F472516

General Info

Members Datasets Scaffolds Average Seq Length
650 204 1300 282

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10286070|Ga0105249_102860702
Length 298
Sequence MSWIDPDFPKTATVSDLVGRVLGLNPGMMTGPGTNTYLVGRRDPILIDTGIGVPEYMPLLEGYLAERGWRSPSRVVLTHRHKDHLGGVKDIRARFPGLRVGKRLHRDEDLPEGIEDIRDGDVIEGDGVTLVAVSTPGHASDHLCYYLPEEKAVFTGDVVLSGSTSVIPAGDGDLLDYMRSLRRLQGLDVRRIYSAHGPVIEDGPGRIADYIAHRLDRERQILEGLGDGVETIPALVKRIYADVPEKLHAMAAQSVESHLKKLLREGRVQERPVPDAPSIWSWAARDAPPKAPHAPDGE

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10286070 3300009553 Bacteria 1648
2 JGI25406J46586_10038982 3300003203 Bacteria 1698
3 Ga0070683_100291575 3300005329 Bacteria 1552
4 Ga0070670_100003118 3300005331 Bacteria 13716
5 Ga0070670_100576079 3300005331 Bacteria 1006
6 Ga0068869_100000905 3300005334 Bacteria 17080
7 Ga0068869_100015845 3300005334 Bacteria 5069
8 Ga0068869_100056406 3300005334 Bacteria 2865
9 Ga0070680_100045290 3300005336 Bacteria 3576
10 Ga0070680_100106290 3300005336 Bacteria 2334
11 Ga0070682_100000577 3300005337 Bacteria 22507
12 Ga0070689_100039232 3300005340 Bacteria 3626
13 Ga0070691_10039766 3300005341 Bacteria 2222
14 Ga0070691_10106987 3300005341 Bacteria 1395
15 Ga0070661_100005036 3300005344 Bacteria 9111
16 Ga0070692_10006146 3300005345 Bacteria 5191
17 Ga0070692_10039362 3300005345 Bacteria 2413
18 Ga0070669_100092551 3300005353 Unclassified 2269
19 Ga0070669_100157615 3300005353 Bacteria 1762
20 Ga0070673_100143132 3300005364 Bacteria 2019
21 Ga0070688_100455801 3300005365 Bacteria 957
22 Ga0070701_10023446 3300005438 Bacteria 2972
23 Ga0070701_10028719 3300005438 Bacteria 2736
24 Ga0070711_100472770 3300005439 Bacteria 1029
25 Ga0070705_100000177 3300005440 Bacteria 37033
26 Ga0070705_100082718 3300005440 Bacteria 1976
27 Ga0070705_100335682 3300005440 Unclassified 1096
28 Ga0070700_100173493 3300005441 Bacteria 1495
29 Ga0070694_100001713 3300005444 Bacteria 12921
30 Ga0070694_100004610 3300005444 Bacteria 8293
31 Ga0070708_100002559 3300005445 Bacteria 14068
32 Ga0070708_100018486 3300005445 Bacteria 5834
33 Ga0070708_100033885 3300005445 Bacteria 4438
34 Ga0070708_100034394 3300005445 Bacteria 4409
35 Ga0070708_100035358 3300005445 Bacteria 4352
36 Ga0070708_100049312 3300005445 Bacteria 3724
37 Ga0070708_100105246 3300005445 Bacteria 2588
38 Ga0070708_100167752 3300005445 Bacteria 2048
39 Ga0070708_100493038 3300005445 Bacteria 1156
40 Ga0070663_100003261 3300005455 Bacteria 9343
41 Ga0070662_100035276 3300005457 Bacteria 3532
42 Ga0070662_100191402 3300005457 Bacteria 1618
43 Ga0068867_100027024 3300005459 Bacteria 4123
44 Ga0068867_100079459 3300005459 Bacteria 2469
45 Ga0070706_100006000 3300005467 Bacteria 11482
46 Ga0070706_100007224 3300005467 Bacteria 10437
47 Ga0070706_100007914 3300005467 Bacteria 9925
48 Ga0070706_100012758 3300005467 Bacteria 7775
49 Ga0070706_100022859 3300005467 Bacteria 5759
50 Ga0070706_100033893 3300005467 Bacteria 4714
51 Ga0070707_100003606 3300005468 Bacteria 14602
52 Ga0070707_100011125 3300005468 Bacteria 8382
53 Ga0070707_100033676 3300005468 Bacteria 4885
54 Ga0070707_100048336 3300005468 Bacteria 4076
55 Ga0070707_100050171 3300005468 Bacteria 4000
56 Ga0070707_100058098 3300005468 Bacteria 3710
57 Ga0070698_100007159 3300005471 Bacteria 12083
58 Ga0070698_100011945 3300005471 Bacteria 9216
59 Ga0070698_100025804 3300005471 Bacteria 6124
60 Ga0070698_100028253 3300005471 Bacteria 5828
61 Ga0070698_100062071 3300005471 Bacteria 3770
62 Ga0070698_100109365 3300005471 Bacteria 2731
63 Ga0070698_100554639 3300005471 Unclassified 1088
64 Ga0070699_100004713 3300005518 Bacteria 12061
65 Ga0070699_100007939 3300005518 Bacteria 9216
66 Ga0070699_100014855 3300005518 Bacteria 6695
67 Ga0070699_100016189 3300005518 Bacteria 6401
68 Ga0070699_100035418 3300005518 Bacteria 4315
69 Ga0070699_100112278 3300005518 Bacteria 2394
70 Ga0070699_100464143 3300005518 Bacteria 1148
71 Ga0070699_100484504 3300005518 Bacteria 1123
72 Ga0070699_100515506 3300005518 Bacteria 1087
73 Ga0070679_100011090 3300005530 Bacteria 8577
74 Ga0070697_100003605 3300005536 Bacteria 11893
75 Ga0070697_100030250 3300005536 Bacteria 4349
76 Ga0070697_100040530 3300005536 Bacteria 3769
77 Ga0070697_100084187 3300005536 Bacteria 2623
78 Ga0070697_100107139 3300005536 Bacteria 2325
79 Ga0070697_100174526 3300005536 Bacteria 1820
80 Ga0070697_100411389 3300005536 Bacteria 1175
81 Ga0068853_100005240 3300005539 Bacteria 10148
82 Ga0070672_100048193 3300005543 Bacteria 3310
83 Ga0070686_100131586 3300005544 Unclassified 1731
84 Ga0070695_100000973 3300005545 Bacteria 15566
85 Ga0070695_100003426 3300005545 Bacteria 9267
86 Ga0070695_100005592 3300005545 Bacteria 7402
87 Ga0070695_100312116 3300005545 Bacteria 1166
88 Ga0070696_100000622 3300005546 Bacteria 22623
89 Ga0070696_100013430 3300005546 Bacteria 5496
90 Ga0070696_100018486 3300005546 Bacteria 4711
91 Ga0070693_100001756 3300005547 Bacteria 9883
92 Ga0070693_100221760 3300005547 Bacteria 1239
93 Ga0070704_100000270 3300005549 Bacteria 22815
94 Ga0070704_100041498 3300005549 Bacteria 3176
95 Ga0070704_100095266 3300005549 Bacteria 2229
96 Ga0070704_100230912 3300005549 Bacteria 1509
97 Ga0068855_100002606 3300005563 Bacteria 22229
98 Ga0070664_100004718 3300005564 Bacteria 10934
99 Ga0068857_100016016 3300005577 Bacteria 6567
100 Ga0068854_100021177 3300005578 Bacteria 4410
101 Ga0068856_100000268 3300005614 Bacteria 56652
102 Ga0070702_100171512 3300005615 Bacteria 1412
103 Ga0068852_100515704 3300005616 Bacteria 1192
104 Ga0068859_100000274 3300005617 Bacteria 51332
105 Ga0068859_100135439 3300005617 Bacteria 2536
106 Ga0068859_100167949 3300005617 Bacteria 2274
107 Ga0068864_100001001 3300005618 Bacteria 23635
108 Ga0068864_100197084 3300005618 Bacteria 1848
109 Ga0068861_100024798 3300005719 Bacteria 4341
110 Ga0068870_10026065 3300005840 Bacteria 2910
111 Ga0068870_10035300 3300005840 Bacteria 2564
112 Ga0068863_100392337 3300005841 Bacteria 1357
113 Ga0068863_100506011 3300005841 Bacteria 1190
114 Ga0068858_100175966 3300005842 Bacteria 2019
115 Ga0068860_100043956 3300005843 Bacteria 4259
116 Ga0068860_100143020 3300005843 Bacteria 2300
