_bacteria 2935638405 2935643575 227
88 iso_pu_bacteria 2935648319 2935650461 227
89 iso_pu_bacteria 2935656913 2935662903 227
90 iso_pu_bacteria 2935665750 2935671115 227
91 iso_pu_bacteria 2935703347 2935712116 227
92 iso_pu_bacteria 2935760218 2935763939 227
93 iso_pu_bacteria 2935801545 2935807916 227
94 iso_pu_bacteria 2935810662 2935818750 227
95 iso_pu_bacteria 2935827899 2935833092 227
96 iso_pu_bacteria 2935837841 2935844252 227
97 iso_pu_bacteria 2935855204 2935859689 227
98 iso_pu_bacteria 2935864058 2935872087 227
99 iso_pu_bacteria 2935873716 2935878989 227
100 iso_pu_bacteria 2935883170 2935887215 227
101 iso_pu_bacteria 2935908558 2935911252 227
102 iso_pu_bacteria 2935926038 2935928281 227
103 iso_pu_bacteria 2935934488 2935937926 227
104 iso_pu_bacteria 2935942939 2935945208 227
105 iso_pu_bacteria 2935951376 2935954286 227
106 iso_pu_bacteria 2935959822 2935965635 227
107 iso_pu_bacteria 2935967501 2935971446 227
108 iso_pu_bacteria 2935984226 2935990595 227
109 iso_pu_bacteria 2935992306 2936000336 227
110 iso_pu_bacteria 2936002035 2936008494 227
111 iso_pu_bacteria 2936011229 2936017183 227
112 iso_pu_bacteria 2936019824 2936026682 227
113 iso_pu_bacteria 2936028420 2936035425 227
114 iso_pu_bacteria 2936037263 2936045560 227
115 iso_pu_bacteria 2936046547 2936053574 227
116 iso_pu_bacteria 2936055302 2936063283 227
117 iso_pu_bacteria 2941538514 2941542584 227
118 iso_pu_bacteria 8016630954 8016637170 227
119 iso_pu_bacteria 8017057580 8017066051 227
120 iso_pu_bacteria 8019576017 8019578583 227
121 iso_pu_bacteria 8019586578 8019596633 227
122 iso_pu_bacteria 8019597564 8019605071 227
123 iso_pu_bacteria 8019608314 8019613463 227
124 iso_pu_bacteria 8019687851 8019695011 227
125 iso_pu_bacteria 8056681323 8056684598 227
126 3300014326 Ga0157380_10082126 Ga0157380_100821262 228
127 3300035086 Ga0373934_0036382 Ga0373934_0036382_345_1031 228
128 3300035119 Ga0373956_0055684 Ga0373956_0055684_798_1484 228
129 3300036401 Ga0373937_0048835 Ga0373937_0048835_1116_1802 228
130 iso_pu_bacteria 2513237102 2513699507 228
131 iso_pu_bacteria 2524023205 2524438334 228
132 iso_pu_bacteria 2744054633 2745078518 228
133 iso_pu_bacteria 2791355196 2793059616 228
134 iso_pu_bacteria 2824617872 2824625202 228
135 iso_pu_bacteria 2824626560 2824635087 228
136 iso_pu_bacteria 2824635225 2824643623 228
137 iso_pu_bacteria 2824644064 2824652696 228
138 iso_pu_bacteria 2824714736 2824723251 228
139 iso_pu_bacteria 2824723954 2824732605 228
140 iso_pu_bacteria 2842038055 2842041986 228
141 iso_pu_bacteria 2842045827 2842050029 228
142 iso_pu_bacteria 2847930680 2847932290 228
143 iso_pu_bacteria 2857576091 2857577539 228
144 iso_pu_bacteria 2879083081 2879091545 228
145 iso_pu_bacteria 2885366525 2885374046 228
146 iso_pu_bacteria 2885409591 2885412920 228
147 iso_pu_bacteria 2888388044 2888391797 228
148 iso_pu_bacteria 2906643746 2906645359 228
149 iso_pu_bacteria 2922368715 2922370541 228
150 iso_pu_bacteria 2929615660 2929620118 228
151 iso_pu_bacteria 2929624759 2929629431 228
152 iso_pu_bacteria 2933577622 2933582035 228
153 iso_pu_bacteria 2935694250 2935699953 228
154 iso_pu_bacteria 2935769743 2935776659 228
155 iso_pu_bacteria 2935777560 2935781552 228
156 iso_pu_bacteria 2935785616 2935789870 228
157 iso_pu_bacteria 2935793552 2935798364 228
158 iso_pu_bacteria 2941531003 2941537285 228
159 iso_pu_bacteria 8016522445 8016524885 228
160 iso_pu_bacteria 8016530956 8016538462 228
161 iso_pu_bacteria 8016539877 8016542743 228
162 iso_pu_bacteria 8016557553 8016558958 228
163 iso_pu_bacteria 8016566248 8016568128 228
164 iso_pu_bacteria 8016575299 8016580802 228
165 iso_pu_bacteria 8016595262 8016596922 228
166 iso_pu_bacteria 8016603502 8016607826 228
167 iso_pu_bacteria 8016613128 8016619610 228
168 iso_pu_bacteria 8016622563 8016629994 228
169 iso_pu_bacteria 8019530166 8019538125 228
170 iso_pu_bacteria 8019538911 8019541858 228
171 iso_pu_bacteria 8019547302 8019548939 228
172 iso_pu_bacteria 8019648815 8019653653 228
173 iso_pu_bacteria 8055742211 8055750129 228
174 3300005356 Ga0070674_100420255 Ga0070674_1004202552 229
175 3300005435 Ga0070714_100026447 Ga0070714_1000264472 229
176 3300005456 Ga0070678_100044155 Ga0070678_1000441552 229
177 3300006028 Ga0070717_10006671 Ga0070717_100066717 229
178 3300006163 Ga0070715_10019909 Ga0070715_100199094 229
179 3300006173 Ga0070716_100127202 Ga0070716_1001272022 229
180 3300009148 Ga0105243_10075123 Ga0105243_100751232 229
181 3300009176 Ga0105242_10089639 Ga0105242_100896393 229
182 3300009553 Ga0105249_10030441 Ga0105249_100304416 229
183 3300010375 Ga0105239_10694130 Ga0105239_106941302 229
184 3300013308 Ga0157375_10057754 Ga0157375_100577542 229
185 3300014326 Ga0157380_10042815 Ga0157380_100428155 229
186 3300014969 Ga0157376_10339132 Ga0157376_103391321 229
