F472660

General Info

Members Datasets Scaffolds Average Seq Length
652 310 1304 189

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100021937|Ga0070682_1000219374
Length 221
Sequence MGARPLFFKPLKGEIKTMKIFTNHRYALVTGIVLAIALSVVLTHSLLPPDSVWNQLSLARWVHIVSGVFWIGLLYYFNAVQTPALADAAADKGGPGGAGVNKYVAPRALFWFRWSALATWLAGAWLLSERFVPAFTFGYSNGSHDYSTVVIGIGAWLGTIMLLNVWGIIWPNQKKILGIKPATDEEKAAARKAALYASRTNFILSIPMLMCMAATSHGLPI

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
211 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
212 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 3.53
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100021937 3300005337 Bacteria 3775
2 JGI25406J46586_10004992 3300003203 Bacteria 6159
3 rootH2_10124354 3300003320 Bacteria 1542
4 rootL2_10154466 3300003322 Bacteria 1935
5 Ga0070676_10005738 3300005328 Bacteria 6616
6 Ga0070676_10298922 3300005328 Bacteria 1090
7 Ga0070676_10342277 3300005328 Bacteria 1026
8 Ga0070676_10344733 3300005328 Bacteria 1023
9 Ga0070690_100064525 3300005330 Bacteria 2366
10 Ga0070670_100000019 3300005331 Bacteria 215812
11 Ga0070670_100015246 3300005331 Bacteria 6597
12 Ga0070670_100089378 3300005331 Bacteria 2648
13 Ga0070670_100119261 3300005331 Bacteria 2275
14 Ga0070677_10009056 3300005333 Bacteria 3369
15 Ga0070677_10011349 3300005333 Bacteria 3071
16 Ga0070677_10063224 3300005333 Bacteria 1534
17 Ga0070677_10098723 3300005333 Bacteria 1284
18 Ga0068869_100022527 3300005334 Bacteria 4342
19 Ga0068869_100223321 3300005334 Bacteria 1494
20 Ga0070666_10001795 3300005335 Bacteria 13075
21 Ga0070666_10025771 3300005335 Bacteria 3836
22 Ga0070666_10047327 3300005335 Bacteria 2887
23 Ga0070682_100118264 3300005337 Bacteria 1775
24 Ga0068868_100000774 3300005338 Bacteria 21630
25 Ga0068868_100388488 3300005338 Bacteria 1202
26 Ga0070689_100380742 3300005340 Bacteria 1189
27 Ga0070689_100611841 3300005340 Bacteria 944
28 Ga0070668_100008748 3300005347 Bacteria 7521
29 Ga0070668_100282229 3300005347 Bacteria 1387
30 Ga0070668_100395099 3300005347 Bacteria 1179
31 Ga0070669_100001056 3300005353 Bacteria 20146
32 Ga0070669_100024856 3300005353 Bacteria 4299
33 Ga0070669_100158335 3300005353 Bacteria 1758
34 Ga0070669_100311238 3300005353 Bacteria 1269
35 Ga0070669_100349720 3300005353 Bacteria 1199
36 Ga0070675_100009354 3300005354 Bacteria 7622
37 Ga0070675_100098139 3300005354 Bacteria 2463
38 Ga0070675_100209210 3300005354 Bacteria 1695
39 Ga0070675_100267879 3300005354 Bacteria 1498
40 Ga0070675_100777578 3300005354 Bacteria 874
41 Ga0070671_100000057 3300005355 Bacteria 74958
42 Ga0070671_100010434 3300005355 Bacteria 7452
43 Ga0070671_100077102 3300005355 Bacteria 2785
44 Ga0070674_100056320 3300005356 Bacteria 2726
45 Ga0070674_100060904 3300005356 Bacteria 2632
46 Ga0070674_100066091 3300005356 Bacteria 2540
47 Ga0070674_100402684 3300005356 Bacteria 1118
48 Ga0070674_100429834 3300005356 Bacteria 1085
49 Ga0070674_100813998 3300005356 Bacteria 807
50 Ga0070673_100041222 3300005364 Bacteria 3548
51 Ga0070673_100054630 3300005364 Bacteria 3142
52 Ga0070673_100645492 3300005364 Bacteria 968
53 Ga0070688_100014689 3300005365 Bacteria 4441
54 Ga0070667_100000020 3300005367 Bacteria 215812
55 Ga0070667_100000504 3300005367 Bacteria 39552
56 Ga0070667_100017376 3300005367 Bacteria 5961
57 Ga0070667_100023570 3300005367 Bacteria 5108
58 Ga0070667_101124300 3300005367 Bacteria 734
59 Ga0070709_10014003 3300005434 Bacteria 4525
60 Ga0070714_100205362 3300005435 Bacteria 1804
61 Ga0070714_100377358 3300005435 Bacteria 1336
62 Ga0070713_100020502 3300005436 Bacteria 5069
63 Ga0070710_10165009 3300005437 Bacteria 1376
64 Ga0070710_10230149 3300005437 Bacteria 1183
65 Ga0070710_10382865 3300005437 Bacteria 939
66 Ga0070701_10316929 3300005438 Bacteria 964
67 Ga0070711_100008338 3300005439 Bacteria 6343
68 Ga0070711_100089947 3300005439 Bacteria 2210
69 Ga0070711_100118549 3300005439 Bacteria 1954
70 Ga0070711_100158678 3300005439 Bacteria 1713
71 Ga0070705_100457539 3300005440 Bacteria 959
72 Ga0070700_100011147 3300005441 Bacteria 4974
73 Ga0070694_100123766 3300005444 Bacteria 1859
74 Ga0070678_100003217 3300005456 Bacteria 9065
75 Ga0070678_100003815 3300005456 Bacteria 8455
76 Ga0070678_100018471 3300005456 Bacteria 4520
77 Ga0070678_100020153 3300005456 Bacteria 4369
78 Ga0070662_100059198 3300005457 Bacteria 2790
79 Ga0070662_100352807 3300005457 Bacteria 1205
80 Ga0070662_100360393 3300005457 Bacteria 1193
81 Ga0070681_10000780 3300005458 Bacteria 26509
82 Ga0070681_10314565 3300005458 Bacteria 1475
83 Ga0068867_100002175 3300005459 Bacteria 13763
84 Ga0068867_100031329 3300005459 Bacteria 3838
85 Ga0070685_10000015 3300005466 Bacteria 115963
86 Ga0070685_10007518 3300005466 Bacteria 5578
87 Ga0070685_10062787 3300005466 Bacteria 2179
88 Ga0070685_10094509 3300005466 Bacteria 1816
89 Ga0070698_100747246 3300005471 Bacteria 921
90 Ga0070699_100022263 3300005518 Bacteria 5461
91 Ga0070699_100296173 3300005518 Bacteria 1451
92 Ga0070679_100068569 3300005530 Bacteria 3538
93 Ga0070684_100363452 3300005535 Bacteria 1332
94 Ga0068853_100353786 3300005539 Bacteria 1367
95 Ga0070672_100004277 3300005543 Bacteria 9333
96 Ga0070672_100284657 3300005543 Bacteria 1398
97 Ga0070672_100333492 3300005543 Bacteria 1291
98 Ga0070672_100837530 3300005543 Bacteria 810
99 Ga0070695_100056611 3300005545 Bacteria 2531
100 Ga0070695_100654716 3300005545 Bacteria 830
101 Ga0070695_101025734 3300005545 Bacteria 672
102 Ga0070696_100053654 3300005546 Bacteria 2807
103 Ga0070693_100003077 3300005547 Bacteria 7741
104 Ga0070693_100087953 3300005547 Bacteria 1867
105 Ga0070665_100002424 3300005548 Bacteria 20557
106 Ga0070665_100011037 3300005548 Bacteria 9131
107 Ga0070665_100066682 3300005548 Bacteria 3610
108 Ga0070665_100621926 3300005548 Bacteria 1093
109 Ga0068855_100000430 3300005563 Bacteria 51996
110 Ga0068857_100209924 3300005577 Bacteria 1777
111 Ga0068854_100145218 3300005578 Bacteria 1824
112 Ga0068854_100301799 3300005578 Bacteria 1296
113 Ga0068852_100179958 3300005616 Bacteria 1987
114 Ga0068859_100003579 3300005617 Bacteria 15826