117 Ga0068860_100297830 3300005843 Bacteria 1579
118 Ga0068860_100417589 3300005843 Bacteria 1329
119 Ga0068862_100032992 3300005844 Bacteria 4374
120 Ga0068862_100473169 3300005844 Unclassified 1185
121 Ga0068862_100532504 3300005844 Unclassified 1119
122 Ga0081455_10010507 3300005937 Bacteria 9382
123 Ga0081538_10008930 3300005981 Bacteria 8420
124 Ga0081540_1062838 3300005983 Bacteria 1761
125 Ga0081539_10000210 3300005985 Bacteria 136405
126 Ga0070716_100005494 3300006173 Bacteria 6144
127 Ga0075428_100005779 3300006844 Bacteria 13732
128 Ga0075428_100011030 3300006844 Bacteria 10051
129 Ga0075428_100020810 3300006844 Bacteria 7264
130 Ga0075428_100154134 3300006844 Bacteria 2496
131 Ga0075428_100154230 3300006844 Bacteria 2495
132 Ga0075428_100726534 3300006844 Bacteria 1057
133 Ga0075430_100000287 3300006846 Bacteria 35486
134 Ga0075430_100013627 3300006846 Bacteria 6930
135 Ga0075430_100043330 3300006846 Bacteria 3803
136 Ga0075430_100076499 3300006846 Bacteria 2805
137 Ga0075430_100093188 3300006846 Bacteria 2518
138 Ga0075430_100213937 3300006846 Bacteria 1599
139 Ga0075431_100000268 3300006847 Bacteria 40277
140 Ga0075431_100001661 3300006847 Bacteria 20853
141 Ga0075431_100001940 3300006847 Bacteria 19719
142 Ga0075431_100002054 3300006847 Bacteria 19237
143 Ga0075431_100002758 3300006847 Bacteria 17032
144 Ga0075431_100002976 3300006847 Bacteria 16395
145 Ga0075431_100027850 3300006847 Bacteria 5799
146 Ga0075431_100037338 3300006847 Bacteria 5005
147 Ga0075431_100093110 3300006847 Bacteria 3111
148 Ga0075431_100166118 3300006847 Bacteria 2269
149 Ga0075431_100517677 3300006847 Bacteria 1183
150 Ga0075433_10000893 3300006852 Bacteria 21032
151 Ga0075433_10001032 3300006852 Bacteria 19872
152 Ga0075433_10002367 3300006852 Bacteria 14326
153 Ga0075433_10010004 3300006852 Bacteria 7600
154 Ga0075433_10017686 3300006852 Bacteria 5912
155 Ga0075433_10047312 3300006852 Bacteria 3741
156 Ga0075433_10068278 3300006852 Bacteria 3121
157 Ga0075433_10099272 3300006852 Bacteria 2577
158 Ga0075433_10255079 3300006852 Bacteria 1556
159 Ga0075433_10492135 3300006852 Bacteria 1080
160 Ga0075434_100005432 3300006871 Bacteria 11604
161 Ga0075434_100006755 3300006871 Bacteria 10542
162 Ga0075434_100017488 3300006871 Bacteria 6911
163 Ga0075434_100023503 3300006871 Bacteria 6009
164 Ga0075434_100053996 3300006871 Bacteria 3991
165 Ga0075434_100064023 3300006871 Bacteria 3661
166 Ga0075434_100095876 3300006871 Bacteria 2972
167 Ga0075434_100160697 3300006871 Bacteria 2266
168 Ga0075434_100298645 3300006871 Bacteria 1631
169 Ga0075429_100000222 3300006880 Bacteria 38478
170 Ga0075429_100000886 3300006880 Bacteria 23639
171 Ga0075429_100003832 3300006880 Bacteria 12846
172 Ga0075429_100011391 3300006880 Bacteria 7702
173 Ga0075429_100013483 3300006880 Bacteria 7090
174 Ga0075429_100016313 3300006880 Bacteria 6439
175 Ga0075429_100046821 3300006880 Bacteria 3762
176 Ga0075436_100030668 3300006914 Bacteria 3700
177 Ga0075436_100033028 3300006914 Bacteria 3565
178 Ga0075436_100050540 3300006914 Bacteria 2869
179 Ga0075436_100062202 3300006914 Bacteria 2580
180 Ga0075436_100260008 3300006914 Unclassified 1238
181 Ga0097620_100000274 3300006931 Bacteria 51332
182 Ga0097620_100135436 3300006931 Bacteria 2536
183 Ga0097620_100167940 3300006931 Bacteria 2274
184 Ga0075435_100005563 3300007076 Bacteria 8818
185 Ga0075435_100014112 3300007076 Bacteria 5961
186 Ga0075435_100054932 3300007076 Bacteria 3215
187 Ga0075435_100147342 3300007076 Bacteria 1977
188 Ga0075435_100156952 3300007076 Bacteria 1915
189 Ga0099794_10032096 3300007265 Bacteria 2463
190 Ga0099794_10127532 3300007265 Bacteria 1283
191 Ga0099794_10134056 3300007265 Bacteria 1252
192 Ga0105240_10149373 3300009093 Bacteria 2785
193 Ga0111539_10002152 3300009094 Bacteria 26346
194 Ga0111539_10007948 3300009094 Bacteria 13525
195 Ga0111539_10017156 3300009094 Bacteria 8962
196 Ga0111539_10060257 3300009094 Bacteria 4498
197 Ga0105247_10182350 3300009101 Bacteria 1402
198 Ga0114129_10000003 3300009147 Bacteria 183186
199 Ga0114129_10000044 3300009147 Bacteria 106171
200 Ga0114129_10004983 3300009147 Bacteria 18714
201 Ga0114129_10005583 3300009147 Bacteria 17793
202 Ga0114129_10010961 3300009147 Bacteria 12913
203 Ga0114129_10018393 3300009147 Bacteria 9953
204 Ga0114129_10058176 3300009147 Bacteria 5407
205 Ga0114129_10059711 3300009147 Bacteria 5331
206 Ga0114129_10063554 3300009147 Bacteria 5154
207 Ga0114129_10081817 3300009147 Bacteria 4488
208 Ga0114129_10088641 3300009147 Bacteria 4289
209 Ga0114129_10107267 3300009147 Bacteria 3858
210 Ga0114129_10173796 3300009147 Bacteria 2935
211 Ga0114129_10219470 3300009147 Bacteria 2566
212 Ga0114129_10280534 3300009147 Bacteria 2226
213 Ga0114129_10476166 3300009147 Bacteria 1634
214 Ga0114129_10584925 3300009147 Bacteria 1448
215 Ga0114129_10817010 3300009147 Bacteria 1188
216 Ga0105243_10436818 3300009148 Bacteria 1225
217 Ga0105241_10260930 3300009174 Bacteria 1472
218 Ga0105242_10150976 3300009176 Bacteria 2025
219 Ga0105249_10041579 3300009553 Bacteria 4179
220 Ga0105249_10279179 3300009553 Bacteria 1667
221 Ga0105249_10531568 3300009553 Bacteria 1224
222 Ga0105249_10575330 3300009553 Bacteria 1179
223 Ga0105239_10201277 3300010375 Bacteria 2231
224 Ga0157373_10406362 3300013100 Bacteria 976
225 Ga0157369_10121533 3300013105 Bacteria 2771
226 Ga0157378_10305323 3300013297 Bacteria 1541
227 Ga0163162_10032190 3300013306 Bacteria 5206
228 Ga0163162_10256754 3300013306 Bacteria 1879
229 Ga0157372_10000675 3300013307 Bacteria 37542
230 Ga0157372_10113918 3300013307 Bacteria 3100
231 Ga0157375_10315264 3300013308 Bacteria 1728
232 Ga0182008_10093121 3300014497 Bacteria 1487
233 Ga0157379_10158467 3300014968 Bacteria 2043
234 Ga0163161_10417449 3300017792 Bacteria 1079
235 Ga0207653_10001860 3300025885 Bacteria 6749
236 Ga0207642_10065839 3300025899 Bacteria 1704
237 Ga0207688_10107187 3300025901 Bacteria 1619
238 Ga0207645_10051783 3300025907 Bacteria 2623
239 Ga0207684_10000550 3300025910 Bacteria 46175
240 Ga0207684_10004127 3300025910 Bacteria 13827
241 Ga0207684_10004874 3300025910 Bacteria 12549
242 Ga0207684_10021128 3300025910 Bacteria 5558
243 Ga0207684_10028956 3300025910 Bacteria 4717