187 3300021388 Ga0213875_10000011 Ga0213875_1000001129 229
188 3300025315 Ga0207697_10089141 Ga0207697_100891412 229
189 3300025899 Ga0207642_10078429 Ga0207642_100784293 229
190 3300025926 Ga0207659_10194451 Ga0207659_101944514 229
191 3300025929 Ga0207664_10025742 Ga0207664_100257425 229
192 3300025934 Ga0207686_10221627 Ga0207686_102216273 229
193 3300025935 Ga0207709_10135121 Ga0207709_101351213 229
194 3300025937 Ga0207669_10009924 Ga0207669_100099244 229
195 3300025939 Ga0207665_10055525 Ga0207665_100555253 229
196 3300025961 Ga0207712_10285906 Ga0207712_102859062 229
197 3300026121 Ga0207683_10051830 Ga0207683_100518303 229
198 3300035695 Ga0373927_0026463 Ga0373927_0026463_988_1677 229
199 3300037068 Ga0373925_0176925 Ga0373925_0176925_896_1585 229
200 3300037853 Ga0436364_0232280 Ga0436364_0232280_33283_33972 229
201 3300037853 Ga0436364_0887813 Ga0436364_0887813_480_1169 229
202 3300037853 Ga0436364_1224135 Ga0436364_1224135_45624_46313 229
203 3300039453 Ga0436362_1206919 Ga0436362_1206919_172_861 229
204 3300046523 Ga0495644_0011772 Ga0495644_0011772_2070_2861 229
205 3300046525 Ga0495663_0100623 Ga0495663_0100623_21_812 229
206 3300046684 Ga0495669_0002970 Ga0495669_0002970_4491_5282 229
207 3300047445 Ga0495677_0025799 Ga0495677_0025799_134_925 229
208 3300048905 Ga0496102_0070854 Ga0496102_0070854_1541_2332 229
209 3300048917 Ga0496114_0060221 Ga0496114_0060221_640_1431 229
210 3300049583 Ga0501067_0023237 Ga0501067_0023237_1550_2242 229
211 3300049589 Ga0501073_0053128 Ga0501073_0053128_2082_2774 229
212 3300049743 Ga0501081_0673098 Ga0501081_0673098_67_759 229
213 3300005330 Ga0070690_100474184 Ga0070690_1004741841 230
214 3300005338 Ga0068868_100060031 Ga0068868_1000600314 230
215 3300005347 Ga0070668_100292083 Ga0070668_1002920832 230
216 3300005366 Ga0070659_100656581 Ga0070659_1006565811 230
217 3300005441 Ga0070700_100155547 Ga0070700_1001555472 230
218 3300005455 Ga0070663_100049222 Ga0070663_1000492222 230
219 3300005455 Ga0070663_100091376 Ga0070663_1000913761 230
220 3300005455 Ga0070663_100483433 Ga0070663_1004834331 230
221 3300005457 Ga0070662_100047414 Ga0070662_1000474143 230
222 3300005548 Ga0070665_100015135 Ga0070665_1000151352 230
223 3300005548 Ga0070665_100042136 Ga0070665_1000421364 230
224 3300005548 Ga0070665_100108212 Ga0070665_1001082123 230
225 3300005548 Ga0070665_100213535 Ga0070665_1002135353 230
226 3300005564 Ga0070664_100675758 Ga0070664_1006757582 230
227 3300005578 Ga0068854_100284844 Ga0068854_1002848442 230
228 3300005614 Ga0068856_100261325 Ga0068856_1002613251 230
229 3300005615 Ga0070702_100275393 Ga0070702_1002753931 230
230 3300005617 Ga0068859_100061016 Ga0068859_1000610162 230
231 3300005618 Ga0068864_100075214 Ga0068864_1000752142 230
232 3300005718 Ga0068866_10141008 Ga0068866_101410082 230
233 3300005719 Ga0068861_100343230 Ga0068861_1003432301 230
234 3300005841 Ga0068863_100110330 Ga0068863_1001103302 230
235 3300005843 Ga0068860_100053416 Ga0068860_1000534162 230
236 3300005843 Ga0068860_100100200 Ga0068860_1001002002 230
237 3300005844 Ga0068862_100099944 Ga0068862_1000999443 230
238 3300005844 Ga0068862_100338703 Ga0068862_1003387032 230
239 3300005937 Ga0081455_10022998 Ga0081455_100229983 230
240 3300005983 Ga0081540_1003095 Ga0081540_10030952 230
241 3300005983 Ga0081540_1004104 Ga0081540_100410410 230
242 3300005983 Ga0081540_1004610 Ga0081540_100461012 230
243 3300005983 Ga0081540_1027653 Ga0081540_10276533 230
244 3300006048 Ga0075363_100000680 Ga0075363_10000068012 230
245 3300006048 Ga0075363_100095017 Ga0075363_1000950172 230
246 3300006051 Ga0075364_10123240 Ga0075364_101232402 230
247 3300006177 Ga0075362_10185222 Ga0075362_101852221 230
248 3300006178 Ga0075367_10095026 Ga0075367_100950262 230
249 3300006178 Ga0075367_10205996 Ga0075367_102059962 230
250 3300006195 Ga0075366_10131820 Ga0075366_101318202 230
251 3300006353 Ga0075370_10007368 Ga0075370_100073687 230
252 3300006353 Ga0075370_10018197 Ga0075370_100181974 230
253 3300006358 Ga0068871_100081794 Ga0068871_1000817944 230
254 3300006871 Ga0075434_100379761 Ga0075434_1003797613 230
255 3300006931 Ga0097620_100061013 Ga0097620_1000610132 230
256 3300007076 Ga0075435_100316466 Ga0075435_1003164662 230
257 3300009093 Ga0105240_10355506 Ga0105240_103555063 230
258 3300009174 Ga0105241_10047563 Ga0105241_100475632 230
259 3300009174 Ga0105241_10068508 Ga0105241_100685082 230
260 3300009177 Ga0105248_10069294 Ga0105248_100692945 230
261 3300009545 Ga0105237_10616336 Ga0105237_106163361 230
262 3300009553 Ga0105249_10363467 Ga0105249_103634672 230
263 3300010375 Ga0105239_10067144 Ga0105239_100671444 230
264 3300010375 Ga0105239_10086663 Ga0105239_100866634 230
265 3300010375 Ga0105239_10901000 Ga0105239_109010001 230
266 3300011119 Ga0105246_10066091 Ga0105246_100660915 230