115 Ga0068859_100016819 3300005617 Bacteria 7343
116 Ga0068859_100582462 3300005617 Bacteria 1212
117 Ga0068859_101216982 3300005617 Bacteria 829
118 Ga0068864_100000030 3300005618 Bacteria 215812
119 Ga0068864_100112592 3300005618 Bacteria 2425
120 Ga0068864_100178309 3300005618 Bacteria 1941
121 Ga0068864_100356417 3300005618 Bacteria 1381
122 Ga0068866_10091194 3300005718 Bacteria 1660
123 Ga0068861_100003202 3300005719 Bacteria 10830
124 Ga0068861_100014058 3300005719 Bacteria 5613
125 Ga0068861_100045536 3300005719 Bacteria 3304
126 Ga0068861_100219333 3300005719 Bacteria 1607
127 Ga0068870_10038811 3300005840 Bacteria 2461
128 Ga0068863_100006174 3300005841 Bacteria 11752
129 Ga0068863_100039319 3300005841 Bacteria 4501
130 Ga0068863_100463619 3300005841 Bacteria 1244
131 Ga0068863_100485480 3300005841 Bacteria 1215
132 Ga0068863_100819914 3300005841 Bacteria 928
133 Ga0068863_100915053 3300005841 Bacteria 878
134 Ga0068863_101020909 3300005841 Bacteria 830
135 Ga0068858_100011271 3300005842 Bacteria 8448
136 Ga0068858_100016508 3300005842 Bacteria 6934
137 Ga0068858_100070267 3300005842 Bacteria 3245
138 Ga0068858_100152191 3300005842 Bacteria 2175
139 Ga0068858_100500735 3300005842 Bacteria 1174
140 Ga0068858_100660409 3300005842 Bacteria 1016
141 Ga0068860_100002991 3300005843 Bacteria 17457
142 Ga0068860_100009754 3300005843 Bacteria 9533
143 Ga0068860_100021076 3300005843 Bacteria 6313
144 Ga0068860_100412004 3300005843 Bacteria 1338
145 Ga0068862_100001079 3300005844 Bacteria 26085
146 Ga0068862_100047718 3300005844 Bacteria 3656
147 Ga0068862_100078096 3300005844 Bacteria 2867
148 Ga0068862_100180056 3300005844 Bacteria 1896
149 Ga0081455_10000055 3300005937 Bacteria 121650
150 Ga0081455_10012540 3300005937 Bacteria 8456
151 Ga0081539_10000123 3300005985 Bacteria 181245
152 Ga0070717_10762139 3300006028 Bacteria 880
153 Ga0070715_10001938 3300006163 Bacteria 6227
154 Ga0070716_100006698 3300006173 Bacteria 5642
155 Ga0070716_100015315 3300006173 Bacteria 3938
156 Ga0070716_100716729 3300006173 Bacteria 766
157 Ga0070712_100001529 3300006175 Bacteria 14111
158 Ga0070712_100098219 3300006175 Bacteria 2160
159 Ga0097621_100084778 3300006237 Bacteria 2642
160 Ga0097621_100090513 3300006237 Bacteria 2560
161 Ga0068871_100003468 3300006358 Bacteria 10838
162 Ga0068871_100024330 3300006358 Bacteria 4695
163 Ga0068871_100219096 3300006358 Bacteria 1648
164 Ga0068871_100388968 3300006358 Bacteria 1240
165 Ga0068871_100451545 3300006358 Unclassified 1152
166 Ga0075428_100267170 3300006844 Bacteria 1841
167 Ga0075433_10152972 3300006852 Bacteria 2052
168 Ga0075434_100385091 3300006871 Bacteria 1423
169 Ga0068865_100005671 3300006881 Bacteria 7580
170 Ga0068865_100020283 3300006881 Bacteria 4310
171 Ga0068865_100045541 3300006881 Bacteria 3007
172 Ga0068865_100129992 3300006881 Bacteria 1885
173 Ga0097620_100003579 3300006931 Bacteria 15826
174 Ga0097620_100016819 3300006931 Bacteria 7343
175 Ga0097620_100582447 3300006931 Bacteria 1212
176 Ga0097620_101216933 3300006931 Bacteria 829
177 Ga0105240_10010706 3300009093 Bacteria 12871
178 Ga0105240_10033308 3300009093 Bacteria 6659
179 Ga0105240_10078973 3300009093 Bacteria 4051
180 Ga0105240_10129965 3300009093 Bacteria 3022
181 Ga0105240_10247427 3300009093 Bacteria 2064
182 Ga0105240_10924506 3300009093 Bacteria 937
183 Ga0111539_10050983 3300009094 Bacteria 4930
184 Ga0111539_10808026 3300009094 Bacteria 1091
185 Ga0105245_10005670 3300009098 Bacteria 10973
186 Ga0105245_10160678 3300009098 Bacteria 2132
187 Ga0105245_10703161 3300009098 Bacteria 1044
188 Ga0105247_10072204 3300009101 Bacteria 2160
189 Ga0105247_10104688 3300009101 Bacteria 1813
190 Ga0105247_10121256 3300009101 Bacteria 1694
191 Ga0114129_10052579 3300009147 Bacteria 5717
192 Ga0105243_10055209 3300009148 Bacteria 3156
193 Ga0105243_10090142 3300009148 Bacteria 2523
194 Ga0105243_10496111 3300009148 Bacteria 1156
195 Ga0105241_10116431 3300009174 Bacteria 2146
196 Ga0105241_10120853 3300009174 Bacteria 2109
197 Ga0105242_10004242 3300009176 Bacteria 11176
198 Ga0105248_10007618 3300009177 Bacteria 11894
199 Ga0105248_10034267 3300009177 Bacteria 5676
200 Ga0105248_10091153 3300009177 Bacteria 3433
201 Ga0105248_10521882 3300009177 Bacteria 1339
202 Ga0105248_11039342 3300009177 Bacteria 925
203 Ga0105237_10025128 3300009545 Bacteria 6093
204 Ga0105237_10328341 3300009545 Bacteria 1534
205 Ga0105238_11244058 3300009551 Bacteria 769
206 Ga0105249_10040834 3300009553 Bacteria 4216
207 Ga0105249_10169993 3300009553 Bacteria 2113
208 Ga0105249_10264765 3300009553 Bacteria 1710
209 Ga0099796_10005395 3300010159 Bacteria 3189
210 Ga0105239_10031593 3300010375 Bacteria 5821
211 Ga0105239_10049426 3300010375 Bacteria 4612
212 Ga0157369_10153494 3300013105 Unclassified 2433
213 Ga0157374_10000346 3300013296 Bacteria 42858
214 Ga0157374_10033956 3300013296 Bacteria 4657
215 Ga0157374_10176496 3300013296 Bacteria 2085
216 Ga0157378_10113038 3300013297 Bacteria 2492
217 Ga0157378_10417137 3300013297 Bacteria 1326
218 Ga0163162_10012637 3300013306 Bacteria 8244
219 Ga0163162_10015294 3300013306 Bacteria 7496
220 Ga0157372_10365485 3300013307 Bacteria 1681
221 Ga0157375_10039460 3300013308 Bacteria 4545
222 Ga0157375_10089727 3300013308 Bacteria 3131
223 Ga0157375_10277365 3300013308 Bacteria 1839
224 Ga0157375_11374838 3300013308 Bacteria 831
225 Ga0163163_10000115 3300014325 Bacteria 85945
226 Ga0163163_10011644 3300014325 Bacteria 7989
227 Ga0163163_10109681 3300014325 Bacteria 2787
228 Ga0163163_10129159 3300014325 Bacteria 2567
229 Ga0163163_10342497 3300014325 Bacteria 1550
230 Ga0163163_10363306 3300014325 Bacteria 1504
231 Ga0163163_11063424 3300014325 Bacteria 872
232 Ga0157380_10010851 3300014326 Bacteria 6568
233 Ga0157380_10108920 3300014326 Bacteria 2323
234 Ga0157380_10110095 3300014326 Bacteria 2312
235 Ga0157380_11313683 3300014326 Bacteria 771
236 Ga0157379_10023248 3300014968 Bacteria 5498
237 Ga0157379_10034828 3300014968 Bacteria 4490
238 Ga0157379_10040450 3300014968 Bacteria 4161
239 Ga0157379_10054481 3300014968 Bacteria 3573
240 Ga0157379_10708250 3300014968 Unclassified 945
