F472463

General Info

Members Datasets Scaffolds Average Seq Length
649 330 1298 120

Family's Representative Sequence

Representative Sequence 3300042008|Ga0439450_225075|Ga0439450_225075_87_461
Length 124
Sequence MSVLEFSVKTATLGGEAFVVTLAGEVDLHTAPELEQALEGVVGLGGTAVAVDLAEVTFIDSTTLEVLLRYHERFRGLGGALVIVTDDRRVLRTFEITGLDRVFTIERRLADAVAAILPDSAPTS

Samples

Sample ID Description Type Environment
1 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
89 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
90 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
91 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
92 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
93 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
94 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
202 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
203 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
204 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
207 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 2.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.93
Rhizosphere 91.68
Stem 0
Stem Tuber 0
Unclassified 14.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439450_225075 3300042008 Bacteria 506
2 ARcpr5oldR_c011098 3300000041 Bacteria 769
3 ARCol0yngRDRAFT_1008390 3300000652 Bacteria 745
4 JGI25407J50210_10000994 3300003373 Bacteria 6154
5 JGI25407J50210_10042930 3300003373 Bacteria 1156
6 JGI25407J50210_10063179 3300003373 Bacteria 928
7 JGI25407J50210_10072244 3300003373 Bacteria 861
8 Ga0070658_10001923 3300005327 Bacteria 17483
9 Ga0070683_100015394 3300005329 Bacteria 6717
10 Ga0070683_101283763 3300005329 Bacteria 704
11 Ga0070690_101752447 3300005330 Bacteria 506
12 Ga0070677_10067188 3300005333 Bacteria 1497
13 Ga0068869_101069334 3300005334 Bacteria 705
14 Ga0070680_100113111 3300005336 Unclassified 2261
15 Ga0070682_100076920 3300005337 Bacteria 2149
16 Ga0070682_100333607 3300005337 Bacteria 1125
17 Ga0068868_100009008 3300005338 Bacteria 7164
18 Ga0068868_100551355 3300005338 Bacteria 1016
19 Ga0070660_101080936 3300005339 Bacteria 679
20 Ga0070691_10589762 3300005341 Bacteria 654
21 Ga0070687_100067883 3300005343 Unclassified 1905
22 Ga0070661_100332518 3300005344 Bacteria 1189
23 Ga0070692_10040869 3300005345 Bacteria 2374
24 Ga0070668_100153230 3300005347 Bacteria 1866
25 Ga0070668_100356075 3300005347 Bacteria 1240
26 Ga0070669_100083160 3300005353 Bacteria 2387
27 Ga0070669_100836140 3300005353 Bacteria 784
28 Ga0070671_100114101 3300005355 Unclassified 2271
29 Ga0070671_100461063 3300005355 Bacteria 1091
30 Ga0070674_100082936 3300005356 Bacteria 2294
31 Ga0070659_100007213 3300005366 Bacteria 8066
32 Ga0070703_10036668 3300005406 Bacteria 1508
33 Ga0070709_10052497 3300005434 Bacteria 2562
34 Ga0070709_10570980 3300005434 Bacteria 868
35 Ga0070714_100188121 3300005435 Bacteria 1882
36 Ga0070714_100469615 3300005435 Bacteria 1197
37 Ga0070714_101348298 3300005435 Bacteria 696
38 Ga0070713_101881909 3300005436 Bacteria 580
39 Ga0070710_10201378 3300005437 Bacteria 1257
40 Ga0070701_10097938 3300005438 Bacteria 1619
41 Ga0070701_10145551 3300005438 Bacteria 1359
42 Ga0070711_100025093 3300005439 Bacteria 3896
43 Ga0070711_100054238 3300005439 Bacteria 2766
44 Ga0070711_100096797 3300005439 Bacteria 2139
45 Ga0070711_100123091 3300005439 Bacteria 1921
46 Ga0070711_100177481 3300005439 Bacteria 1628
47 Ga0070705_100054352 3300005440 Bacteria 2348
48 Ga0070705_100077645 3300005440 Bacteria 2029
49 Ga0070705_100623059 3300005440 Unclassified 838
50 Ga0070700_100002630 3300005441 Bacteria 9189
51 Ga0070694_100019045 3300005444 Bacteria 4362
52 Ga0070678_100163960 3300005456 Bacteria 1803
53 Ga0070662_100138023 3300005457 Unclassified 1887
54 Ga0070662_100157734 3300005457 Bacteria 1773
55 Ga0070681_10044718 3300005458 Bacteria 4433
56 Ga0070681_10622613 3300005458 Bacteria 994
57 Ga0068867_100279312 3300005459 Unclassified 1369
58 Ga0068867_100360708 3300005459 Unclassified 1215
59 Ga0070706_100027202 3300005467 Bacteria 5263
60 Ga0070707_100006137 3300005468 Bacteria 11197
61 Ga0070699_100313869 3300005518 Bacteria 1408
62 Ga0070679_100310511 3300005530 Unclassified 1527