267 3300013296 Ga0157374_10229435 Ga0157374_102294353 230
268 3300014325 Ga0163163_10099788 Ga0163163_100997883 230
269 3300014325 Ga0163163_10991486 Ga0163163_109914861 230
270 3300014968 Ga0157379_10160337 Ga0157379_101603373 230
271 3300014969 Ga0157376_10107194 Ga0157376_101071943 230
272 3300021388 Ga0213875_10002319 Ga0213875_1000231910 230
273 3300025899 Ga0207642_10253003 Ga0207642_102530031 230
274 3300025900 Ga0207710_10093872 Ga0207710_100938722 230
275 3300025901 Ga0207688_10227034 Ga0207688_102270341 230
276 3300025907 Ga0207645_10037451 Ga0207645_100374515 230
277 3300025909 Ga0207705_10033478 Ga0207705_100334784 230
278 3300025924 Ga0207694_10040558 Ga0207694_100405582 230
279 3300025927 Ga0207687_10012936 Ga0207687_100129364 230
280 3300025929 Ga0207664_10110197 Ga0207664_101101972 230
281 3300025931 Ga0207644_10252591 Ga0207644_102525911 230
282 3300025932 Ga0207690_10553710 Ga0207690_105537101 230
283 3300025933 Ga0207706_10026773 Ga0207706_100267736 230
284 3300025936 Ga0207670_10142712 Ga0207670_101427121 230
285 3300025940 Ga0207691_10091519 Ga0207691_100915194 230
286 3300025941 Ga0207711_10099749 Ga0207711_100997492 230
287 3300025942 Ga0207689_10056672 Ga0207689_100566725 230
288 3300025961 Ga0207712_10161695 Ga0207712_101616951 230
289 3300025972 Ga0207668_10131577 Ga0207668_101315773 230
290 3300026023 Ga0207677_10062898 Ga0207677_100628982 230
291 3300026067 Ga0207678_10004916 Ga0207678_1000491612 230
292 3300026067 Ga0207678_10095014 Ga0207678_100950144 230
293 3300026067 Ga0207678_10265681 Ga0207678_102656812 230
294 3300026075 Ga0207708_10255226 Ga0207708_102552261 230
295 3300026088 Ga0207641_10313628 Ga0207641_103136282 230
296 3300026089 Ga0207648_10431007 Ga0207648_104310071 230
297 3300026095 Ga0207676_10063964 Ga0207676_100639644 230
298 3300026116 Ga0207674_10196401 Ga0207674_101964011 230
299 3300026118 Ga0207675_100068830 Ga0207675_1000688302 230
300 3300026121 Ga0207683_10699674 Ga0207683_106996741 230
301 3300028379 Ga0268266_10006857 Ga0268266_100068574 230
302 3300028379 Ga0268266_10601225 Ga0268266_106012251 230
303 3300028380 Ga0268265_10111732 Ga0268265_101117321 230
304 3300028381 Ga0268264_10045022 Ga0268264_100450223 230
305 3300028381 Ga0268264_10686124 Ga0268264_106861242 230
306 3300031665 Ga0316575_10089195 Ga0316575_100891952 230
307 3300031995 Ga0307409_100119359 Ga0307409_1001193591 230
308 3300031995 Ga0307409_100269743 Ga0307409_1002697433 230
309 3300032126 Ga0307415_100021174 Ga0307415_1000211745 230
310 3300032126 Ga0307415_100247425 Ga0307415_1002474252 230
311 3300032126 Ga0307415_100711575 Ga0307415_1007115751 230
312 3300037312 Ga0395899_0179696 Ga0395899_0179696_64_759 230
313 3300037418 Ga0395900_0124721 Ga0395900_0124721_1270_1965 230
314 3300038443 Ga0395901_0015566 Ga0395901_0015566_4211_4906 230
315 3300041451 Ga0451791_0231185 Ga0451791_0231185_60_806 230
316 3300046455 Ga0495603_0053912 Ga0495603_0053912_647_1339 230
317 3300046460 Ga0495638_0047605 Ga0495638_0047605_458_1222 230
318 3300046471 Ga0495650_0082850 Ga0495650_0082850_431_1195 230
319 3300046472 Ga0495580_0396492 Ga0495580_0396492_68_760 230
320 3300046474 Ga0495605_0152741 Ga0495605_0152741_165_929 230
321 3300046491 Ga0495584_0141793 Ga0495584_0141793_432_1193 230
322 3300046492 Ga0495585_0055858 Ga0495585_0055858_581_1273 230
323 3300046500 Ga0495596_0039854 Ga0495596_0039854_621_1385 230
324 3300046513 Ga0495616_0053634 Ga0495616_0053634_193_957 230
325 3300046518 Ga0495631_0011197 Ga0495631_0011197_2172_2936 230
326 3300046519 Ga0495632_0032104 Ga0495632_0032104_495_1259 230
327 3300046519 Ga0495632_0167237 Ga0495632_0167237_31_810 230
328 3300046523 Ga0495644_0016014 Ga0495644_0016014_345_1037 230
329 3300046525 Ga0495663_0050265 Ga0495663_0050265_11_718 230
330 3300046528 Ga0495642_0024956 Ga0495642_0024956_821_1585 230
331 3300046538 Ga0495609_0082791 Ga0495609_0082791_284_1048 230
332 3300046557 Ga0495622_0073983 Ga0495622_0073983_37_831 230
333 3300046616 Ga0495668_0018733 Ga0495668_0018733_975_1739 230
334 3300046616 Ga0495668_0059067 Ga0495668_0059067_1074_1853 230
335 3300046648 Ga0495611_0022187 Ga0495611_0022187_581_1345 230
336 3300046664 Ga0495659_0023543 Ga0495659_0023543_382_1074 230
337 3300046664 Ga0495659_0048013 Ga0495659_0048013_672_1364 230
338 3300046681 Ga0495647_0083878 Ga0495647_0083878_390_1082 230
339 3300046684 Ga0495669_0039616 Ga0495669_0039616_14_751 230
340 3300046684 Ga0495669_0121906 Ga0495669_0121906_490_1182 230
341 3300046691 Ga0495670_0038253 Ga0495670_0038253_837_1529 230
342 3300046794 Ga0495589_0060910 Ga0495589_0060910_415_1179 230
343 3300047315 Ga0495581_0203681 Ga0495581_0203681_12_761 230
344 3300047318 Ga0495636_0029940 Ga0495636_0029940_1159_1851 230
345 3300047469 Ga0495673_0055712 Ga0495673_0055712_757_1521 230
346 3300048905 Ga0496102_0142725 Ga0496102_0142725_1388_2080 230