241 Ga0157376_10091553 3300014969 Bacteria 2634
242 Ga0157376_10459696 3300014969 Bacteria 1243
243 Ga0163161_10020781 3300017792 Bacteria 4609
244 Ga0163161_10062315 3300017792 Bacteria 2716
245 Ga0224712_10039613 3300022467 Unclassified 1768
246 Ga0228600_1010116 3300024123 Bacteria 728
247 Ga0207697_10026790 3300025315 Bacteria 2357
248 Ga0207682_10002442 3300025893 Bacteria 8338
249 Ga0207682_10025024 3300025893 Bacteria 2366
250 Ga0207682_10069246 3300025893 Bacteria 1492
251 Ga0207692_10043146 3300025898 Bacteria 2242
252 Ga0207692_10462034 3300025898 Bacteria 801
253 Ga0207642_10006047 3300025899 Bacteria 3999
254 Ga0207642_10118486 3300025899 Bacteria 1361
255 Ga0207710_10006402 3300025900 Bacteria 5031
256 Ga0207710_10036564 3300025900 Bacteria 2165
257 Ga0207688_10138977 3300025901 Bacteria 1429
258 Ga0207680_10030777 3300025903 Bacteria 3032
259 Ga0207680_10032455 3300025903 Bacteria 2969
260 Ga0207680_10058322 3300025903 Bacteria 2339
261 Ga0207680_10161052 3300025903 Bacteria 1504
262 Ga0207680_10759998 3300025903 Bacteria 695
263 Ga0207685_10006949 3300025905 Bacteria 3120
264 Ga0207699_10015333 3300025906 Bacteria 3978
265 Ga0207645_10000431 3300025907 Bacteria 34728
266 Ga0207645_10057291 3300025907 Bacteria 2488
267 Ga0207645_10340532 3300025907 Bacteria 1002
268 Ga0207645_10350259 3300025907 Bacteria 988
269 Ga0207643_10042967 3300025908 Bacteria 2549
270 Ga0207654_10042001 3300025911 Bacteria 2586
271 Ga0207654_10202412 3300025911 Bacteria 1308
272 Ga0207707_10004164 3300025912 Bacteria 12811
273 Ga0207707_10127423 3300025912 Bacteria 2226
274 Ga0207695_10037827 3300025913 Bacteria 5203
275 Ga0207695_10048952 3300025913 Bacteria 4459
276 Ga0207695_10058206 3300025913 Bacteria 4012
277 Ga0207695_10068626 3300025913 Bacteria 3632
278 Ga0207695_10101015 3300025913 Bacteria 2879
279 Ga0207695_10671255 3300025913 Bacteria 917
280 Ga0207671_10055347 3300025914 Bacteria 2939
281 Ga0207671_10344423 3300025914 Bacteria 1181
282 Ga0207693_10000391 3300025915 Bacteria 40291
283 Ga0207693_10084792 3300025915 Bacteria 2482
284 Ga0207693_10125493 3300025915 Bacteria 2017
285 Ga0207663_10061366 3300025916 Bacteria 2385
286 Ga0207663_10071997 3300025916 Bacteria 2232
287 Ga0207663_10407227 3300025916 Bacteria 1041
288 Ga0207660_10081751 3300025917 Bacteria 2375
289 Ga0207681_10016711 3300025923 Bacteria 4597
290 Ga0207681_10022759 3300025923 Bacteria 4000
291 Ga0207681_10056355 3300025923 Bacteria 2680
292 Ga0207681_10255019 3300025923 Bacteria 1371
293 Ga0207681_10788192 3300025923 Bacteria 793
294 Ga0207650_10000034 3300025925 Bacteria 215826
295 Ga0207650_10012765 3300025925 Bacteria 5804
296 Ga0207650_10206153 3300025925 Bacteria 1577
297 Ga0207659_10029040 3300025926 Bacteria 3764
298 Ga0207659_10044259 3300025926 Bacteria 3131
299 Ga0207659_10061264 3300025926 Bacteria 2711
300 Ga0207659_10109244 3300025926 Bacteria 2099
301 Ga0207659_10295630 3300025926 Bacteria 1328
302 Ga0207659_10386790 3300025926 Bacteria 1168
303 Ga0207687_10093466 3300025927 Bacteria 2199
304 Ga0207687_10349243 3300025927 Bacteria 1205
305 Ga0207700_10034840 3300025928 Unclassified 3619
306 Ga0207700_10152460 3300025928 Bacteria 1911
307 Ga0207664_10741627 3300025929 Bacteria 883
308 Ga0207664_10764079 3300025929 Bacteria 869
309 Ga0207644_10000208 3300025931 Bacteria 40880
310 Ga0207644_10395427 3300025931 Bacteria 1129
311 Ga0207690_10225703 3300025932 Bacteria 1435
312 Ga0207690_10623748 3300025932 Bacteria 882
313 Ga0207706_10040763 3300025933 Bacteria 4116
314 Ga0207706_10203843 3300025933 Bacteria 1735
315 Ga0207686_10001782 3300025934 Bacteria 11984
316 Ga0207686_10135787 3300025934 Bacteria 1693
317 Ga0207686_10200786 3300025934 Bacteria 1428
318 Ga0207670_10156374 3300025936 Bacteria 1698
319 Ga0207670_10250205 3300025936 Bacteria 1369
320 Ga0207670_10720189 3300025936 Bacteria 827
321 Ga0207669_10244748 3300025937 Bacteria 1331
322 Ga0207704_10016229 3300025938 Bacteria 3822
323 Ga0207704_10078609 3300025938 Bacteria 2122
324 Ga0207704_10165242 3300025938 Bacteria 1580
325 Ga0207665_10003007 3300025939 Bacteria 11320
326 Ga0207665_10007306 3300025939 Bacteria 7307
327 Ga0207665_10460837 3300025939 Bacteria 977
328 Ga0207691_10012433 3300025940 Bacteria 8161
329 Ga0207691_10015804 3300025940 Bacteria 7172
330 Ga0207691_10124466 3300025940 Bacteria 2282
331 Ga0207691_10177711 3300025940 Bacteria 1861
332 Ga0207691_10315596 3300025940 Bacteria 1341
333 Ga0207691_10709493 3300025940 Bacteria 848
334 Ga0207711_10001721 3300025941 Bacteria 20121
335 Ga0207711_10051467 3300025941 Bacteria 3527
336 Ga0207711_10136975 3300025941 Bacteria 2199
337 Ga0207711_10225818 3300025941 Bacteria 1714
338 Ga0207711_10741635 3300025941 Bacteria 916
339 Ga0207689_10027587 3300025942 Bacteria 4751
340 Ga0207689_10037680 3300025942 Bacteria 4009
341 Ga0207689_10183094 3300025942 Bacteria 1727
342 Ga0207689_10237273 3300025942 Bacteria 1507
343 Ga0207661_10070201 3300025944 Bacteria 2859
344 Ga0207679_10264064 3300025945 Bacteria 1470
345 Ga0207679_10637281 3300025945 Bacteria 963
346 Ga0207667_10003985 3300025949 Bacteria 18151
347 Ga0207667_11210056 3300025949 Bacteria 735
348 Ga0207651_10015618 3300025960 Bacteria 4419
349 Ga0207651_10341835 3300025960 Bacteria 1257
350 Ga0207651_10792650 3300025960 Bacteria 840
351 Ga0207712_10040748 3300025961 Bacteria 3189
352 Ga0207668_10010200 3300025972 Bacteria 5669
353 Ga0207668_10824193 3300025972 Bacteria 822
354 Ga0207668_10840537 3300025972 Bacteria 815
355 Ga0207640_10013939 3300025981 Bacteria 4616
356 Ga0207658_10000015 3300025986 Bacteria 215826
357 Ga0207658_10000605 3300025986 Bacteria 31883
358 Ga0207658_10010772 3300025986 Bacteria 6219
359 Ga0207658_10023555 3300025986 Bacteria 4299
360 Ga0207658_10100637 3300025986 Bacteria 2263
361 Ga0207658_10479730 3300025986 Bacteria 1105
362 Ga0207658_10927269 3300025986 Bacteria 793
363 Ga0207658_11399253 3300025986 Bacteria 640
364 Ga0207677_10003049 3300026023 Bacteria 8859
365 Ga0207677_10461481 3300026023 Bacteria 1090
366 Ga0207703_10030281 3300026035 Bacteria 4276
367 Ga0207703_10053661 3300026035 Bacteria 3277