244 Ga0207684_10035160 3300025910 Bacteria 4255
245 Ga0207684_10058575 3300025910 Bacteria 3269
246 Ga0207654_10189978 3300025911 Bacteria 1345
247 Ga0207693_10006930 3300025915 Bacteria 9359
248 Ga0207660_10000367 3300025917 Bacteria 29429
249 Ga0207660_10064265 3300025917 Bacteria 2648
250 Ga0207660_10095519 3300025917 Bacteria 2212
251 Ga0207652_10007547 3300025921 Bacteria 8758
252 Ga0207646_10000462 3300025922 Bacteria 54396
253 Ga0207646_10007086 3300025922 Bacteria 11467
254 Ga0207646_10025072 3300025922 Bacteria 5458
255 Ga0207646_10026032 3300025922 Bacteria 5346
256 Ga0207646_10034044 3300025922 Bacteria 4604
257 Ga0207646_10048806 3300025922 Bacteria 3793
258 Ga0207646_10092635 3300025922 Bacteria 2705
259 Ga0207646_10270035 3300025922 Bacteria 1537
260 Ga0207681_10081269 3300025923 Unclassified 2288
261 Ga0207681_10217660 3300025923 Bacteria 1476
262 Ga0207650_10087876 3300025925 Bacteria 2369
263 Ga0207650_10145613 3300025925 Bacteria 1865
264 Ga0207659_10351072 3300025926 Bacteria 1224
265 Ga0207690_10001710 3300025932 Bacteria 13493
266 Ga0207706_10041538 3300025933 Bacteria 4077
267 Ga0207706_10119241 3300025933 Bacteria 2320
268 Ga0207706_10119431 3300025933 Bacteria 2318
269 Ga0207686_10424528 3300025934 Bacteria 1018
270 Ga0207709_10009085 3300025935 Bacteria 5481
271 Ga0207709_10130831 3300025935 Bacteria 1710
272 Ga0207670_10148073 3300025936 Bacteria 1739
273 Ga0207704_10323033 3300025938 Bacteria 1191
274 Ga0207665_10001228 3300025939 Bacteria 17289
275 Ga0207691_10080377 3300025940 Bacteria 2932
276 Ga0207691_10236175 3300025940 Bacteria 1581
277 Ga0207711_10076118 3300025941 Bacteria 2922
278 Ga0207689_10000036 3300025942 Bacteria 95211
279 Ga0207689_10009022 3300025942 Bacteria 8638
280 Ga0207689_10017360 3300025942 Bacteria 6090
281 Ga0207689_10158054 3300025942 Bacteria 1868
282 Ga0207679_10025697 3300025945 Bacteria 4054
283 Ga0207651_10077843 3300025960 Bacteria 2376
284 Ga0207712_10404103 3300025961 Unclassified 1149
285 Ga0207640_10074595 3300025981 Bacteria 2296
286 Ga0207639_10004067 3300026041 Bacteria 9865
287 Ga0207678_10012356 3300026067 Bacteria 7496
288 Ga0207708_10056595 3300026075 Bacteria 2991
289 Ga0207708_10316504 3300026075 Bacteria 1272
290 Ga0207708_10358443 3300026075 Unclassified 1198
291 Ga0207702_10000751 3300026078 Bacteria 34631
292 Ga0207648_10006700 3300026089 Bacteria 11425
293 Ga0207648_10034086 3300026089 Bacteria 4490
294 Ga0207648_10161904 3300026089 Bacteria 1976
295 Ga0207674_10022992 3300026116 Bacteria 6686
296 Ga0207675_100009460 3300026118 Bacteria 9122
297 Ga0207675_100159781 3300026118 Bacteria 2149
298 Ga0207675_100201523 3300026118 Bacteria 1912
299 Ga0207675_100210357 3300026118 Bacteria 1870
300 Ga0207675_100840533 3300026118 Unclassified 933
301 Ga0207698_10228381 3300026142 Bacteria 1688
302 Ga0209996_1001686 3300027395 Bacteria 2692
303 Ga0209995_1005941 3300027471 Bacteria 1965
304 Ga0209968_1000975 3300027526 Bacteria 4405
305 Ga0209968_1021707 3300027526 Unclassified 1044
306 Ga0209999_1001106 3300027543 Bacteria 4601
307 Ga0209970_1000665 3300027614 Bacteria 5952
308 Ga0210002_1001546 3300027617 Bacteria 3270
309 Ga0209983_1002142 3300027665 Bacteria 4353
310 Ga0209588_1008317 3300027671 Bacteria 3073
311 Ga0209971_1000019 3300027682 Bacteria 63560
312 Ga0209966_1000101 3300027695 Bacteria 38274
313 Ga0209998_10000017 3300027717 Bacteria 83663
314 Ga0209974_10001118 3300027876 Bacteria 9510
315 Ga0207428_10000035 3300027907 Bacteria 229100
316 Ga0207428_10116846 3300027907 Bacteria 2048
317 Ga0207428_10180733 3300027907 Bacteria 1594
318 Ga0268265_10020724 3300028380 Bacteria 4594
319 Ga0268265_10121555 3300028380 Bacteria 2152
320 Ga0268265_10133901 3300028380 Bacteria 2064
321 Ga0268265_10378600 3300028380 Bacteria 1301
322 Ga0268264_10095017 3300028381 Bacteria 2579
323 Ga0307408_100038056 3300031548 Bacteria 3392
324 Ga0307410_10117595 3300031852 Bacteria 1933
325 Ga0307410_10302729 3300031852 Bacteria 1262
326 Ga0307406_10050006 3300031901 Bacteria 2648
327 Ga0307412_10171731 3300031911 Bacteria 1622
328 Ga0373958_0052399 3300034819 Bacteria 864
329 Ga0373929_0008686 3300035085 Bacteria 1874
330 Ga0373940_0002990 3300035088 Bacteria 3382
331 Ga0373951_0005161 3300035091 Bacteria 3052
332 Ga0373932_0015452 3300035112 Bacteria 1936
333 Ga0373932_0023945 3300035112 Bacteria 1638
334 Ga0373960_0014110 3300035121 Bacteria 2018
335 Ga0373962_0005370 3300035242 Bacteria 3103
336 Ga0373962_0017665 3300035242 Bacteria 1850
337 Ga0373962_0023776 3300035242 Bacteria 1634
338 Ga0373931_0003560 3300035691 Bacteria 7021
339 Ga0373931_0038112 3300035691 Bacteria 2513
340 Ga0395899_0074276 3300037312 Bacteria 2484
341 Ga0395900_0000799 3300037418 Bacteria 41640
342 Ga0395898_0033835 3300037466 Bacteria 5097
343 Ga0395905_0097879 3300037471 Bacteria 2755
344 Ga0395901_0002831 3300038443 Bacteria 17518
345 Ga0439453_0011453 3300041408 Bacteria 1479
346 Ga0439448_0022202 3300042005 Bacteria 1971
347 Ga0439448_0048704 3300042005 Bacteria 1384
348 Ga0439455_0061074 3300042012 Bacteria 1000
349 Ga0439435_0048641 3300042436 Bacteria 1208
350 Ga0439464_0005190 3300042439 Bacteria 3357
351 Ga0439460_0000475 3300042461 Bacteria 8703
352 Ga0451577_0006293 3300042876 Bacteria 11887
353 Ga0451577_0010190 3300042876 Bacteria 9000
354 Ga0451577_0010607 3300042876 Bacteria 8786
355 Ga0451577_0119065 3300042876 Bacteria 2365
356 Ga0451577_0326387 3300042876 Bacteria 1392
357 Ga0453683_0020351 3300044673 Bacteria 4242
358 Ga0453683_0053459 3300044673 Bacteria 2527
359 Ga0453684_0017092 3300044712 Bacteria 11265
360 Ga0453684_0040329 3300044712 Bacteria 6343
361 Ga0453684_0191473 3300044712 Bacteria 2392
362 Ga0451576_0013354 3300045051 Bacteria 9190
363 Ga0451576_0016459 3300045051 Bacteria 8161
364 Ga0451576_0018010 3300045051 Bacteria 7750
365 Ga0451576_0060344 3300045051 Bacteria 3957
366 Ga0451576_0061760 3300045051 Bacteria 3907
367 Ga0451576_0095435 3300045051 Bacteria 3093
368 Ga0451576_0333068 3300045051 Bacteria 1588
369 Ga0451576_0397007 3300045051 Bacteria 1446
370 Ga0495580_0000193 3300046472 Bacteria 46333
371 Ga0495580_0150366 3300046472 Bacteria 1613