347 3300048906 Ga0496103_0182523 Ga0496103_0182523_327_1019 230
348 3300048908 Ga0496105_0107803 Ga0496105_0107803_1245_1937 230
349 3300048911 Ga0496108_0060454 Ga0496108_0060454_544_1236 230
350 3300048913 Ga0496110_0035330 Ga0496110_0035330_1909_2601 230
351 3300048914 Ga0496111_0410030 Ga0496111_0410030_156_890 230
352 3300048916 Ga0496113_0435732 Ga0496113_0435732_272_964 230
353 3300048918 Ga0496115_0144035 Ga0496115_0144035_643_1335 230
354 3300048918 Ga0496115_0511624 Ga0496115_0511624_233_925 230
355 3300048918 Ga0496115_0639337 Ga0496115_0639337_72_764 230
356 3300048919 Ga0496116_0178608 Ga0496116_0178608_321_1013 230
357 3300048921 Ga0496118_0262790 Ga0496118_0262790_110_802 230
358 3300048923 Ga0496120_0121961 Ga0496120_0121961_176_868 230
359 3300048924 Ga0496121_0023355 Ga0496121_0023355_2433_3125 230
360 3300048924 Ga0496121_0108275 Ga0496121_0108275_92_784 230
361 3300048927 Ga0496124_0331242 Ga0496124_0331242_354_1046 230
362 3300048927 Ga0496124_0530107 Ga0496124_0530107_35_727 230
363 3300048929 Ga0496126_0018704 Ga0496126_0018704_3607_4299 230
364 3300049572 Ga0501036_0047624 Ga0501036_0047624_989_1684 230
365 3300049580 Ga0501046_0353459 Ga0501046_0353459_186_881 230
366 3300049581 Ga0501047_0613812 Ga0501047_0613812_184_879 230
367 3300049822 Ga0501035_0069240 Ga0501035_0069240_2072_2767 230
368 3300049824 Ga0501045_0405999 Ga0501045_0405999_217_912 230
369 3300050489 nmdc:mga03683_148439_c1 nmdc:mga03683_148439_c1_280_972 230
370 3300050490 nmdc:mga03n38_4940_c1 nmdc:mga03n38_4940_c1_3207_3899 230
371 3300050491 nmdc:mga00v17_155965_c1 nmdc:mga00v17_155965_c1_352_1044 230
372 3300050494 nmdc:mga06z11_261468_c1 nmdc:mga06z11_261468_c1_263_1000 230
373 3300050494 nmdc:mga06z11_77115_c1 nmdc:mga06z11_77115_c1_589_1281 230
374 3300050495 nmdc:mga04h51_55315_c1 nmdc:mga04h51_55315_c1_478_1170 230
375 3300050496 nmdc:mga07m45_52567_c1 nmdc:mga07m45_52567_c1_1176_1868 230
376 3300050496 nmdc:mga07m45_8072_c1 nmdc:mga07m45_8072_c1_4324_5016 230
377 3300050512 nmdc:mga0n895_661570_c1 nmdc:mga0n895_661570_c1_189_881 230
378 3300053087 Ga0500643_022154 Ga0500643_022154_1117_1809 230
379 3300053096 Ga0500641_0025966 Ga0500641_0025966_425_1117 230
380 3300053096 Ga0500641_0166303 Ga0500641_0166303_114_806 230
381 3300053114 Ga0500582_132356 Ga0500582_132356_32_724 230
382 3300053130 Ga0500642_0051040 Ga0500642_0051040_526_1218 230
383 3300053134 Ga0500658_0010926 Ga0500658_0010926_2246_2938 230
384 3300053146 Ga0500588_0027359 Ga0500588_0027359_664_1356 230
385 3300053161 Ga0500634_0145645 Ga0500634_0145645_401_1093 230
386 3300053178 Ga0500637_0093240 Ga0500637_0093240_815_1573 230
387 3300005329 Ga0070683_100083841 Ga0070683_1000838413 231
388 3300005335 Ga0070666_10421842 Ga0070666_104218421 231
389 3300005338 Ga0068868_100656136 Ga0068868_1006561361 231
390 3300005344 Ga0070661_100067210 Ga0070661_1000672104 231
391 3300005434 Ga0070709_10003877 Ga0070709_100038777 231
392 3300005435 Ga0070714_100002400 Ga0070714_1000024004 231
393 3300005435 Ga0070714_100212405 Ga0070714_1002124052 231
394 3300005436 Ga0070713_100066523 Ga0070713_1000665233 231
395 3300005436 Ga0070713_100409671 Ga0070713_1004096712 231
396 3300005437 Ga0070710_10011512 Ga0070710_100115124 231
397 3300005437 Ga0070710_10051623 Ga0070710_100516233 231
398 3300005439 Ga0070711_100032102 Ga0070711_1000321023 231
399 3300005439 Ga0070711_100139720 Ga0070711_1001397202 231
400 3300005439 Ga0070711_100153290 Ga0070711_1001532902 231
401 3300005455 Ga0070663_100193042 Ga0070663_1001930421 231
402 3300005471 Ga0070698_100026383 Ga0070698_1000263838 231
403 3300005518 Ga0070699_100128562 Ga0070699_1001285622 231
404 3300005530 Ga0070679_100523308 Ga0070679_1005233081 231
405 3300005536 Ga0070697_100347379 Ga0070697_1003473792 231
406 3300005614 Ga0068856_100025081 Ga0068856_1000250814 231
407 3300005614 Ga0068856_100693134 Ga0068856_1006931341 231
408 3300005618 Ga0068864_100273776 Ga0068864_1002737762 231
409 3300005842 Ga0068858_100411470 Ga0068858_1004114701 231
410 3300006028 Ga0070717_10037568 Ga0070717_100375682 231
411 3300006038 Ga0075365_10236458 Ga0075365_102364582 231
412 3300006048 Ga0075363_100115001 Ga0075363_1001150012 231
413 3300006051 Ga0075364_10010772 Ga0075364_100107725 231
414 3300006175 Ga0070712_100002146 Ga0070712_1000021467 231
415 3300006175 Ga0070712_100069089 Ga0070712_1000690893 231
416 3300006186 Ga0075369_10005761 Ga0075369_100057615 231
417 3300006914 Ga0075436_100052807 Ga0075436_1000528072 231
418 3300006914 Ga0075436_100108224 Ga0075436_1001082241 231
419 3300007265 Ga0099794_10118282 Ga0099794_101182822 231
420 3300007788 Ga0099795_10028541 Ga0099795_100285412 231
421 3300007788 Ga0099795_10028831 Ga0099795_100288311 231
422 3300009093 Ga0105240_10080848 Ga0105240_100808484 231