368 Ga0207703_10066543 3300026035 Bacteria 2964
369 Ga0207703_10328725 3300026035 Bacteria 1402
370 Ga0207639_10123590 3300026041 Bacteria 2131
371 Ga0207678_10077837 3300026067 Bacteria 2840
372 Ga0207678_10089047 3300026067 Bacteria 2638
373 Ga0207708_10007791 3300026075 Bacteria 7930
374 Ga0207641_10001115 3300026088 Bacteria 27013
375 Ga0207641_10021917 3300026088 Bacteria 5252
376 Ga0207641_10041265 3300026088 Bacteria 3866
377 Ga0207641_10171786 3300026088 Bacteria 1979
378 Ga0207641_10340369 3300026088 Bacteria 1427
379 Ga0207641_10439839 3300026088 Bacteria 1258
380 Ga0207641_10517873 3300026088 Bacteria 1160
381 Ga0207641_10659621 3300026088 Bacteria 1028
382 Ga0207641_10741397 3300026088 Bacteria 969
383 Ga0207641_10879521 3300026088 Bacteria 889
384 Ga0207648_10000306 3300026089 Bacteria 53612
385 Ga0207648_10020718 3300026089 Bacteria 5919
386 Ga0207648_10257340 3300026089 Bacteria 1557
387 Ga0207648_10460335 3300026089 Bacteria 1159
388 Ga0207676_10000032 3300026095 Bacteria 215826
389 Ga0207676_10040466 3300026095 Bacteria 3572
390 Ga0207676_10048418 3300026095 Bacteria 3300
391 Ga0207676_10180904 3300026095 Bacteria 1846
392 Ga0207675_100030249 3300026118 Bacteria 5043
393 Ga0207675_100042232 3300026118 Bacteria 4256
394 Ga0207675_100098343 3300026118 Bacteria 2756
395 Ga0207675_100231685 3300026118 Bacteria 1782
396 Ga0207675_100888106 3300026118 Unclassified 907
397 Ga0207675_100902111 3300026118 Bacteria 900
398 Ga0207683_10000661 3300026121 Bacteria 31642
399 Ga0207683_10002242 3300026121 Bacteria 16990
400 Ga0207683_10005085 3300026121 Bacteria 11287
401 Ga0207683_10074668 3300026121 Bacteria 3000
402 Ga0207683_11733300 3300026121 Bacteria 574
403 Ga0207428_10368685 3300027907 Bacteria 1055
404 Ga0268266_10001574 3300028379 Bacteria 26660
405 Ga0268266_10002609 3300028379 Bacteria 19094
406 Ga0268266_10047856 3300028379 Bacteria 3664
407 Ga0268266_10112656 3300028379 Bacteria 2412
408 Ga0268266_10120319 3300028379 Bacteria 2336
409 Ga0268266_10181368 3300028379 Bacteria 1917
410 Ga0268265_10001053 3300028380 Bacteria 24777
411 Ga0268265_10073680 3300028380 Bacteria 2668
412 Ga0268265_10712599 3300028380 Bacteria 970
413 Ga0268264_10006666 3300028381 Bacteria 9714
414 Ga0268264_10023327 3300028381 Bacteria 5048
415 Ga0268264_10134281 3300028381 Bacteria 2198
416 Ga0268264_10292793 3300028381 Bacteria 1529
417 Ga0265319_1008465 3300028563 Bacteria 4504
418 Ga0265334_10000962 3300028573 Bacteria 14343
419 Ga0265318_10000307 3300028577 Bacteria 39350
420 Ga0265338_10007913 3300028800 Bacteria 13025
421 Ga0265338_10010202 3300028800 Bacteria 11070
422 Ga0265330_10007440 3300031235 Bacteria 5335
423 Ga0265332_10001276 3300031238 Bacteria 14408
424 Ga0265328_10005468 3300031239 Bacteria 5439
425 Ga0265320_10003267 3300031240 Bacteria 10950
426 Ga0265325_10002916 3300031241 Bacteria 11398
427 Ga0265329_10004645 3300031242 Bacteria 5665
428 Ga0265340_10091512 3300031247 Bacteria 1421
429 Ga0265339_10075491 3300031249 Bacteria 1789
430 Ga0265331_10005730 3300031250 Bacteria 7449
431 Ga0265327_10000845 3300031251 Bacteria 45701
432 Ga0265316_10001817 3300031344 Bacteria 22436
433 Ga0307513_10025089 3300031456 Bacteria 6918
434 Ga0307513_10144339 3300031456 Bacteria 2301
435 Ga0307513_10222032 3300031456 Bacteria 1710
436 Ga0307509_10009918 3300031507 Bacteria 11769
437 Ga0307408_100131166 3300031548 Unclassified 1955
438 Ga0307408_100388875 3300031548 Bacteria 1194
439 Ga0307408_100493289 3300031548 Bacteria 1071
440 Ga0307408_100797494 3300031548 Bacteria 857
441 Ga0265313_10001839 3300031595 Bacteria 19345
442 Ga0265314_10006148 3300031711 Bacteria 10670
443 Ga0265342_10003586 3300031712 Bacteria 12666
444 Ga0316576_10075326 3300031727 Unclassified 2496
445 Ga0316578_10009004 3300031728 Bacteria 5110
446 Ga0307405_10151561 3300031731 Bacteria 1631
447 Ga0307405_10231079 3300031731 Bacteria 1364
448 Ga0307413_10071249 3300031824 Bacteria 2189
449 Ga0307410_10002475 3300031852 Bacteria 8924
450 Ga0307410_10003350 3300031852 Bacteria 8025
451 Ga0307410_10037432 3300031852 Bacteria 3169
452 Ga0307406_10078876 3300031901 Bacteria 2183
453 Ga0307406_10668206 3300031901 Bacteria 864
454 Ga0307407_10026134 3300031903 Bacteria 3088
455 Ga0307407_10537361 3300031903 Bacteria 862
456 Ga0307412_10246136 3300031911 Bacteria 1386
457 Ga0307409_100169112 3300031995 Bacteria 1922
458 Ga0307409_100814568 3300031995 Bacteria 942
459 Ga0307409_100900070 3300031995 Bacteria 898
460 Ga0307409_101215071 3300031995 Bacteria 777
461 Ga0307416_100105822 3300032002 Bacteria 2464
462 Ga0307416_100180896 3300032002 Bacteria 1976
463 Ga0307416_100445418 3300032002 Bacteria 1346
464 Ga0307416_100583040 3300032002 Bacteria 1196
465 Ga0307414_10645141 3300032004 Bacteria 954
466 Ga0307411_10005848 3300032005 Bacteria 6097
467 Ga0307411_10316805 3300032005 Bacteria 1258
468 Ga0307415_100091084 3300032126 Bacteria 2208
469 Ga0307415_100097364 3300032126 Bacteria 2147
470 Ga0307415_100299328 3300032126 Bacteria 1332
471 Ga0307415_101188345 3300032126 Bacteria 718
472 Ga0373923_0180808 3300035111 Bacteria 969
473 Ga0373945_0131411 3300035116 Bacteria 1003
474 Ga0373954_0112659 3300035118 Bacteria 1317
475 Ga0373956_0290487 3300035119 Bacteria 778
476 Ga0373957_0136002 3300035120 Unclassified 1003
477 Ga0373957_0183129 3300035120 Bacteria 869
478 Ga0373943_0474916 3300035170 Bacteria 729
479 Ga0373955_0098549 3300035172 Bacteria 1675
480 Ga0373955_0149237 3300035172 Bacteria 1375
481 Ga0316574_0000782 3300035398 Bacteria 13753
482 Ga0316574_0105317 3300035398 Bacteria 1806
483 Ga0373935_0281648 3300035692 Bacteria 1171
484 Ga0373927_0236066 3300035695 Bacteria 1201
485 Ga0373933_0035165 3300035724 Bacteria 2925
486 Ga0373933_0075298 3300035724 Bacteria 2061
487 Ga0373933_0118583 3300035724 Bacteria 1656
488 Ga0373947_0034493 3300035725 Bacteria 2993
489 Ga0373937_0005753 3300036401 Bacteria 10653
490 Ga0373937_0009036 3300036401 Bacteria 8651
491 Ga0373937_0089633 3300036401 Bacteria 2848
492 Ga0373937_0134030 3300036401 Bacteria 2315
493 Ga0316582_0003987 3300036647 Bacteria 7378