372 Ga0495669_0011747 3300046684 Bacteria 3723
373 Ga0496102_0093113 3300048905 Bacteria 2792
374 Ga0496102_0103177 3300048905 Bacteria 2652
375 Ga0496106_0102256 3300048909 Bacteria 2223
376 Ga0496109_0410269 3300048912 Bacteria 1280
377 Ga0496112_0120124 3300048915 Bacteria 2598
378 Ga0501033_0163271 3300049570 Bacteria 1603
379 Ga0501036_0018502 3300049572 Bacteria 5839
380 Ga0501036_0068468 3300049572 Bacteria 3004
381 Ga0501036_0086064 3300049572 Bacteria 2657
382 Ga0501036_0325143 3300049572 Bacteria 1285
383 Ga0501037_0087977 3300049573 Bacteria 2248
384 Ga0501038_0008043 3300049574 Bacteria 9711
385 Ga0501038_0014784 3300049574 Bacteria 7110
386 Ga0501038_0031461 3300049574 Bacteria 4689
387 Ga0501038_0111814 3300049574 Bacteria 2262
388 Ga0501038_0133480 3300049574 Bacteria 2036
389 Ga0501038_0360639 3300049574 Bacteria 1130
390 Ga0501039_0003952 3300049575 Bacteria 11140
391 Ga0501039_0032729 3300049575 Bacteria 4009
392 Ga0501039_0055736 3300049575 Bacteria 3062
393 Ga0501039_0173735 3300049575 Bacteria 1694
394 Ga0501039_0602760 3300049575 Unclassified 861
395 Ga0501040_0000715 3300049576 Bacteria 20478
396 Ga0501040_0005430 3300049576 Bacteria 8248
397 Ga0501040_0019447 3300049576 Bacteria 4517
398 Ga0501040_0020285 3300049576 Bacteria 4429
399 Ga0501040_0027465 3300049576 Bacteria 3833
400 Ga0501040_0052094 3300049576 Bacteria 2801
401 Ga0501040_0069219 3300049576 Bacteria 2435
402 Ga0501040_0069264 3300049576 Bacteria 2434
403 Ga0501040_0071916 3300049576 Bacteria 2388
404 Ga0501040_0079852 3300049576 Bacteria 2265
405 Ga0501040_0089477 3300049576 Bacteria 2139
406 Ga0501040_0091382 3300049576 Bacteria 2116
407 Ga0501040_0161256 3300049576 Unclassified 1585
408 Ga0501040_0290993 3300049576 Bacteria 1167
409 Ga0501040_0294370 3300049576 Bacteria 1160
410 Ga0501040_0326581 3300049576 Bacteria 1098
411 Ga0501041_0000766 3300049577 Bacteria 17168
412 Ga0501041_0005075 3300049577 Bacteria 7673
413 Ga0501041_0020608 3300049577 Bacteria 3943
414 Ga0501041_0133427 3300049577 Bacteria 1547
415 Ga0501041_0180802 3300049577 Bacteria 1320
416 Ga0501042_0001063 3300049578 Bacteria 15701
417 Ga0501042_0034179 3300049578 Bacteria 3605
418 Ga0501042_0061805 3300049578 Bacteria 2675
419 Ga0501042_0071105 3300049578 Bacteria 2489
420 Ga0501042_0158774 3300049578 Unclassified 1631
421 Ga0501042_0278379 3300049578 Bacteria 1208
422 Ga0501042_0290654 3300049578 Unclassified 1180
423 Ga0501043_0070179 3300049579 Bacteria 2752
424 Ga0501046_0001495 3300049580 Bacteria 22395
425 Ga0501046_0021957 3300049580 Bacteria 5260
426 Ga0501046_0040109 3300049580 Bacteria 3743
427 Ga0501046_0047961 3300049580 Bacteria 3384
428 Ga0501047_0040617 3300049581 Bacteria 4498
429 Ga0501048_0005151 3300049582 Bacteria 9958
430 Ga0501048_0019619 3300049582 Bacteria 4958
431 Ga0501048_0042815 3300049582 Bacteria 3241
432 Ga0501048_0073674 3300049582 Bacteria 2410
433 Ga0501048_0093365 3300049582 Bacteria 2123
434 Ga0501048_0125804 3300049582 Bacteria 1812
435 Ga0501048_0174338 3300049582 Bacteria 1524
436 Ga0501068_0135954 3300049584 Bacteria 1539
437 Ga0501068_0292862 3300049584 Bacteria 1041
438 Ga0501068_0347020 3300049584 Bacteria 954
439 Ga0501069_0100424 3300049585 Bacteria 1642
440 Ga0501071_0000637 3300049587 Bacteria 18225
441 Ga0501071_0006050 3300049587 Bacteria 7839
442 Ga0501071_0029703 3300049587 Bacteria 3860
443 Ga0501071_0032719 3300049587 Bacteria 3694
444 Ga0501071_0093810 3300049587 Bacteria 2207
445 Ga0501071_0226876 3300049587 Bacteria 1407
446 Ga0501072_0003962 3300049588 Bacteria 11201
447 Ga0501072_0007465 3300049588 Bacteria 8294
448 Ga0501072_0014339 3300049588 Bacteria 6075
449 Ga0501072_0019816 3300049588 Bacteria 5205
450 Ga0501072_0064963 3300049588 Bacteria 2877
451 Ga0501072_0098840 3300049588 Bacteria 2320
452 Ga0501072_0114011 3300049588 Bacteria 2152
453 Ga0501072_0223741 3300049588 Bacteria 1500
454 Ga0501072_0277227 3300049588 Bacteria 1334
455 Ga0501074_0082460 3300049590 Bacteria 2306
456 Ga0501074_0124182 3300049590 Bacteria 1846
457 Ga0501075_0004993 3300049591 Bacteria 9050
458 Ga0501075_0007402 3300049591 Bacteria 7617
459 Ga0501075_0007966 3300049591 Bacteria 7361
460 Ga0501075_0011767 3300049591 Bacteria 6203
461 Ga0501075_0015264 3300049591 Bacteria 5510
462 Ga0501075_0053367 3300049591 Bacteria 3040
463 Ga0501075_0059048 3300049591 Bacteria 2889
464 Ga0501075_0059968 3300049591 Bacteria 2867
465 Ga0501075_0074581 3300049591 Bacteria 2566
466 Ga0501075_0077447 3300049591 Bacteria 2516
467 Ga0501076_0001617 3300049592 Bacteria 15195
468 Ga0501076_0001958 3300049592 Bacteria 14062
469 Ga0501076_0004329 3300049592 Bacteria 10073
470 Ga0501076_0023042 3300049592 Bacteria 4794
471 Ga0501076_0031089 3300049592 Bacteria 4162
472 Ga0501076_0032130 3300049592 Bacteria 4096
473 Ga0501076_0051317 3300049592 Bacteria 3265
474 Ga0501076_0058271 3300049592 Bacteria 3069
475 Ga0501076_0098777 3300049592 Bacteria 2352
476 Ga0501076_0198429 3300049592 Bacteria 1638
477 Ga0501076_0240627 3300049592 Bacteria 1481
478 Ga0501076_0395952 3300049592 Bacteria 1135
479 Ga0501076_0776118 3300049592 Bacteria 791
480 Ga0501077_0004207 3300049593 Bacteria 8694
481 Ga0501077_0011203 3300049593 Bacteria 5594
482 Ga0501077_0017424 3300049593 Bacteria 4534
483 Ga0501077_0027045 3300049593 Bacteria 3643
484 Ga0501077_0030791 3300049593 Bacteria 3415
485 Ga0501077_0031515 3300049593 Bacteria 3374
486 Ga0501077_0035759 3300049593 Bacteria 3162
487 Ga0501077_0040696 3300049593 Unclassified 2960
488 Ga0501077_0067584 3300049593 Bacteria 2266
489 Ga0501077_0070948 3300049593 Bacteria 2208
490 Ga0501077_0123389 3300049593 Bacteria 1642
491 Ga0501077_0183653 3300049593 Unclassified 1329
492 Ga0501079_0000324 3300049741 Bacteria 30008
493 Ga0501079_0002811 3300049741 Bacteria 12692
494 Ga0501079_0003474 3300049741 Bacteria 11583
495 Ga0501079_0004511 3300049741 Bacteria 10322
496 Ga0501079_0010231 3300049741 Bacteria 7121
497 Ga0501079_0011992 3300049741 Bacteria 6616
498 Ga0501079_0045609 3300049741 Bacteria 3383
499 Ga0501079_0047085 3300049741 Bacteria 3327
500 Ga0501079_0155328 3300049741 Bacteria 1784
501 Ga0501079_0491008 3300049741 Bacteria 965
502 Ga0501080_0034778 3300049742 Bacteria 4706