423 3300009094 Ga0111539_10281499 Ga0111539_102814993 231
424 3300009101 Ga0105247_10038309 Ga0105247_100383095 231
425 3300009101 Ga0105247_10519229 Ga0105247_105192291 231
426 3300009176 Ga0105242_10158533 Ga0105242_101585331 231
427 3300010159 Ga0099796_10010931 Ga0099796_100109314 231
428 3300010159 Ga0099796_10021110 Ga0099796_100211103 231
429 3300010159 Ga0099796_10093418 Ga0099796_100934182 231
430 3300010375 Ga0105239_10059371 Ga0105239_100593713 231
431 3300010375 Ga0105239_10144870 Ga0105239_101448701 231
432 3300011119 Ga0105246_10009096 Ga0105246_100090966 231
433 3300013296 Ga0157374_10015314 Ga0157374_100153146 231
434 3300013306 Ga0163162_10025914 Ga0163162_100259143 231
435 3300013308 Ga0157375_10153627 Ga0157375_101536272 231
436 3300014325 Ga0163163_10070756 Ga0163163_100707562 231
437 3300014497 Ga0182008_10075648 Ga0182008_100756482 231
438 3300014969 Ga0157376_10005988 Ga0157376_100059886 231
439 3300021358 Ga0213873_10074724 Ga0213873_100747241 231
440 3300021361 Ga0213872_10113163 Ga0213872_101131631 231
441 3300021377 Ga0213874_10062906 Ga0213874_100629062 231
442 3300021388 Ga0213875_10000480 Ga0213875_1000048035 231
443 3300021441 Ga0213871_10014576 Ga0213871_100145762 231
444 3300025253 Ga0209677_102002 Ga0209677_1020028 231
445 3300025261 Ga0209233_1003959 Ga0209233_10039595 231
446 3300025295 Ga0209564_1000397 Ga0209564_100039735 231
447 3300025315 Ga0207697_10058291 Ga0207697_100582913 231
448 3300025898 Ga0207692_10012176 Ga0207692_100121763 231
449 3300025906 Ga0207699_10037669 Ga0207699_100376692 231
450 3300025906 Ga0207699_10067760 Ga0207699_100677602 231
451 3300025912 Ga0207707_10245404 Ga0207707_102454042 231
452 3300025912 Ga0207707_10543706 Ga0207707_105437062 231
453 3300025915 Ga0207693_10002609 Ga0207693_100026097 231
454 3300025915 Ga0207693_10028370 Ga0207693_100283705 231
455 3300025915 Ga0207693_10085965 Ga0207693_100859652 231
456 3300025915 Ga0207693_10481881 Ga0207693_104818812 231
457 3300025916 Ga0207663_10005220 Ga0207663_100052206 231
458 3300025920 Ga0207649_10204128 Ga0207649_102041282 231
459 3300025921 Ga0207652_10361797 Ga0207652_103617971 231
460 3300025928 Ga0207700_10206584 Ga0207700_102065842 231
461 3300025928 Ga0207700_10215507 Ga0207700_102155072 231
462 3300025929 Ga0207664_10038577 Ga0207664_100385773 231
463 3300025929 Ga0207664_10106974 Ga0207664_101069743 231
464 3300025929 Ga0207664_10346465 Ga0207664_103464652 231
465 3300025929 Ga0207664_10453600 Ga0207664_104536002 231
466 3300025938 Ga0207704_10100374 Ga0207704_101003742 231
467 3300025939 Ga0207665_10023995 Ga0207665_100239953 231
468 3300025939 Ga0207665_10094022 Ga0207665_100940221 231
469 3300025942 Ga0207689_10480185 Ga0207689_104801851 231
470 3300025944 Ga0207661_10052779 Ga0207661_100527794 231
471 3300025945 Ga0207679_10102978 Ga0207679_101029783 231
472 3300026035 Ga0207703_10451093 Ga0207703_104510932 231
473 3300026067 Ga0207678_10015307 Ga0207678_100153075 231
474 3300026067 Ga0207678_10025216 Ga0207678_100252162 231
475 3300026078 Ga0207702_10071413 Ga0207702_100714132 231
476 3300026078 Ga0207702_10615743 Ga0207702_106157432 231
477 3300026095 Ga0207676_10008501 Ga0207676_100085015 231
478 3300026121 Ga0207683_10008816 Ga0207683_100088163 231
479 3300028573 Ga0265334_10025685 Ga0265334_100256852 231
480 3300031239 Ga0265328_10048818 Ga0265328_100488182 231
481 3300034816 Ga0373930_0010637 Ga0373930_0010637_490_1185 231
482 3300034957 Ga0373938_0051523 Ga0373938_0051523_99_869 231
483 3300035115 Ga0373941_0141572 Ga0373941_0141572_61_756 231
484 3300035116 Ga0373945_0135081 Ga0373945_0135081_265_960 231
485 3300035119 Ga0373956_0129969 Ga0373956_0129969_100_807 231
486 3300035121 Ga0373960_0031327 Ga0373960_0031327_554_1249 231
487 3300035170 Ga0373943_0129611 Ga0373943_0129611_431_1195 231
488 3300035691 Ga0373931_0019943 Ga0373931_0019943_601_1371 231
489 3300035691 Ga0373931_0198817 Ga0373931_0198817_242_937 231
490 3300035692 Ga0373935_0391751 Ga0373935_0391751_275_970 231
491 3300035724 Ga0373933_0308472 Ga0373933_0308472_18_725 231
492 3300036401 Ga0373937_0079077 Ga0373937_0079077_1383_2090 231
493 3300036401 Ga0373937_0558471 Ga0373937_0558471_152_883 231
494 3300037466 Ga0395898_0094516 Ga0395898_0094516_2052_2747 231
495 3300037853 Ga0436364_0010042 Ga0436364_0010042_28720_29415 231
496 3300037853 Ga0436364_0151134 Ga0436364_0151134_265_960 231
497 3300037853 Ga0436364_0960005 Ga0436364_0960005_1696_2391 231
498 3300039437 Ga0436365_1051823 Ga0436365_1051823_855_1550 231
499 3300039437 Ga0436365_1917762 Ga0436365_1917762_14_709 231
500 3300039438 Ga0436360_0135729 Ga0436360_0135729_135_842 231
501 3300039438 Ga0436360_0372949 Ga0436360_0372949_483_1178 231
502 3300039438 Ga0436360_0381517 Ga0436360_0381517_195_890 231
503 3300039438 Ga0436360_1299321 Ga0436360_1299321_38_733 231