494 Ga0316584_0169183 3300036712 Bacteria 1622
495 Ga0373925_0103929 3300037068 Bacteria 2187
496 Ga0373925_0460260 3300037068 Bacteria 1042
497 Ga0436360_0410680 3300039438 Bacteria 2073
498 Ga0451797_0621749 3300041453 Bacteria 1689
499 Ga0451797_1524824 3300041453 Bacteria 1078
500 Ga0451800_1481369 3300041459 Unclassified 696
501 Ga0451802_0445547 3300041460 Bacteria 1177
502 Ga0451802_0857606 3300041460 Bacteria 2341
503 Ga0451807_2204375 3300041486 Bacteria 1864
504 Ga0450894_004198 3300042131 Bacteria 1877
505 Ga0450895_002340 3300042132 Unclassified 1406
506 Ga0450896_007897 3300042133 Bacteria 1470
507 Ga0439446_0004514 3300042156 Bacteria 3527
508 Ga0439446_0027057 3300042156 Bacteria 1645
509 Ga0466969_0001742 3300044656 Bacteria 11601
510 Ga0466969_0003007 3300044656 Bacteria 8982
511 Ga0466969_0020026 3300044656 Bacteria 3468
512 Ga0466966_0000375 3300044684 Bacteria 29156
513 Ga0466966_0034133 3300044684 Bacteria 3292
514 Ga0466961_0001014 3300044693 Bacteria 17335
515 Ga0466971_0000522 3300044719 Bacteria 15195
516 Ga0466968_0023687 3300044735 Bacteria 2503
517 Ga0466970_0001081 3300044765 Bacteria 13196
518 Ga0466957_0131786 3300044842 Bacteria 1602
519 Ga0466959_0002673 3300045049 Bacteria 11440
520 Ga0466959_0009045 3300045049 Bacteria 7066
521 Ga0466959_0058821 3300045049 Bacteria 2799
522 Ga0495638_0169769 3300046460 Bacteria 1252
523 Ga0495580_0022667 3300046472 Bacteria 4617
524 Ga0495580_0373883 3300046472 Bacteria 963
525 Ga0495639_0010217 3300046475 Bacteria 4039
526 Ga0495639_0131799 3300046475 Bacteria 1197
527 Ga0495662_0117778 3300046476 Bacteria 1303
528 Ga0495664_0332550 3300046477 Bacteria 916
529 Ga0495616_0036821 3300046513 Bacteria 2522
530 Ga0495616_0114064 3300046513 Bacteria 1253
531 Ga0495628_0172008 3300046516 Bacteria 1642
532 Ga0495630_0093483 3300046517 Bacteria 2273
533 Ga0495632_0037844 3300046519 Bacteria 2445
534 Ga0495632_0045619 3300046519 Bacteria 2182
535 Ga0495632_0340695 3300046519 Bacteria 660
536 Ga0495644_0003659 3300046523 Bacteria 6058
537 Ga0495598_0007337 3300046537 Bacteria 2526
538 Ga0495621_0002064 3300046539 Bacteria 5318
539 Ga0495645_0287127 3300046543 Bacteria 1080
540 Ga0495622_0238187 3300046557 Bacteria 803
541 Ga0495633_0158470 3300046558 Bacteria 1044
542 Ga0495668_0257322 3300046616 Bacteria 955
543 Ga0495625_0023718 3300046660 Bacteria 4683
544 Ga0495625_0252563 3300046660 Bacteria 1144
545 Ga0495625_0289526 3300046660 Bacteria 1051
546 Ga0495623_0200429 3300046679 Bacteria 1148
547 Ga0495647_0000266 3300046681 Bacteria 14448
548 Ga0495647_0169844 3300046681 Bacteria 944
549 Ga0495658_0088313 3300046683 Bacteria 1832
550 Ga0495671_0256008 3300046692 Bacteria 845
551 Ga0495589_0103676 3300046794 Bacteria 1375
552 Ga0495600_0007783 3300046809 Bacteria 6561
553 Ga0495581_0126957 3300047315 Bacteria 1486
554 Ga0495674_0120647 3300047319 Bacteria 2215
555 Ga0495680_0265075 3300047322 Bacteria 1214
556 Ga0495687_034579 3300047443 Unclassified 2282
557 Ga0496100_0714518 3300048903 Bacteria 782
558 Ga0496101_0135323 3300048904 Bacteria 1874
559 Ga0496101_0579837 3300048904 Bacteria 887
560 Ga0496102_0009340 3300048905 Bacteria 8424
561 Ga0496103_0698481 3300048906 Bacteria 643
562 Ga0496103_0711229 3300048906 Bacteria 636
563 Ga0496106_0146984 3300048909 Bacteria 1857
564 Ga0496107_0011977 3300048910 Bacteria 6052
565 Ga0496108_0214431 3300048911 Bacteria 1672
566 Ga0496109_0238164 3300048912 Bacteria 1712
567 Ga0496110_0069874 3300048913 Bacteria 3110
568 Ga0496110_1305328 3300048913 Bacteria 635
569 Ga0496112_0183591 3300048915 Bacteria 2055
570 Ga0496113_0025387 3300048916 Bacteria 4223
571 Ga0496113_0633937 3300048916 Bacteria 855
572 Ga0496114_0019095 3300048917 Bacteria 5554
573 Ga0496115_0026317 3300048918 Bacteria 4539
574 Ga0496118_0278522 3300048921 Bacteria 932
575 Ga0496124_0048448 3300048927 Unclassified 3631
576 Ga0496125_0062119 3300048928 Bacteria 2990
577 Ga0496126_0024934 3300048929 Bacteria 5766
578 Ga0496126_0091935 3300048929 Bacteria 2667
579 Ga0496126_0206929 3300048929 Bacteria 1654
580 Ga0495682_0164894 3300049460 Bacteria 789
581 Ga0501036_0004221 3300049572 Bacteria 11586
582 Ga0501036_0175516 3300049572 Bacteria 1804
583 Ga0501037_0091773 3300049573 Bacteria 2197
584 Ga0501038_0253870 3300049574 Bacteria 1392
585 Ga0501039_0001001 3300049575 Bacteria 20583
586 Ga0501039_0489049 3300049575 Bacteria 966
587 Ga0501040_0000658 3300049576 Bacteria 21296
588 Ga0501040_0072737 3300049576 Bacteria 2375
589 Ga0501040_0201910 3300049576 Bacteria 1412
590 Ga0501041_0016826 3300049577 Bacteria 4351
591 Ga0501042_0233661 3300049578 Bacteria 1326
592 Ga0501042_0234104 3300049578 Bacteria 1325
593 Ga0501042_0268293 3300049578 Bacteria 1232
594 Ga0501046_0121114 3300049580 Bacteria 1990
595 Ga0501048_0001750 3300049582 Bacteria 16500
596 Ga0501068_0010264 3300049584 Bacteria 5257
597 Ga0501068_0019811 3300049584 Bacteria 3911
598 Ga0501068_0461965 3300049584 Bacteria 822
599 Ga0501069_0132014 3300049585 Bacteria 1430
600 Ga0501071_0004841 3300049587 Bacteria 8581
601 Ga0501072_0006472 3300049588 Bacteria 8918
602 Ga0501072_0113681 3300049588 Bacteria 2155
603 Ga0501072_0297647 3300049588 Bacteria 1283
604 Ga0501073_0002531 3300049589 Bacteria 13656
605 Ga0501074_0006808 3300049590 Bacteria 8255
606 Ga0501074_0054919 3300049590 Bacteria 2871
607 Ga0501074_0092575 3300049590 Bacteria 2165
608 Ga0501075_0190019 3300049591 Bacteria 1566
609 Ga0501075_0430153 3300049591 Bacteria 1006
610 Ga0501076_0002977 3300049592 Bacteria 11753
611 Ga0501076_0042274 3300049592 Bacteria 3587
612 Ga0501076_0060109 3300049592 Bacteria 3023
613 Ga0501076_1166246 3300049592 Bacteria 634
614 Ga0501077_0009598 3300049593 Bacteria 6015
615 Ga0501079_0004964 3300049741 Bacteria 9866
616 Ga0501079_0010430 3300049741 Bacteria 7064
617 Ga0501079_0454082 3300049741 Bacteria 1006
618 Ga0501080_0003520 3300049742 Bacteria 13788
619 Ga0501080_0014389 3300049742 Bacteria 7286
620 Ga0501080_0023572 3300049742 Bacteria 5703
621 Ga0501081_0000192 3300049743 Bacteria 29549
622 Ga0501083_0018524 3300049744 Bacteria 4852