503 Ga0501080_0249233 3300049742 Unclassified 1620
504 Ga0501080_0388649 3300049742 Unclassified 1256
505 Ga0501081_0000617 3300049743 Bacteria 20308
506 Ga0501081_0001024 3300049743 Bacteria 16697
507 Ga0501081_0001495 3300049743 Bacteria 14330
508 Ga0501081_0007879 3300049743 Bacteria 6909
509 Ga0501081_0015087 3300049743 Bacteria 5099
510 Ga0501081_0016233 3300049743 Bacteria 4921
511 Ga0501081_0090100 3300049743 Bacteria 2155
512 Ga0501081_0119979 3300049743 Bacteria 1872
513 Ga0501081_0255905 3300049743 Bacteria 1279
514 Ga0501081_0309331 3300049743 Bacteria 1160
515 Ga0501083_0008240 3300049744 Bacteria 7368
516 Ga0501083_0012874 3300049744 Bacteria 5851
517 Ga0501083_0089287 3300049744 Unclassified 2037
518 Ga0501083_0139310 3300049744 Bacteria 1589
519 Ga0501083_0160056 3300049744 Bacteria 1473
520 Ga0501035_0032770 3300049822 Bacteria 4726
521 Ga0501035_0101408 3300049822 Bacteria 2526
522 Ga0501045_0000510 3300049824 Bacteria 24155
523 Ga0501045_0017820 3300049824 Bacteria 5044
524 Ga0501045_0028062 3300049824 Bacteria 4059
525 Ga0501045_0040926 3300049824 Bacteria 3371
526 Ga0501045_0105255 3300049824 Bacteria 2091
527 Ga0501045_0178942 3300049824 Bacteria 1580
528 Ga0501045_0185261 3300049824 Bacteria 1551
529 Ga0501045_0197718 3300049824 Unclassified 1498
530 Ga0501045_0326904 3300049824 Unclassified 1141
531 Ga0501045_0392899 3300049824 Bacteria 1032
532 nmdc:mga05p37_1260_c1 3300050507 Bacteria 29358
533 nmdc:mga05p37_147240_c1 3300050507 Bacteria 2882
534 nmdc:mga05p37_157054_c1 3300050507 Bacteria 2779
535 nmdc:mga05p37_163362_c1 3300050507 Bacteria 2719
536 nmdc:mga05p37_16977_c1 3300050507 Bacteria 8779
537 nmdc:mga05p37_224659_c1 3300050507 Bacteria 2265
538 nmdc:mga05p37_246253_c1 3300050507 Bacteria 2146
539 nmdc:mga05p37_254_c1 3300050507 Bacteria 55030
540 nmdc:mga05p37_25753_c1 3300050507 Bacteria 7155
541 nmdc:mga05p37_290265_c1 3300050507 Bacteria 1947
542 nmdc:mga05p37_299420_c1 3300050507 Bacteria 1911
543 nmdc:mga05p37_317349_c1 3300050507 Bacteria 1845
544 nmdc:mga05p37_31822_c1 3300050507 Bacteria 6447
545 nmdc:mga05p37_39025_c1 3300050507 Bacteria 5826
546 nmdc:mga05p37_40871_c1 3300050507 Bacteria 5694
547 nmdc:mga05p37_4596_c1 3300050507 Bacteria 16135
548 nmdc:mga05p37_462187_c1 3300050507 Bacteria 1466
549 nmdc:mga05p37_47421_c1 3300050507 Bacteria 5284
550 nmdc:mga05p37_4749_c1 3300050507 Bacteria 15876
551 nmdc:mga05p37_52099_c1 3300050507 Bacteria 5033
552 nmdc:mga05p37_604127_c1 3300050507 Bacteria 1238
553 nmdc:mga05p37_857_c1 3300050507 Bacteria 34239
554 nmdc:mga09592_119364_c1 3300050508 Bacteria 2264
555 nmdc:mga09592_148110_c1 3300050508 Bacteria 2024
556 nmdc:mga09592_2472_c1 3300050508 Bacteria 14920
557 nmdc:mga09592_2936_c1 3300050508 Bacteria 13816
558 nmdc:mga09592_3441_c1 3300050508 Bacteria 12782
559 nmdc:mga09592_36897_c1 3300050508 Bacteria 4096
560 nmdc:mga09592_46879_c1 3300050508 Bacteria 3641
561 nmdc:mga09592_49606_c1 3300050508 Bacteria 3539
562 nmdc:mga09592_52573_c1 3300050508 Bacteria 3439
563 nmdc:mga09592_576_c1 3300050508 Bacteria 27843
564 nmdc:mga09592_96422_c1 3300050508 Bacteria 2530
565 nmdc:mga0qj67_118_c1 3300050509 Bacteria 52561
566 nmdc:mga0qj67_146951_c1 3300050509 Bacteria 1912
567 nmdc:mga0qj67_170697_c1 3300050509 Bacteria 1766
568 nmdc:mga0qj67_2132_c1 3300050509 Bacteria 14088
569 nmdc:mga0qj67_37305_c1 3300050509 Bacteria 3806
570 nmdc:mga06r32_1432_c1 3300050510 Bacteria 21539
571 nmdc:mga06r32_184078_c1 3300050510 Bacteria 2075
572 nmdc:mga06r32_203638_c1 3300050510 Bacteria 1967
573 nmdc:mga06r32_254920_c1 3300050510 Bacteria 1742
574 nmdc:mga06r32_2582_c1 3300050510 Bacteria 16168
575 nmdc:mga06r32_25887_c1 3300050510 Bacteria 5463
576 nmdc:mga06r32_27723_c1 3300050510 Bacteria 5295
577 nmdc:mga06r32_294601_c1 3300050510 Bacteria 1609
578 nmdc:mga06r32_485_c1 3300050510 Bacteria 34276
579 nmdc:mga06r32_534_c1 3300050510 Bacteria 32901
580 nmdc:mga06r32_8602_c1 3300050510 Bacteria 9204
581 nmdc:mga08y16_10799_c1 3300050511 Bacteria 9585
582 nmdc:mga08y16_12798_c1 3300050511 Bacteria 8827
583 nmdc:mga08y16_327191_c1 3300050511 Bacteria 1577
584 nmdc:mga08y16_45477_c1 3300050511 Bacteria 4600
585 nmdc:mga08y16_636721_c1 3300050511 Unclassified 1072
586 nmdc:mga0n895_1378_c1 3300050512 Bacteria 18092
587 nmdc:mga0n895_142403_c1 3300050512 Bacteria 2427
588 nmdc:mga0n895_14516_c1 3300050512 Bacteria 7158
589 nmdc:mga0n895_153340_c1 3300050512 Bacteria 2335
590 nmdc:mga0n895_165284_c1 3300050512 Bacteria 2245
591 nmdc:mga0n895_2868_c1 3300050512 Bacteria 13669
592 nmdc:mga0n895_298896_c1 3300050512 Bacteria 1632
593 nmdc:mga0n895_302759_c1 3300050512 Bacteria 1620
594 nmdc:mga0n895_3592_c1 3300050512 Bacteria 12540
595 nmdc:mga0n895_67613_c1 3300050512 Bacteria 3539
596 nmdc:mga0n895_7596_c1 3300050512 Bacteria 9322
597 nmdc:mga0rr50_128510_c1 3300050513 Bacteria 2026
598 nmdc:mga0rr50_13486_c1 3300050513 Bacteria 5322
599 nmdc:mga0rr50_16714_c1 3300050513 Bacteria 4881
600 nmdc:mga0rr50_1915_c1 3300050513 Bacteria 11568
601 nmdc:mga0rr50_211813_c1 3300050513 Bacteria 1597
602 nmdc:mga0rr50_2790_c1 3300050513 Bacteria 9930
603 nmdc:mga0rr50_329280_c1 3300050513 Bacteria 1282
604 nmdc:mga0rr50_49346_c1 3300050513 Bacteria 3116
605 nmdc:mga08x19_15484_c1 3300050514 Bacteria 4640
606 nmdc:mga08x19_15633_c1 3300050514 Bacteria 4618
607 nmdc:mga08x19_27944_c1 3300050514 Bacteria 3531
608 nmdc:mga08x19_3647_c1 3300050514 Bacteria 9166
609 nmdc:mga08x19_5819_c1 3300050514 Bacteria 7292
610 nmdc:mga08x19_92578_c1 3300050514 Bacteria 1997
611 nmdc:mga0a205_1071_c1 3300050515 Bacteria 22735
612 nmdc:mga0a205_1146_c1 3300050515 Bacteria 22011
613 nmdc:mga0a205_117_c1 3300050515 Bacteria 47476
614 nmdc:mga0a205_1967_c1 3300050515 Bacteria 17894
615 nmdc:mga0a205_200061_c2 3300050515 Unclassified 992
616 nmdc:mga0a205_232996_c1 3300050515 Bacteria 1724
617 nmdc:mga0a205_2571_c1 3300050515 Bacteria 16003
618 nmdc:mga0a205_27028_c1 3300050515 Bacteria 5479
619 nmdc:mga0a205_33312_c1 3300050515 Bacteria 4941
620 nmdc:mga0a205_7242_c2 3300050515 Bacteria 2545
621 nmdc:mga0a205_96199_c1 3300050515 Bacteria 2860
622 Ga0501084_0000783 3300054114 Bacteria 24233