504 3300039447 Ga0436361_0240505 Ga0436361_0240505_210_905 231
505 3300039450 Ga0436363_0956567 Ga0436363_0956567_822_1517 231
506 3300039450 Ga0436363_1095549 Ga0436363_1095549_1367_2062 231
507 3300039453 Ga0436362_0351741 Ga0436362_0351741_896_1603 231
508 3300039453 Ga0436362_0533801 Ga0436362_0533801_704_1429 231
509 3300039453 Ga0436362_0621117 Ga0436362_0621117_401_1096 231
510 3300046454 Ga0495592_0323100 Ga0495592_0323100_10_705 231
511 3300046460 Ga0495638_0120423 Ga0495638_0120423_468_1163 231
512 3300046462 Ga0495651_0067205 Ga0495651_0067205_739_1434 231
513 3300046477 Ga0495664_0105598 Ga0495664_0105598_708_1403 231
514 3300046501 Ga0495607_0000007 Ga0495607_0000007_50419_51123 231
515 3300046506 Ga0495583_0069063 Ga0495583_0069063_742_1437 231
516 3300046512 Ga0495610_0018929 Ga0495610_0018929_1069_1764 231
517 3300046513 Ga0495616_0047660 Ga0495616_0047660_899_1594 231
518 3300046515 Ga0495620_0024529 Ga0495620_0024529_1216_1911 231
519 3300046518 Ga0495631_0060301 Ga0495631_0060301_537_1232 231
520 3300046524 Ga0495648_0201016 Ga0495648_0201016_25_720 231
521 3300046616 Ga0495668_0085120 Ga0495668_0085120_595_1290 231
522 3300046616 Ga0495668_0232173 Ga0495668_0232173_298_993 231
523 3300046648 Ga0495611_0139750 Ga0495611_0139750_89_784 231
524 3300046663 Ga0495635_0389154 Ga0495635_0389154_109_804 231
525 3300046675 Ga0495657_0174775 Ga0495657_0174775_555_1250 231
526 3300046691 Ga0495670_0119499 Ga0495670_0119499_198_893 231
527 3300046692 Ga0495671_0049040 Ga0495671_0049040_405_1100 231
528 3300046809 Ga0495600_0061389 Ga0495600_0061389_1512_2207 231
529 3300047444 Ga0495675_0451184 Ga0495675_0451184_38_733 231
530 3300048903 Ga0496100_0046421 Ga0496100_0046421_1062_1832 231
531 3300048903 Ga0496100_0254310 Ga0496100_0254310_497_1228 231
532 3300048905 Ga0496102_0002173 Ga0496102_0002173_11941_12672 231
533 3300048905 Ga0496102_0086365 Ga0496102_0086365_1362_2132 231
534 3300048906 Ga0496103_0038357 Ga0496103_0038357_831_1601 231
535 3300048907 Ga0496104_0031262 Ga0496104_0031262_462_1193 231
536 3300048907 Ga0496104_0599746 Ga0496104_0599746_53_823 231
537 3300048908 Ga0496105_0007814 Ga0496105_0007814_6107_6838 231
538 3300048908 Ga0496105_0170813 Ga0496105_0170813_878_1648 231
539 3300048909 Ga0496106_0003947 Ga0496106_0003947_7620_8351 231
540 3300048909 Ga0496106_0050798 Ga0496106_0050798_1581_2351 231
541 3300048909 Ga0496106_0096539 Ga0496106_0096539_1496_2191 231
542 3300048910 Ga0496107_0002755 Ga0496107_0002755_4913_5644 231
543 3300048910 Ga0496107_0023427 Ga0496107_0023427_1347_2117 231
544 3300048911 Ga0496108_0044462 Ga0496108_0044462_1357_2127 231
545 3300048912 Ga0496109_0030271 Ga0496109_0030271_548_1279 231
546 3300048912 Ga0496109_0050679 Ga0496109_0050679_272_1042 231
547 3300048913 Ga0496110_0028973 Ga0496110_0028973_3998_4693 231
548 3300048913 Ga0496110_0360028 Ga0496110_0360028_128_898 231
549 3300048914 Ga0496111_0247491 Ga0496111_0247491_123_893 231
550 3300048914 Ga0496111_0315364 Ga0496111_0315364_64_795 231
551 3300048915 Ga0496112_0000023 Ga0496112_0000023_63870_64565 231
552 3300048915 Ga0496112_0009639 Ga0496112_0009639_3574_4305 231
553 3300048915 Ga0496112_0018433 Ga0496112_0018433_1368_2063 231
554 3300048915 Ga0496112_0103896 Ga0496112_0103896_1459_2229 231
555 3300048915 Ga0496112_0484326 Ga0496112_0484326_424_1119 231
556 3300048916 Ga0496113_0030732 Ga0496113_0030732_995_1726 231
557 3300048916 Ga0496113_0085238 Ga0496113_0085238_1595_2365 231
558 3300048917 Ga0496114_0013788 Ga0496114_0013788_3321_4052 231
559 3300048917 Ga0496114_0031526 Ga0496114_0031526_397_1167 231
560 3300048918 Ga0496115_0041290 Ga0496115_0041290_2402_3133 231
561 3300048918 Ga0496115_0157050 Ga0496115_0157050_1057_1827 231
562 3300048919 Ga0496116_0002981 Ga0496116_0002981_11278_11973 231
563 3300048920 Ga0496117_0031961 Ga0496117_0031961_2854_3549 231
564 3300048920 Ga0496117_0056787 Ga0496117_0056787_390_1085 231
565 3300048920 Ga0496117_0078028 Ga0496117_0078028_1480_2175 231
566 3300048921 Ga0496118_0017807 Ga0496118_0017807_199_894 231
567 3300048921 Ga0496118_0019373 Ga0496118_0019373_2705_3400 231
568 3300048922 Ga0496119_0143571 Ga0496119_0143571_78_773 231
569 3300048923 Ga0496120_0045674 Ga0496120_0045674_44_739 231
570 3300048924 Ga0496121_0000927 Ga0496121_0000927_24186_24884 231
571 3300048924 Ga0496121_0148404 Ga0496121_0148404_493_1188 231
572 3300048924 Ga0496121_0435364 Ga0496121_0435364_71_766 231
573 3300048925 Ga0496122_0021553 Ga0496122_0021553_2553_3248 231
574 3300048925 Ga0496122_0174725 Ga0496122_0174725_583_1278 231
575 3300048926 Ga0496123_0072850 Ga0496123_0072850_673_1368 231
576 3300048926 Ga0496123_0084827 Ga0496123_0084827_573_1268 231
577 3300048927 Ga0496124_0038116 Ga0496124_0038116_886_1581 231
578 3300048927 Ga0496124_0451036 Ga0496124_0451036_149_844 231