623 Ga0501045_0004460 3300049824 Bacteria 9663
624 nmdc:mga05p37_863174_c1 3300050507 Bacteria 981
625 nmdc:mga09592_227055_c1 3300050508 Bacteria 1617
626 nmdc:mga08y16_130302_c1 3300050511 Bacteria 2616
627 nmdc:mga08y16_556302_c1 3300050511 Bacteria 1160
628 nmdc:mga0n895_353487_c1 3300050512 Bacteria 1488
629 nmdc:mga0a205_76842_c1 3300050515 Bacteria 3227
630 Ga0495601_0555215 3300053077 Bacteria 739
631 Ga0500583_0053817 3300053092 Bacteria 1877
632 Ga0500583_0161894 3300053092 Bacteria 1114
633 Ga0500641_0055989 3300053096 Bacteria 1633
634 Ga0500556_0001370 3300053104 Bacteria 10678
635 Ga0500557_133979 3300053105 Bacteria 820
636 Ga0500562_031502 3300053108 Bacteria 1399
637 Ga0500572_027347 3300053111 Bacteria 1562
638 Ga0500642_0110607 3300053130 Bacteria 1283
639 Ga0500652_173496 3300053131 Bacteria 886
640 Ga0500588_0009814 3300053146 Bacteria 2290
641 Ga0500616_0000030 3300053153 Bacteria 415224
642 Ga0500616_0151375 3300053153 Bacteria 1073
643 Ga0500637_0066783 3300053178 Bacteria 2065
644 Ga0501084_0023953 3300054114 Bacteria 5092
645 Ga0501084_0032105 3300054114 Bacteria 4392
646 Ga0501084_0448748 3300054114 Bacteria 1090
647 Ga0501082_0005156 3300060353 Bacteria 11373
648 Ga0501082_0007732 3300060353 Bacteria 9280
649 Ga0501082_0036582 3300060353 Bacteria 4229
650 Ga0466962_0016932 3300061719 Bacteria 3511
651 Ga0530510_0000123 3300061734 Bacteria 44505
652 Ga0530510_0306172 3300061734 Bacteria 1189
653 Ga0070682_100021937
654 JGI25406J46586_10004992
655 rootH2_10124354
656 rootL2_10154466
657 Ga0070676_10005738
658 Ga0070676_10298922
659 Ga0070676_10342277
660 Ga0070676_10344733
661 Ga0070690_100064525
662 Ga0070670_100000019
663 Ga0070670_100015246
664 Ga0070670_100089378
665 Ga0070670_100119261
666 Ga0070677_10009056
667 Ga0070677_10011349
668 Ga0070677_10063224
669 Ga0070677_10098723
670 Ga0068869_100022527
671 Ga0068869_100223321
672 Ga0070666_10001795
673 Ga0070666_10025771
674 Ga0070666_10047327
675 Ga0070682_100118264
676 Ga0068868_100000774
677 Ga0068868_100388488
678 Ga0070689_100380742
679 Ga0070689_100611841
680 Ga0070668_100008748
681 Ga0070668_100282229
682 Ga0070668_100395099
683 Ga0070669_100001056
684 Ga0070669_100024856
685 Ga0070669_100158335
686 Ga0070669_100311238
687 Ga0070669_100349720
688 Ga0070675_100009354
689 Ga0070675_100098139
690 Ga0070675_100209210
691 Ga0070675_100267879
692 Ga0070675_100777578
693 Ga0070671_100000057
694 Ga0070671_100010434
695 Ga0070671_100077102
696 Ga0070674_100056320
697 Ga0070674_100060904
698 Ga0070674_100066091
699 Ga0070674_100402684
700 Ga0070674_100429834
701 Ga0070674_100813998
702 Ga0070673_100041222
703 Ga0070673_100054630
704 Ga0070673_100645492
705 Ga0070688_100014689
706 Ga0070667_100000020
707 Ga0070667_100000504
708 Ga0070667_100017376
709 Ga0070667_100023570
710 Ga0070667_101124300
711 Ga0070709_10014003
712 Ga0070714_100205362
713 Ga0070714_100377358
714 Ga0070713_100020502
715 Ga0070710_10165009
716 Ga0070710_10230149
717 Ga0070710_10382865
718 Ga0070701_10316929
719 Ga0070711_100008338
720 Ga0070711_100089947
721 Ga0070711_100118549
722 Ga0070711_100158678
723 Ga0070705_100457539
724 Ga0070700_100011147
725 Ga0070694_100123766
726 Ga0070678_100003217
727 Ga0070678_100003815
728 Ga0070678_100018471
729 Ga0070678_100020153
730 Ga0070662_100059198
731 Ga0070662_100352807
732 Ga0070662_100360393
733 Ga0070681_10000780
734 Ga0070681_10314565
735 Ga0068867_100002175
736 Ga0068867_100031329
737 Ga0070685_10000015
738 Ga0070685_10007518
739 Ga0070685_10062787
740 Ga0070685_10094509
741 Ga0070698_100747246
742 Ga0070699_100022263
743 Ga0070699_100296173
744 Ga0070679_100068569
745 Ga0070684_100363452
746 Ga0068853_100353786
747 Ga0070672_100004277
748 Ga0070672_100284657
749 Ga0070672_100333492
750 Ga0070672_100837530
751 Ga0070695_100056611
752 Ga0070695_100654716
753 Ga0070695_101025734
754 Ga0070696_100053654
755 Ga0070693_100003077
756 Ga0070693_100087953
757 Ga0070665_100002424
758 Ga0070665_100011037
759 Ga0070665_100066682
760 Ga0070665_100621926
761 Ga0068855_100000430
762 Ga0068857_100209924
763 Ga0068854_100145218
764 Ga0068854_100301799
765 Ga0068852_100179958
766 Ga0068859_100003579
767 Ga0068859_100016819
768 Ga0068859_100582462
769 Ga0068859_101216982
770 Ga0068864_100000030
771 Ga0068864_100112592
772 Ga0068864_100178309
773 Ga0068864_100356417
774 Ga0068866_10091194
775 Ga0068861_100003202
776 Ga0068861_100014058
777 Ga0068861_100045536
778 Ga0068861_100219333
779 Ga0068870_10038811
780 Ga0068863_100006174
781 Ga0068863_100039319
782 Ga0068863_100463619
783 Ga0068863_100485480
784 Ga0068863_100819914
785 Ga0068863_100915053
786 Ga0068863_101020909
787 Ga0068858_100011271
788 Ga0068858_100016508
789 Ga0068858_100070267
790 Ga0068858_100152191
791 Ga0068858_100500735
792 Ga0068858_100660409
793 Ga0068860_100002991
794 Ga0068860_100009754
795 Ga0068860_100021076
796 Ga0068860_100412004
797 Ga0068862_100001079
798 Ga0068862_100047718
799 Ga0068862_100078096
800 Ga0068862_100180056
801 Ga0081455_10000055
802 Ga0081455_10012540
803 Ga0081539_10000123
804 Ga0070717_10762139
805 Ga0070715_10001938
806 Ga0070716_100006698
807 Ga0070716_100015315
808 Ga0070716_100716729
809 Ga0070712_100001529
810 Ga0070712_100098219
811 Ga0097621_100084778
812 Ga0097621_100090513
813 Ga0068871_100003468
814 Ga0068871_100024330
815 Ga0068871_100219096
816 Ga0068871_100388968
817 Ga0068871_100451545
818 Ga0075428_100267170
819 Ga0075433_10152972
820 Ga0075434_100385091
821 Ga0068865_100005671
822 Ga0068865_100020283
823 Ga0068865_100045541
824 Ga0068865_100129992
825 Ga0097620_100003579
826 Ga0097620_100016819
827 Ga0097620_100582447
828 Ga0097620_101216933
829 Ga0105240_10010706
830 Ga0105240_10033308
831 Ga0105240_10078973
832 Ga0105240_10129965
833 Ga0105240_10247427
834 Ga0105240_10924506
835 Ga0111539_10050983
836 Ga0111539_10808026
837 Ga0105245_10005670
838 Ga0105245_10160678
839 Ga0105245_10703161
840 Ga0105247_10072204
841 Ga0105247_10104688
842 Ga0105247_10121256
843 Ga0114129_10052579
844 Ga0105243_10055209
845 Ga0105243_10090142
846 Ga0105243_10496111
847 Ga0105241_10116431
848 Ga0105241_10120853
849 Ga0105242_10004242