623 Ga0501084_0003284 3300054114 Bacteria 13088
624 Ga0501084_0004077 3300054114 Bacteria 11899
625 Ga0501084_0007310 3300054114 Bacteria 9097
626 Ga0501084_0013074 3300054114 Bacteria 6868
627 Ga0501084_0051798 3300054114 Bacteria 3436
628 Ga0501084_0094890 3300054114 Bacteria 2505
629 Ga0501084_0116698 3300054114 Bacteria 2244
630 Ga0501084_0118909 3300054114 Bacteria 2221
631 Ga0501084_0164506 3300054114 Unclassified 1872
632 Ga0501084_0350017 3300054114 Unclassified 1248
633 Ga0501084_0528704 3300054114 Unclassified 997
634 Ga0501082_0005976 3300060353 Bacteria 10555
635 Ga0501082_0011500 3300060353 Bacteria 7619
636 Ga0501082_0026420 3300060353 Bacteria 5003
637 Ga0501082_0057985 3300060353 Bacteria 3335
638 Ga0501082_0183831 3300060353 Bacteria 1818
639 Ga0530510_0000244 3300061734 Bacteria 34085
640 Ga0530510_0000352 3300061734 Bacteria 29758
641 Ga0530510_0014626 3300061734 Bacteria 5539
642 Ga0530510_0040139 3300061734 Bacteria 3378
643 Ga0530510_0041863 3300061734 Bacteria 3308
644 Ga0530510_0051190 3300061734 Bacteria 2983
645 Ga0530510_0126546 3300061734 Bacteria 1878
646 Ga0530510_0169141 3300061734 Bacteria 1619
647 Ga0530510_0174021 3300061734 Unclassified 1595
648 Ga0530510_0332120 3300061734 Unclassified 1140
649 Ga0530510_0421698 3300061734 Bacteria 1007
650 Ga0530510_0507650 3300061734 Bacteria 914
651 Ga0105249_10286070
652 JGI25406J46586_10038982
653 Ga0070683_100291575
654 Ga0070670_100003118
655 Ga0070670_100576079
656 Ga0068869_100000905
657 Ga0068869_100015845
658 Ga0068869_100056406
659 Ga0070680_100045290
660 Ga0070680_100106290
661 Ga0070682_100000577
662 Ga0070689_100039232
663 Ga0070691_10039766
664 Ga0070691_10106987
665 Ga0070661_100005036
666 Ga0070692_10006146
667 Ga0070692_10039362
668 Ga0070669_100092551
669 Ga0070669_100157615
670 Ga0070673_100143132
671 Ga0070688_100455801
672 Ga0070701_10023446
673 Ga0070701_10028719
674 Ga0070711_100472770
675 Ga0070705_100000177
676 Ga0070705_100082718
677 Ga0070705_100335682
678 Ga0070700_100173493
679 Ga0070694_100001713
680 Ga0070694_100004610
681 Ga0070708_100002559
682 Ga0070708_100018486
683 Ga0070708_100033885
684 Ga0070708_100034394
685 Ga0070708_100035358
686 Ga0070708_100049312
687 Ga0070708_100105246
688 Ga0070708_100167752
689 Ga0070708_100493038
690 Ga0070663_100003261
691 Ga0070662_100035276
692 Ga0070662_100191402
693 Ga0068867_100027024
694 Ga0068867_100079459
695 Ga0070706_100006000
696 Ga0070706_100007224
697 Ga0070706_100007914
698 Ga0070706_100012758
699 Ga0070706_100022859
700 Ga0070706_100033893
701 Ga0070707_100003606
702 Ga0070707_100011125
703 Ga0070707_100033676
704 Ga0070707_100048336
705 Ga0070707_100050171
706 Ga0070707_100058098
707 Ga0070698_100007159
708 Ga0070698_100011945
709 Ga0070698_100025804
710 Ga0070698_100028253
711 Ga0070698_100062071
712 Ga0070698_100109365
713 Ga0070698_100554639
714 Ga0070699_100004713
715 Ga0070699_100007939
716 Ga0070699_100014855
717 Ga0070699_100016189
718 Ga0070699_100035418
719 Ga0070699_100112278
720 Ga0070699_100464143
721 Ga0070699_100484504
722 Ga0070699_100515506
723 Ga0070679_100011090
724 Ga0070697_100003605
725 Ga0070697_100030250
726 Ga0070697_100040530
727 Ga0070697_100084187
728 Ga0070697_100107139
729 Ga0070697_100174526
730 Ga0070697_100411389
731 Ga0068853_100005240
732 Ga0070672_100048193
733 Ga0070686_100131586
734 Ga0070695_100000973
735 Ga0070695_100003426
736 Ga0070695_100005592
737 Ga0070695_100312116
738 Ga0070696_100000622
739 Ga0070696_100013430
740 Ga0070696_100018486
741 Ga0070693_100001756
742 Ga0070693_100221760
743 Ga0070704_100000270
744 Ga0070704_100041498
745 Ga0070704_100095266
746 Ga0070704_100230912
747 Ga0068855_100002606
748 Ga0070664_100004718
749 Ga0068857_100016016
750 Ga0068854_100021177
751 Ga0068856_100000268
752 Ga0070702_100171512
753 Ga0068852_100515704
754 Ga0068859_100000274
755 Ga0068859_100135439
756 Ga0068859_100167949
757 Ga0068864_100001001
758 Ga0068864_100197084
759 Ga0068861_100024798
760 Ga0068870_10026065
761 Ga0068870_10035300
762 Ga0068863_100392337
763 Ga0068863_100506011
764 Ga0068858_100175966
765 Ga0068860_100043956
766 Ga0068860_100143020
767 Ga0068860_100297830
768 Ga0068860_100417589
769 Ga0068862_100032992
770 Ga0068862_100473169
771 Ga0068862_100532504
772 Ga0081455_10010507
773 Ga0081538_10008930
774 Ga0081540_1062838
775 Ga0081539_10000210
776 Ga0070716_100005494
777 Ga0075428_100005779
778 Ga0075428_100011030
779 Ga0075428_100020810
780 Ga0075428_100154134
781 Ga0075428_100154230
782 Ga0075428_100726534
783 Ga0075430_100000287
784 Ga0075430_100013627
785 Ga0075430_100043330
786 Ga0075430_100076499
787 Ga0075430_100093188
788 Ga0075430_100213937
789 Ga0075431_100000268
790 Ga0075431_100001661
791 Ga0075431_100001940
792 Ga0075431_100002054
793 Ga0075431_100002758
794 Ga0075431_100002976
795 Ga0075431_100027850
796 Ga0075431_100037338
797 Ga0075431_100093110
798 Ga0075431_100166118
799 Ga0075431_100517677
800 Ga0075433_10000893
801 Ga0075433_10001032
802 Ga0075433_10002367
803 Ga0075433_10010004
804 Ga0075433_10017686
805 Ga0075433_10047312
806 Ga0075433_10068278
807 Ga0075433_10099272
808 Ga0075433_10255079
809 Ga0075433_10492135
810 Ga0075434_100005432
811 Ga0075434_100006755
812 Ga0075434_100017488
813 Ga0075434_100023503
814 Ga0075434_100053996
815 Ga0075434_100064023
816 Ga0075434_100095876
817 Ga0075434_100160697
818 Ga0075434_100298645
819 Ga0075429_100000222
820 Ga0075429_100000886
821 Ga0075429_100003832
822 Ga0075429_100011391
823 Ga0075429_100013483
824 Ga0075429_100016313
825 Ga0075429_100046821
826 Ga0075436_100030668
827 Ga0075436_100033028
828 Ga0075436_100050540
829 Ga0075436_100062202
830 Ga0075436_100260008
831 Ga0097620_100000274
832 Ga0097620_100135436
833 Ga0097620_100167940
834 Ga0075435_100005563
835 Ga0075435_100014112
836 Ga0075435_100054932
837 Ga0075435_100147342
838 Ga0075435_100156952
839 Ga0099794_10032096
840 Ga0099794_10127532
841 Ga0099794_10134056
842 Ga0105240_10149373
843 Ga0111539_10002152
844 Ga0111539_10007948
845 Ga0111539_10017156
846 Ga0111539_10060257
847 Ga0105247_10182350
848 Ga0114129_10000003
849 Ga0114129_10000044
850 Ga0114129_10004983
851 Ga0114129_10005583
852 Ga0114129_10010961