579 3300048928 Ga0496125_0003941 Ga0496125_0003941_7202_7897 231
580 3300048928 Ga0496125_0056844 Ga0496125_0056844_1757_2452 231
581 3300048929 Ga0496126_0006232 Ga0496126_0006232_10933_11628 231
582 3300048929 Ga0496126_0041131 Ga0496126_0041131_3207_3902 231
583 3300048929 Ga0496126_0109334 Ga0496126_0109334_547_1242 231
584 3300048929 Ga0496126_0202932 Ga0496126_0202932_703_1398 231
585 3300048929 Ga0496126_0300205 Ga0496126_0300205_523_1218 231
586 3300048929 Ga0496126_0447327 Ga0496126_0447327_55_750 231
587 3300049568 Ga0501031_0127006 Ga0501031_0127006_614_1309 231
588 3300049570 Ga0501033_0245167 Ga0501033_0245167_485_1180 231
589 3300049571 Ga0501034_0132424 Ga0501034_0132424_675_1370 231
590 3300049581 Ga0501047_0029826 Ga0501047_0029826_1768_2463 231
591 3300049581 Ga0501047_0032550 Ga0501047_0032550_2746_3441 231
592 3300049586 Ga0501070_0072317 Ga0501070_0072317_1153_1848 231
593 3300049586 Ga0501070_0541128 Ga0501070_0541128_137_844 231
594 3300049589 Ga0501073_0172852 Ga0501073_0172852_214_909 231
595 3300049590 Ga0501074_0048319 Ga0501074_0048319_970_1665 231
596 3300049742 Ga0501080_0049397 Ga0501080_0049397_2946_3641 231
597 3300049822 Ga0501035_0129494 Ga0501035_0129494_1257_1952 231
598 3300050491 nmdc:mga00v17_31785_c1 nmdc:mga00v17_31785_c1_774_1469 231
599 3300050492 nmdc:mga0yw44_154756_c1 nmdc:mga0yw44_154756_c1_292_987 231
600 3300050492 nmdc:mga0yw44_16705_c2 nmdc:mga0yw44_16705_c2_766_1461 231
601 3300050511 nmdc:mga08y16_401907_c1 nmdc:mga08y16_401907_c1_662_1363 231
602 3300050514 nmdc:mga08x19_93074_c1 nmdc:mga08x19_93074_c1_1197_1892 231
603 3300050516 nmdc:mga0sz30_8457_c1 nmdc:mga0sz30_8457_c1_1979_2674 231
604 3300053079 Ga0500610_0238015 Ga0500610_0238015_59_754 231
605 3300053080 Ga0500635_0018733 Ga0500635_0018733_286_981 231
606 3300053080 Ga0500635_0044873 Ga0500635_0044873_508_1203 231
607 3300053080 Ga0500635_0223493 Ga0500635_0223493_17_712 231
608 3300053088 Ga0500644_0008756 Ga0500644_0008756_680_1375 231
609 3300053093 Ga0500651_0015119 Ga0500651_0015119_3671_4366 231
610 3300053094 Ga0500566_0016743 Ga0500566_0016743_3343_4038 231
611 3300053094 Ga0500566_0212795 Ga0500566_0212795_200_895 231
612 3300053096 Ga0500641_0113174 Ga0500641_0113174_462_1157 231
613 3300053098 Ga0500650_0004546 Ga0500650_0004546_459_1154 231
614 3300053102 Ga0500554_009268 Ga0500554_009268_1241_1936 231
615 3300053102 Ga0500554_009322 Ga0500554_009322_176_871 231
616 3300053104 Ga0500556_0000029 Ga0500556_0000029_55975_56670 231
617 3300053111 Ga0500572_000876 Ga0500572_000876_4347_5042 231
618 3300053116 Ga0500592_000648 Ga0500592_000648_3367_4062 231
619 3300053118 Ga0500594_0005769 Ga0500594_0005769_1356_2051 231
620 3300053119 Ga0500595_001029 Ga0500595_001029_9439_10134 231
621 3300053119 Ga0500595_003049 Ga0500595_003049_5847_6545 231
622 3300053119 Ga0500595_010338 Ga0500595_010338_1084_1863 231
623 3300053121 Ga0500607_025602 Ga0500607_025602_45_740 231
624 3300053130 Ga0500642_0000020 Ga0500642_0000020_57705_58400 231
625 3300053131 Ga0500652_000227 Ga0500652_000227_12804_13499 231
626 3300053136 Ga0500559_0001175 Ga0500559_0001175_2923_3618 231
627 3300053136 Ga0500559_0005368 Ga0500559_0005368_481_1176 231
628 3300053139 Ga0500568_0013591 Ga0500568_0013591_1807_2535 231
629 3300053145 Ga0500586_001025 Ga0500586_001025_308_1003 231
630 3300053150 Ga0500603_000764 Ga0500603_000764_847_1542 231
631 3300053153 Ga0500616_0000112 Ga0500616_0000112_58157_58852 231
632 3300053156 Ga0500622_0001493 Ga0500622_0001493_7490_8185 231
633 3300053177 Ga0500636_0001494 Ga0500636_0001494_1349_2044 231
634 3300053177 Ga0500636_0267473 Ga0500636_0267473_36_731 231
635 3300053178 Ga0500637_0002741 Ga0500637_0002741_6375_7070 231
636 3300053178 Ga0500637_0041163 Ga0500637_0041163_1700_2395 231
637 3300053178 Ga0500637_0090699 Ga0500637_0090699_616_1311 231
638 3300053723 Ga0500567_171323 Ga0500567_171323_21_716 231
639 3300053735 Ga0500596_003575 Ga0500596_003575_1393_2088 231
640 iso_pu_bacteria 2508501128 2509146609 231
641 3300003215 JGI25153J46596_10038959 JGI25153J46596_100389591 232
642 3300005548 Ga0070665_100008468 Ga0070665_10000846812 232
643 3300006944 Ga0099823_1004804 Ga0099823_100480412 232
644 3300025253 Ga0209677_100991 Ga0209677_10099114 232
645 3300028379 Ga0268266_10024242 Ga0268266_100242423 232
646 3300028381 Ga0268264_10716668 Ga0268264_107166681 232
647 3300037418 Ga0395900_0193035 Ga0395900_0193035_700_1398 232
648 3300037471 Ga0395905_0032137 Ga0395905_0032137_55_768 232
649 3300044765 Ga0466970_0145823 Ga0466970_0145823_578_1276 232
650 3300044901 Ga0466960_0033755 Ga0466960_0033755_1625_2323 232
651 3300047472 Ga0495686_0077183 Ga0495686_0077183_116_829 232
652 3300053094 Ga0500566_0015016 Ga0500566_0015016_3666_4364 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22041