850 Ga0105248_10007618
851 Ga0105248_10034267
852 Ga0105248_10091153
853 Ga0105248_10521882
854 Ga0105248_11039342
855 Ga0105237_10025128
856 Ga0105237_10328341
857 Ga0105238_11244058
858 Ga0105249_10040834
859 Ga0105249_10169993
860 Ga0105249_10264765
861 Ga0099796_10005395
862 Ga0105239_10031593
863 Ga0105239_10049426
864 Ga0157369_10153494
865 Ga0157374_10000346
866 Ga0157374_10033956
867 Ga0157374_10176496
868 Ga0157378_10113038
869 Ga0157378_10417137
870 Ga0163162_10012637
871 Ga0163162_10015294
872 Ga0157372_10365485
873 Ga0157375_10039460
874 Ga0157375_10089727
875 Ga0157375_10277365
876 Ga0157375_11374838
877 Ga0163163_10000115
878 Ga0163163_10011644
879 Ga0163163_10109681
880 Ga0163163_10129159
881 Ga0163163_10342497
882 Ga0163163_10363306
883 Ga0163163_11063424
884 Ga0157380_10010851
885 Ga0157380_10108920
886 Ga0157380_10110095
887 Ga0157380_11313683
888 Ga0157379_10023248
889 Ga0157379_10034828
890 Ga0157379_10040450
891 Ga0157379_10054481
892 Ga0157379_10708250
893 Ga0157376_10091553
894 Ga0157376_10459696
895 Ga0163161_10020781
896 Ga0163161_10062315
897 Ga0224712_10039613
898 Ga0228600_1010116
899 Ga0207697_10026790
900 Ga0207682_10002442
901 Ga0207682_10025024
902 Ga0207682_10069246
903 Ga0207692_10043146
904 Ga0207692_10462034
905 Ga0207642_10006047
906 Ga0207642_10118486
907 Ga0207710_10006402
908 Ga0207710_10036564
909 Ga0207688_10138977
910 Ga0207680_10030777
911 Ga0207680_10032455
912 Ga0207680_10058322
913 Ga0207680_10161052
914 Ga0207680_10759998
915 Ga0207685_10006949
916 Ga0207699_10015333
917 Ga0207645_10000431
918 Ga0207645_10057291
919 Ga0207645_10340532
920 Ga0207645_10350259
921 Ga0207643_10042967
922 Ga0207654_10042001
923 Ga0207654_10202412
924 Ga0207707_10004164
925 Ga0207707_10127423
926 Ga0207695_10037827
927 Ga0207695_10048952
928 Ga0207695_10058206
929 Ga0207695_10068626
930 Ga0207695_10101015
931 Ga0207695_10671255
932 Ga0207671_10055347
933 Ga0207671_10344423
934 Ga0207693_10000391
935 Ga0207693_10084792
936 Ga0207693_10125493
937 Ga0207663_10061366
938 Ga0207663_10071997
939 Ga0207663_10407227
940 Ga0207660_10081751
941 Ga0207681_10016711
942 Ga0207681_10022759
943 Ga0207681_10056355
944 Ga0207681_10255019
945 Ga0207681_10788192
946 Ga0207650_10000034
947 Ga0207650_10012765
948 Ga0207650_10206153
949 Ga0207659_10029040
950 Ga0207659_10044259
951 Ga0207659_10061264
952 Ga0207659_10109244
953 Ga0207659_10295630
954 Ga0207659_10386790
955 Ga0207687_10093466
956 Ga0207687_10349243
957 Ga0207700_10034840
958 Ga0207700_10152460
959 Ga0207664_10741627
960 Ga0207664_10764079
961 Ga0207644_10000208
962 Ga0207644_10395427
963 Ga0207690_10225703
964 Ga0207690_10623748
965 Ga0207706_10040763
966 Ga0207706_10203843
967 Ga0207686_10001782
968 Ga0207686_10135787
969 Ga0207686_10200786
970 Ga0207670_10156374
971 Ga0207670_10250205
972 Ga0207670_10720189
973 Ga0207669_10244748
974 Ga0207704_10016229
975 Ga0207704_10078609
976 Ga0207704_10165242
977 Ga0207665_10003007
978 Ga0207665_10007306
979 Ga0207665_10460837
980 Ga0207691_10012433
981 Ga0207691_10015804
982 Ga0207691_10124466
983 Ga0207691_10177711
984 Ga0207691_10315596
985 Ga0207691_10709493
986 Ga0207711_10001721
987 Ga0207711_10051467
988 Ga0207711_10136975
989 Ga0207711_10225818
990 Ga0207711_10741635
991 Ga0207689_10027587
992 Ga0207689_10037680
993 Ga0207689_10183094
994 Ga0207689_10237273
995 Ga0207661_10070201
996 Ga0207679_10264064
997 Ga0207679_10637281
998 Ga0207667_10003985
999 Ga0207667_11210056
1000 Ga0207651_10015618
1001 Ga0207651_10341835
1002 Ga0207651_10792650
1003 Ga0207712_10040748
1004 Ga0207668_10010200
1005 Ga0207668_10824193
1006 Ga0207668_10840537
1007 Ga0207640_10013939
1008 Ga0207658_10000015
1009 Ga0207658_10000605
1010 Ga0207658_10010772
1011 Ga0207658_10023555
1012 Ga0207658_10100637
1013 Ga0207658_10479730
1014 Ga0207658_10927269
1015 Ga0207658_11399253
1016 Ga0207677_10003049
1017 Ga0207677_10461481
1018 Ga0207703_10030281
1019 Ga0207703_10053661
1020 Ga0207703_10066543
1021 Ga0207703_10328725
1022 Ga0207639_10123590
1023 Ga0207678_10077837
1024 Ga0207678_10089047
1025 Ga0207708_10007791
1026 Ga0207641_10001115
1027 Ga0207641_10021917
1028 Ga0207641_10041265
1029 Ga0207641_10171786
1030 Ga0207641_10340369
1031 Ga0207641_10439839
1032 Ga0207641_10517873
1033 Ga0207641_10659621
1034 Ga0207641_10741397
1035 Ga0207641_10879521
1036 Ga0207648_10000306
1037 Ga0207648_10020718
1038 Ga0207648_10257340
1039 Ga0207648_10460335
1040 Ga0207676_10000032
1041 Ga0207676_10040466
1042 Ga0207676_10048418
1043 Ga0207676_10180904
1044 Ga0207675_100030249
1045 Ga0207675_100042232
1046 Ga0207675_100098343
1047 Ga0207675_100231685
1048 Ga0207675_100888106
1049 Ga0207675_100902111
1050 Ga0207683_10000661
1051 Ga0207683_10002242
1052 Ga0207683_10005085
1053 Ga0207683_10074668
1054 Ga0207683_11733300
1055 Ga0207428_10368685
1056 Ga0268266_10001574
1057 Ga0268266_10002609
1058 Ga0268266_10047856
1059 Ga0268266_10112656
1060 Ga0268266_10120319
1061 Ga0268266_10181368
1062 Ga0268265_10001053
1063 Ga0268265_10073680
1064 Ga0268265_10712599
1065 Ga0268264_10006666
1066 Ga0268264_10023327
1067 Ga0268264_10134281
1068 Ga0268264_10292793
1069 Ga0265319_1008465
1070 Ga0265334_10000962
1071 Ga0265318_10000307
1072 Ga0265338_10007913
1073 Ga0265338_10010202
1074 Ga0265330_10007440
1075 Ga0265332_10001276
1076 Ga0265328_10005468
1077 Ga0265320_10003267
1078 Ga0265325_10002916
1079 Ga0265329_10004645
1080 Ga0265340_10091512
1081 Ga0265339_10075491
1082 Ga0265331_10005730
1083 Ga0265327_10000845
1084 Ga0265316_10001817
1085 Ga0307513_10025089
1086 Ga0307513_10144339
1087 Ga0307513_10222032
1088 Ga0307509_10009918
1089 Ga0307408_100131166
1090 Ga0307408_100388875
1091 Ga0307408_100493289
1092 Ga0307408_100797494
1093 Ga0265313_10001839
1094 Ga0265314_10006148
1095 Ga0265342_10003586
1096 Ga0316576_10075326
1097 Ga0316578_10009004
1098 Ga0307405_10151561
1099 Ga0307405_10231079
1100 Ga0307413_10071249
1101 Ga0307410_10002475
1102 Ga0307410_10003350
1103 Ga0307410_10037432
1104 Ga0307406_10078876
1105 Ga0307406_10668206
1106 Ga0307407_10026134
1107 Ga0307407_10537361
1108 Ga0307412_10246136
1109 Ga0307409_100169112