853 Ga0114129_10018393
854 Ga0114129_10058176
855 Ga0114129_10059711
856 Ga0114129_10063554
857 Ga0114129_10081817
858 Ga0114129_10088641
859 Ga0114129_10107267
860 Ga0114129_10173796
861 Ga0114129_10219470
862 Ga0114129_10280534
863 Ga0114129_10476166
864 Ga0114129_10584925
865 Ga0114129_10817010
866 Ga0105243_10436818
867 Ga0105241_10260930
868 Ga0105242_10150976
869 Ga0105249_10041579
870 Ga0105249_10279179
871 Ga0105249_10531568
872 Ga0105249_10575330
873 Ga0105239_10201277
874 Ga0157373_10406362
875 Ga0157369_10121533
876 Ga0157378_10305323
877 Ga0163162_10032190
878 Ga0163162_10256754
879 Ga0157372_10000675
880 Ga0157372_10113918
881 Ga0157375_10315264
882 Ga0182008_10093121
883 Ga0157379_10158467
884 Ga0163161_10417449
885 Ga0207653_10001860
886 Ga0207642_10065839
887 Ga0207688_10107187
888 Ga0207645_10051783
889 Ga0207684_10000550
890 Ga0207684_10004127
891 Ga0207684_10004874
892 Ga0207684_10021128
893 Ga0207684_10028956
894 Ga0207684_10035160
895 Ga0207684_10058575
896 Ga0207654_10189978
897 Ga0207693_10006930
898 Ga0207660_10000367
899 Ga0207660_10064265
900 Ga0207660_10095519
901 Ga0207652_10007547
902 Ga0207646_10000462
903 Ga0207646_10007086
904 Ga0207646_10025072
905 Ga0207646_10026032
906 Ga0207646_10034044
907 Ga0207646_10048806
908 Ga0207646_10092635
909 Ga0207646_10270035
910 Ga0207681_10081269
911 Ga0207681_10217660
912 Ga0207650_10087876
913 Ga0207650_10145613
914 Ga0207659_10351072
915 Ga0207690_10001710
916 Ga0207706_10041538
917 Ga0207706_10119241
918 Ga0207706_10119431
919 Ga0207686_10424528
920 Ga0207709_10009085
921 Ga0207709_10130831
922 Ga0207670_10148073
923 Ga0207704_10323033
924 Ga0207665_10001228
925 Ga0207691_10080377
926 Ga0207691_10236175
927 Ga0207711_10076118
928 Ga0207689_10000036
929 Ga0207689_10009022
930 Ga0207689_10017360
931 Ga0207689_10158054
932 Ga0207679_10025697
933 Ga0207651_10077843
934 Ga0207712_10404103
935 Ga0207640_10074595
936 Ga0207639_10004067
937 Ga0207678_10012356
938 Ga0207708_10056595
939 Ga0207708_10316504
940 Ga0207708_10358443
941 Ga0207702_10000751
942 Ga0207648_10006700
943 Ga0207648_10034086
944 Ga0207648_10161904
945 Ga0207674_10022992
946 Ga0207675_100009460
947 Ga0207675_100159781
948 Ga0207675_100201523
949 Ga0207675_100210357
950 Ga0207675_100840533
951 Ga0207698_10228381
952 Ga0209996_1001686
953 Ga0209995_1005941
954 Ga0209968_1000975
955 Ga0209968_1021707
956 Ga0209999_1001106
957 Ga0209970_1000665
958 Ga0210002_1001546
959 Ga0209983_1002142
960 Ga0209588_1008317
961 Ga0209971_1000019
962 Ga0209966_1000101
963 Ga0209998_10000017
964 Ga0209974_10001118
965 Ga0207428_10000035
966 Ga0207428_10116846
967 Ga0207428_10180733
968 Ga0268265_10020724
969 Ga0268265_10121555
970 Ga0268265_10133901
971 Ga0268265_10378600
972 Ga0268264_10095017
973 Ga0307408_100038056
974 Ga0307410_10117595
975 Ga0307410_10302729
976 Ga0307406_10050006
977 Ga0307412_10171731
978 Ga0373958_0052399
979 Ga0373929_0008686
980 Ga0373940_0002990
981 Ga0373951_0005161
982 Ga0373932_0015452
983 Ga0373932_0023945
984 Ga0373960_0014110
985 Ga0373962_0005370
986 Ga0373962_0017665
987 Ga0373962_0023776
988 Ga0373931_0003560
989 Ga0373931_0038112
990 Ga0395899_0074276
991 Ga0395900_0000799
992 Ga0395898_0033835
993 Ga0395905_0097879
994 Ga0395901_0002831
995 Ga0439453_0011453
996 Ga0439448_0022202
997 Ga0439448_0048704
998 Ga0439455_0061074
999 Ga0439435_0048641
1000 Ga0439464_0005190
1001 Ga0439460_0000475
1002 Ga0451577_0006293
1003 Ga0451577_0010190
1004 Ga0451577_0010607
1005 Ga0451577_0119065
1006 Ga0451577_0326387
1007 Ga0453683_0020351
1008 Ga0453683_0053459
1009 Ga0453684_0017092
1010 Ga0453684_0040329
1011 Ga0453684_0191473
1012 Ga0451576_0013354
1013 Ga0451576_0016459
1014 Ga0451576_0018010
1015 Ga0451576_0060344
1016 Ga0451576_0061760
1017 Ga0451576_0095435
1018 Ga0451576_0333068
1019 Ga0451576_0397007
1020 Ga0495580_0000193
1021 Ga0495580_0150366
1022 Ga0495669_0011747
1023 Ga0496102_0093113
1024 Ga0496102_0103177
1025 Ga0496106_0102256
1026 Ga0496109_0410269
1027 Ga0496112_0120124
1028 Ga0501033_0163271
1029 Ga0501036_0018502
1030 Ga0501036_0068468
1031 Ga0501036_0086064
1032 Ga0501036_0325143
1033 Ga0501037_0087977
1034 Ga0501038_0008043
1035 Ga0501038_0014784
1036 Ga0501038_0031461
1037 Ga0501038_0111814
1038 Ga0501038_0133480
1039 Ga0501038_0360639
1040 Ga0501039_0003952
1041 Ga0501039_0032729
1042 Ga0501039_0055736
1043 Ga0501039_0173735
1044 Ga0501039_0602760
1045 Ga0501040_0000715
1046 Ga0501040_0005430
1047 Ga0501040_0019447
1048 Ga0501040_0020285
1049 Ga0501040_0027465
1050 Ga0501040_0052094
1051 Ga0501040_0069219
1052 Ga0501040_0069264
1053 Ga0501040_0071916
1054 Ga0501040_0079852
1055 Ga0501040_0089477
1056 Ga0501040_0091382
1057 Ga0501040_0161256
1058 Ga0501040_0290993
1059 Ga0501040_0294370
1060 Ga0501040_0326581
1061 Ga0501041_0000766
1062 Ga0501041_0005075
1063 Ga0501041_0020608
1064 Ga0501041_0133427
1065 Ga0501041_0180802
1066 Ga0501042_0001063
1067 Ga0501042_0034179
1068 Ga0501042_0061805
1069 Ga0501042_0071105
1070 Ga0501042_0158774
1071 Ga0501042_0278379
1072 Ga0501042_0290654
1073 Ga0501043_0070179
1074 Ga0501046_0001495
1075 Ga0501046_0021957
1076 Ga0501046_0040109
1077 Ga0501046_0047961
1078 Ga0501047_0040617
1079 Ga0501048_0005151
1080 Ga0501048_0019619
1081 Ga0501048_0042815
1082 Ga0501048_0073674
1083 Ga0501048_0093365
1084 Ga0501048_0125804
1085 Ga0501048_0174338
1086 Ga0501068_0135954
1087 Ga0501068_0292862
1088 Ga0501068_0347020
1089 Ga0501069_0100424
1090 Ga0501071_0000637
1091 Ga0501071_0006050
1092 Ga0501071_0029703
1093 Ga0501071_0032719
1094 Ga0501071_0093810
1095 Ga0501071_0226876
1096 Ga0501072_0003962
1097 Ga0501072_0007465
1098 Ga0501072_0014339
1099 Ga0501072_0019816
1100 Ga0501072_0064963
1101 Ga0501072_0098840
1102 Ga0501072_0114011
1103 Ga0501072_0223741
1104 Ga0501072_0277227
1105 Ga0501074_0082460
1106 Ga0501074_0124182
1107 Ga0501075_0004993
1108 Ga0501075_0007402
1109 Ga0501075_0007966
1110 Ga0501075_0011767
1111 Ga0501075_0015264
1112 Ga0501075_0053367
1113 Ga0501075_0059048
1114 Ga0501075_0059968
1115 Ga0501075_0074581
1116 Ga0501075_0077447
1117 Ga0501076_0001617
1118 Ga0501076_0001958
1119 Ga0501076_0004329
1120 Ga0501076_0023042
1121 Ga0501076_0031089