GST_C_7

Glutathione S-transferase, C-terminal domain

98

212

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

136

213

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

2

78

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

13

84

0.91

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

120

216

0.9

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

17

79

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yam-assembly2.cif.gz_D crystal structure of lige-apo form from sphingobium sp. strain syk-6 0.9009 2 231
6j3f-assembly1.cif.gz_B crystal structure of the glutathione s-transferase, csgst63524, of ceriporiopsis subvermispora in complex with glutathione 0.8934 1 221
4yam-assembly2.cif.gz_D crystal structure of lige-apo form from sphingobium sp. strain syk-6 0.89 2 231
6j3f-assembly1.cif.gz_B crystal structure of the glutathione s-transferase, csgst63524, of ceriporiopsis subvermispora in complex with glutathione 0.8504 1 221
4o7h-assembly1.cif.gz_A crystal structure of a glutathione s-transferase from rhodospirillum rubrum f11, target efi-507460 0.8061 3 218
ID Description Score Start End Superfamily
af_A0A0R0JER7_1_73_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8871 19 86 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8803 2 84 3.40.30.10
4isdD01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8707 1 81 3.40.30.10
4lmwA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8679 1 87 3.40.30.10
af_Q9FHX0_75_159_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8646 2 80 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2U3PUU6-F1-model_v4 LigE protein 0.9998 1 232 GO:0005737
AF-A0A2U3PT86-F1-model_v4 LigE protein 0.9995 1 232 GO:0005737
AF-A0A7Y9UE98-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9993 1 232 GO:0004364
GO:0005737
GO:0006749
GO:0045174
AF-A0A1X3HCQ7-F1-model_v4 Glutathione S-transferase 0.999 1 232 GO:0005737
GO:0016740
AF-A0A5S4WU61-F1-model_v4 Glutathione S-transferase family protein 0.9988 1 232 GO:0004364
GO:0005737
GO:0006749
GO:0045174

Feature Viewer

pLDDT pTM Quality
96.52 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map