1110 Ga0307409_100814568
1111 Ga0307409_100900070
1112 Ga0307409_101215071
1113 Ga0307416_100105822
1114 Ga0307416_100180896
1115 Ga0307416_100445418
1116 Ga0307416_100583040
1117 Ga0307414_10645141
1118 Ga0307411_10005848
1119 Ga0307411_10316805
1120 Ga0307415_100091084
1121 Ga0307415_100097364
1122 Ga0307415_100299328
1123 Ga0307415_101188345
1124 Ga0373923_0180808
1125 Ga0373945_0131411
1126 Ga0373954_0112659
1127 Ga0373956_0290487
1128 Ga0373957_0136002
1129 Ga0373957_0183129
1130 Ga0373943_0474916
1131 Ga0373955_0098549
1132 Ga0373955_0149237
1133 Ga0316574_0000782
1134 Ga0316574_0105317
1135 Ga0373935_0281648
1136 Ga0373927_0236066
1137 Ga0373933_0035165
1138 Ga0373933_0075298
1139 Ga0373933_0118583
1140 Ga0373947_0034493
1141 Ga0373937_0005753
1142 Ga0373937_0009036
1143 Ga0373937_0089633
1144 Ga0373937_0134030
1145 Ga0316582_0003987
1146 Ga0316584_0169183
1147 Ga0373925_0103929
1148 Ga0373925_0460260
1149 Ga0436360_0410680
1150 Ga0451797_0621749
1151 Ga0451797_1524824
1152 Ga0451800_1481369
1153 Ga0451802_0445547
1154 Ga0451802_0857606
1155 Ga0451807_2204375
1156 Ga0450894_004198
1157 Ga0450895_002340
1158 Ga0450896_007897
1159 Ga0439446_0004514
1160 Ga0439446_0027057
1161 Ga0466969_0001742
1162 Ga0466969_0003007
1163 Ga0466969_0020026
1164 Ga0466966_0000375
1165 Ga0466966_0034133
1166 Ga0466961_0001014
1167 Ga0466971_0000522
1168 Ga0466968_0023687
1169 Ga0466970_0001081
1170 Ga0466957_0131786
1171 Ga0466959_0002673
1172 Ga0466959_0009045
1173 Ga0466959_0058821
1174 Ga0495638_0169769
1175 Ga0495580_0022667
1176 Ga0495580_0373883
1177 Ga0495639_0010217
1178 Ga0495639_0131799
1179 Ga0495662_0117778
1180 Ga0495664_0332550
1181 Ga0495616_0036821
1182 Ga0495616_0114064
1183 Ga0495628_0172008
1184 Ga0495630_0093483
1185 Ga0495632_0037844
1186 Ga0495632_0045619
1187 Ga0495632_0340695
1188 Ga0495644_0003659
1189 Ga0495598_0007337
1190 Ga0495621_0002064
1191 Ga0495645_0287127
1192 Ga0495622_0238187
1193 Ga0495633_0158470
1194 Ga0495668_0257322
1195 Ga0495625_0023718
1196 Ga0495625_0252563
1197 Ga0495625_0289526
1198 Ga0495623_0200429
1199 Ga0495647_0000266
1200 Ga0495647_0169844
1201 Ga0495658_0088313
1202 Ga0495671_0256008
1203 Ga0495589_0103676
1204 Ga0495600_0007783
1205 Ga0495581_0126957
1206 Ga0495674_0120647
1207 Ga0495680_0265075
1208 Ga0495687_034579
1209 Ga0496100_0714518
1210 Ga0496101_0135323
1211 Ga0496101_0579837
1212 Ga0496102_0009340
1213 Ga0496103_0698481
1214 Ga0496103_0711229
1215 Ga0496106_0146984
1216 Ga0496107_0011977
1217 Ga0496108_0214431
1218 Ga0496109_0238164
1219 Ga0496110_0069874
1220 Ga0496110_1305328
1221 Ga0496112_0183591
1222 Ga0496113_0025387
1223 Ga0496113_0633937
1224 Ga0496114_0019095
1225 Ga0496115_0026317
1226 Ga0496118_0278522
1227 Ga0496124_0048448
1228 Ga0496125_0062119
1229 Ga0496126_0024934
1230 Ga0496126_0091935
1231 Ga0496126_0206929
1232 Ga0495682_0164894
1233 Ga0501036_0004221
1234 Ga0501036_0175516
1235 Ga0501037_0091773
1236 Ga0501038_0253870
1237 Ga0501039_0001001
1238 Ga0501039_0489049
1239 Ga0501040_0000658
1240 Ga0501040_0072737
1241 Ga0501040_0201910
1242 Ga0501041_0016826
1243 Ga0501042_0233661
1244 Ga0501042_0234104
1245 Ga0501042_0268293
1246 Ga0501046_0121114
1247 Ga0501048_0001750
1248 Ga0501068_0010264
1249 Ga0501068_0019811
1250 Ga0501068_0461965
1251 Ga0501069_0132014
1252 Ga0501071_0004841
1253 Ga0501072_0006472
1254 Ga0501072_0113681
1255 Ga0501072_0297647
1256 Ga0501073_0002531
1257 Ga0501074_0006808
1258 Ga0501074_0054919
1259 Ga0501074_0092575
1260 Ga0501075_0190019
1261 Ga0501075_0430153
1262 Ga0501076_0002977
1263 Ga0501076_0042274
1264 Ga0501076_0060109
1265 Ga0501076_1166246
1266 Ga0501077_0009598
1267 Ga0501079_0004964
1268 Ga0501079_0010430
1269 Ga0501079_0454082
1270 Ga0501080_0003520
1271 Ga0501080_0014389
1272 Ga0501080_0023572
1273 Ga0501081_0000192
1274 Ga0501083_0018524
1275 Ga0501045_0004460
1276 nmdc:mga05p37_863174_c1
1277 nmdc:mga09592_227055_c1
1278 nmdc:mga08y16_130302_c1
1279 nmdc:mga08y16_556302_c1
1280 nmdc:mga0n895_353487_c1
1281 nmdc:mga0a205_76842_c1
1282 Ga0495601_0555215
1283 Ga0500583_0053817
1284 Ga0500583_0161894
1285 Ga0500641_0055989
1286 Ga0500556_0001370
1287 Ga0500557_133979
1288 Ga0500562_031502
1289 Ga0500572_027347
1290 Ga0500642_0110607
1291 Ga0500652_173496
1292 Ga0500588_0009814
1293 Ga0500616_0000030
1294 Ga0500616_0151375
1295 Ga0500637_0066783
1296 Ga0501084_0023953
1297 Ga0501084_0032105
1298 Ga0501084_0448748
1299 Ga0501082_0005156
1300 Ga0501082_0007732
1301 Ga0501082_0036582
1302 Ga0466962_0016932
1303 Ga0530510_0000123
1304 Ga0530510_0306172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

131

220

0.9

PF06181

Urate_ox_N

Urate oxidase N-terminal

51

138

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.5588 30 188
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.5528 30 188
4bpd-assembly2.cif.gz_D structure determination of an integral membrane kinase 0.5516 76 186
8dt0-assembly1.cif.gz_A scaffolding protein functional sites using deep learning 0.5201 37 190
1nfo-assembly1.cif.gz_A apolipoprotein e2 (apoe2, d154a mutation) 0.5166 40 185
ID Description Score Start End Superfamily
af_Q9H160_25_121_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.6746 98 188 1.10.287.1060
af_A9Z1K9_108_335_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6687 33 188 1.20.120.1770
af_A9Z1K7_120_346_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6664 26 188 1.20.120.1770
af_A0A0G2K2F0_335_464_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6096 32 180 1.20.120.350
af_A0A0G2K2F0_335_464_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5948 32 180 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A0M4NUV1-F1-model_v4 Membrane protein 0.9798 37 185 GO:0016020
AF-A0A7Y4YL54-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9759 34 188 GO:0016020
AF-A0A483A5M8-F1-model_v4 Glutamate synthase [NADPH] large chain (EC 1.4.1.13) 0.975 44 185 GO:0004355
GO:0016020
AF-A0A2E7UK13-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9731 31 188 GO:0016020
AF-A0A258TNI9-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9657 33 172 GO:0016020

Map