1122 Ga0501076_0032130
1123 Ga0501076_0051317
1124 Ga0501076_0058271
1125 Ga0501076_0098777
1126 Ga0501076_0198429
1127 Ga0501076_0240627
1128 Ga0501076_0395952
1129 Ga0501076_0776118
1130 Ga0501077_0004207
1131 Ga0501077_0011203
1132 Ga0501077_0017424
1133 Ga0501077_0027045
1134 Ga0501077_0030791
1135 Ga0501077_0031515
1136 Ga0501077_0035759
1137 Ga0501077_0040696
1138 Ga0501077_0067584
1139 Ga0501077_0070948
1140 Ga0501077_0123389
1141 Ga0501077_0183653
1142 Ga0501079_0000324
1143 Ga0501079_0002811
1144 Ga0501079_0003474
1145 Ga0501079_0004511
1146 Ga0501079_0010231
1147 Ga0501079_0011992
1148 Ga0501079_0045609
1149 Ga0501079_0047085
1150 Ga0501079_0155328
1151 Ga0501079_0491008
1152 Ga0501080_0034778
1153 Ga0501080_0249233
1154 Ga0501080_0388649
1155 Ga0501081_0000617
1156 Ga0501081_0001024
1157 Ga0501081_0001495
1158 Ga0501081_0007879
1159 Ga0501081_0015087
1160 Ga0501081_0016233
1161 Ga0501081_0090100
1162 Ga0501081_0119979
1163 Ga0501081_0255905
1164 Ga0501081_0309331
1165 Ga0501083_0008240
1166 Ga0501083_0012874
1167 Ga0501083_0089287
1168 Ga0501083_0139310
1169 Ga0501083_0160056
1170 Ga0501035_0032770
1171 Ga0501035_0101408
1172 Ga0501045_0000510
1173 Ga0501045_0017820
1174 Ga0501045_0028062
1175 Ga0501045_0040926
1176 Ga0501045_0105255
1177 Ga0501045_0178942
1178 Ga0501045_0185261
1179 Ga0501045_0197718
1180 Ga0501045_0326904
1181 Ga0501045_0392899
1182 nmdc:mga05p37_1260_c1
1183 nmdc:mga05p37_147240_c1
1184 nmdc:mga05p37_157054_c1
1185 nmdc:mga05p37_163362_c1
1186 nmdc:mga05p37_16977_c1
1187 nmdc:mga05p37_224659_c1
1188 nmdc:mga05p37_246253_c1
1189 nmdc:mga05p37_254_c1
1190 nmdc:mga05p37_25753_c1
1191 nmdc:mga05p37_290265_c1
1192 nmdc:mga05p37_299420_c1
1193 nmdc:mga05p37_317349_c1
1194 nmdc:mga05p37_31822_c1
1195 nmdc:mga05p37_39025_c1
1196 nmdc:mga05p37_40871_c1
1197 nmdc:mga05p37_4596_c1
1198 nmdc:mga05p37_462187_c1
1199 nmdc:mga05p37_47421_c1
1200 nmdc:mga05p37_4749_c1
1201 nmdc:mga05p37_52099_c1
1202 nmdc:mga05p37_604127_c1
1203 nmdc:mga05p37_857_c1
1204 nmdc:mga09592_119364_c1
1205 nmdc:mga09592_148110_c1
1206 nmdc:mga09592_2472_c1
1207 nmdc:mga09592_2936_c1
1208 nmdc:mga09592_3441_c1
1209 nmdc:mga09592_36897_c1
1210 nmdc:mga09592_46879_c1
1211 nmdc:mga09592_49606_c1
1212 nmdc:mga09592_52573_c1
1213 nmdc:mga09592_576_c1
1214 nmdc:mga09592_96422_c1
1215 nmdc:mga0qj67_118_c1
1216 nmdc:mga0qj67_146951_c1
1217 nmdc:mga0qj67_170697_c1
1218 nmdc:mga0qj67_2132_c1
1219 nmdc:mga0qj67_37305_c1
1220 nmdc:mga06r32_1432_c1
1221 nmdc:mga06r32_184078_c1
1222 nmdc:mga06r32_203638_c1
1223 nmdc:mga06r32_254920_c1
1224 nmdc:mga06r32_2582_c1
1225 nmdc:mga06r32_25887_c1
1226 nmdc:mga06r32_27723_c1
1227 nmdc:mga06r32_294601_c1
1228 nmdc:mga06r32_485_c1
1229 nmdc:mga06r32_534_c1
1230 nmdc:mga06r32_8602_c1
1231 nmdc:mga08y16_10799_c1
1232 nmdc:mga08y16_12798_c1
1233 nmdc:mga08y16_327191_c1
1234 nmdc:mga08y16_45477_c1
1235 nmdc:mga08y16_636721_c1
1236 nmdc:mga0n895_1378_c1
1237 nmdc:mga0n895_142403_c1
1238 nmdc:mga0n895_14516_c1
1239 nmdc:mga0n895_153340_c1
1240 nmdc:mga0n895_165284_c1
1241 nmdc:mga0n895_2868_c1
1242 nmdc:mga0n895_298896_c1
1243 nmdc:mga0n895_302759_c1
1244 nmdc:mga0n895_3592_c1
1245 nmdc:mga0n895_67613_c1
1246 nmdc:mga0n895_7596_c1
1247 nmdc:mga0rr50_128510_c1
1248 nmdc:mga0rr50_13486_c1
1249 nmdc:mga0rr50_16714_c1
1250 nmdc:mga0rr50_1915_c1
1251 nmdc:mga0rr50_211813_c1
1252 nmdc:mga0rr50_2790_c1
1253 nmdc:mga0rr50_329280_c1
1254 nmdc:mga0rr50_49346_c1
1255 nmdc:mga08x19_15484_c1
1256 nmdc:mga08x19_15633_c1
1257 nmdc:mga08x19_27944_c1
1258 nmdc:mga08x19_3647_c1
1259 nmdc:mga08x19_5819_c1
1260 nmdc:mga08x19_92578_c1
1261 nmdc:mga0a205_1071_c1
1262 nmdc:mga0a205_1146_c1
1263 nmdc:mga0a205_117_c1
1264 nmdc:mga0a205_1967_c1
1265 nmdc:mga0a205_200061_c2
1266 nmdc:mga0a205_232996_c1
1267 nmdc:mga0a205_2571_c1
1268 nmdc:mga0a205_27028_c1
1269 nmdc:mga0a205_33312_c1
1270 nmdc:mga0a205_7242_c2
1271 nmdc:mga0a205_96199_c1
1272 Ga0501084_0000783
1273 Ga0501084_0003284
1274 Ga0501084_0004077
1275 Ga0501084_0007310
1276 Ga0501084_0013074
1277 Ga0501084_0051798
1278 Ga0501084_0094890
1279 Ga0501084_0116698
1280 Ga0501084_0118909
1281 Ga0501084_0164506
1282 Ga0501084_0350017
1283 Ga0501084_0528704
1284 Ga0501082_0005976
1285 Ga0501082_0011500
1286 Ga0501082_0026420
1287 Ga0501082_0057985
1288 Ga0501082_0183831
1289 Ga0530510_0000244
1290 Ga0530510_0000352
1291 Ga0530510_0014626
1292 Ga0530510_0040139
1293 Ga0530510_0041863
1294 Ga0530510_0051190
1295 Ga0530510_0126546
1296 Ga0530510_0169141
1297 Ga0530510_0174021
1298 Ga0530510_0332120
1299 Ga0530510_0421698
1300 Ga0530510_0507650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

29

196

0.98

PF17778

BLACT_WH

Beta-lactamase associated winged helix domain

231

280

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ad9-assembly2.cif.gz_F crystal structure of human lactb2. 0.9073 4 279
4ad9-assembly1.cif.gz_B crystal structure of human lactb2. 0.9009 4 280
4ad9-assembly2.cif.gz_E crystal structure of human lactb2. 0.8984 4 278
4ad9-assembly2.cif.gz_F crystal structure of human lactb2. 0.8798 4 279
4ad9-assembly1.cif.gz_B crystal structure of human lactb2. 0.8766 4 280
ID Description Score Start End Superfamily
af_Q95Q18_3_200_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9198 3 197 3.60.15.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9087 114 198 3.60.15.10
af_A4HZ66_7_206_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9061 1 198 3.60.15.10
af_Q95Q18_3_200_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.902 3 197 3.60.15.10
af_Q95Q18_202_279_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9011 202 280 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F7NPS6-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9835 3 280 GO:0016787
GO:0046872
AF-A0A1F7NPS6-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9765 3 280 GO:0016787
GO:0046872
AF-A0A1Q7UF19-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9733 3 280 GO:0016787
GO:0046872
AF-A0A6V8KCH8-F1-model_v4 LACTB2 winged helix domain-containing protein 0.9556 151 263 GO:0016787
GO:0046872
AF-A0A5P9FDN8-F1-model_v4 LACTB2 winged helix domain-containing protein 0.9556 171 280 GO:0016787
GO:0046872

Map