63 Ga0070679_100550149 3300005530 Unclassified 1098
64 Ga0070679_100593606 3300005530 Bacteria 1051
65 Ga0070684_100010540 3300005535 Bacteria 7327
66 Ga0070684_100327012 3300005535 Bacteria 1409
67 Ga0068853_100034131 3300005539 Bacteria 4317
68 Ga0068853_100986625 3300005539 Bacteria 811
69 Ga0070672_100136726 3300005543 Bacteria 2019
70 Ga0070686_100499666 3300005544 Bacteria 943
71 Ga0070695_100015936 3300005545 Bacteria 4543
72 Ga0070696_100011253 3300005546 Bacteria 5991
73 Ga0070696_100167448 3300005546 Bacteria 1622
74 Ga0070693_100011130 3300005547 Bacteria 4528
75 Ga0070693_100073013 3300005547 Bacteria 2026
76 Ga0070704_100126441 3300005549 Bacteria 1973
77 Ga0068855_100025529 3300005563 Bacteria 7068
78 Ga0068855_100069759 3300005563 Bacteria 4090
79 Ga0068857_100016618 3300005577 Bacteria 6446
80 Ga0068854_100135063 3300005578 Bacteria 1888
81 Ga0068856_100208836 3300005614 Bacteria 1967
82 Ga0070702_100086765 3300005615 Bacteria 1888
83 Ga0070702_100413326 3300005615 Bacteria 969
84 Ga0070702_101073873 3300005615 Bacteria 642
85 Ga0068852_100032190 3300005616 Bacteria 4339
86 Ga0068852_100892855 3300005616 Unclassified 906
87 Ga0068866_10135772 3300005718 Bacteria 1405
88 Ga0068866_10136663 3300005718 Unclassified 1402
89 Ga0068861_100106325 3300005719 Unclassified 2241
90 Ga0068861_100129325 3300005719 Bacteria 2048
91 Ga0068870_10145672 3300005840 Bacteria 1390
92 Ga0068870_10713778 3300005840 Unclassified 693
93 Ga0068863_101741834 3300005841 Bacteria 633
94 Ga0068858_100487691 3300005842 Bacteria 1190
95 Ga0068860_100693579 3300005843 Unclassified 1028
96 Ga0068862_100051215 3300005844 Bacteria 3531
97 Ga0068862_100170042 3300005844 Bacteria 1951
98 Ga0068862_100567084 3300005844 Unclassified 1086
99 Ga0081455_10048998 3300005937 Bacteria 3645
100 Ga0081455_10215416 3300005937 Unclassified 1428
101 Ga0081538_10000254 3300005981 Bacteria 60558
102 Ga0081538_10000257 3300005981 Bacteria 60184
103 Ga0081538_10025620 3300005981 Bacteria 4151
104 Ga0081538_10042658 3300005981 Bacteria 2859
105 Ga0081538_10066866 3300005981 Bacteria 2011
106 Ga0081538_10095979 3300005981 Unclassified 1512
107 Ga0081538_10138128 3300005981 Bacteria 1130
108 Ga0070717_10010646 3300006028 Bacteria 6951
109 Ga0075432_10064451 3300006058 Unclassified 1308
110 Ga0070716_100051318 3300006173 Bacteria 2344
111 Ga0070712_100031999 3300006175 Bacteria 3549
112 Ga0070712_100121332 3300006175 Bacteria 1967
113 Ga0070712_100479856 3300006175 Bacteria 1039
114 Ga0070712_100786684 3300006175 Bacteria 816
115 Ga0070712_101276427 3300006175 Unclassified 640
116 Ga0070712_101406588 3300006175 Bacteria 609
117 Ga0097621_100057119 3300006237 Bacteria 3190
118 Ga0097621_100469599 3300006237 Bacteria 1136
119 Ga0068871_100088549 3300006358 Bacteria 2576
120 Ga0068871_100117569 3300006358 Bacteria 2242
121 Ga0075428_100061014 3300006844 Bacteria 4129
122 Ga0075428_100524010 3300006844 Bacteria 1267
123 Ga0075431_100078669 3300006847 Bacteria 3404
124 Ga0075431_100716036 3300006847 Unclassified 978
125 Ga0075433_10080883 3300006852 Bacteria 2864
126 Ga0075433_10527457 3300006852 Bacteria 1039
127 Ga0075434_100018923 3300006871 Bacteria 6657
128 Ga0075434_100426888 3300006871 Unclassified 1347
129 Ga0075434_100507406 3300006871 Bacteria 1227
130 Ga0075434_100690386 3300006871 Bacteria 1038
131 Ga0068865_100304298 3300006881 Bacteria 1277
132 Ga0068865_100336539 3300006881 Bacteria 1219
133 Ga0075436_100079455 3300006914 Bacteria 2272
134 Ga0075435_100019699 3300007076 Bacteria 5158
135 Ga0075435_100030111 3300007076 Bacteria 4265
136 Ga0075435_100277120 3300007076 Bacteria 1431
137 Ga0075435_101149928 3300007076 Unclassified 679
138 Ga0105240_10019802 3300009093 Bacteria 8987
139 Ga0105240_10668906 3300009093 Unclassified 1136
140 Ga0111539_10059354 3300009094 Bacteria 4536
141 Ga0105245_10101699 3300009098 Bacteria 2661
142 Ga0105245_10399048 3300009098 Bacteria 1374
143 Ga0114129_10086374 3300009147 Bacteria 4351
144 Ga0114129_10219800 3300009147 Bacteria 2563
145 Ga0114129_13267857 3300009147 Bacteria 525
146 Ga0105243_10030467 3300009148 Bacteria 4154
147 Ga0105243_10034832 3300009148 Bacteria 3901
148 Ga0105242_10142313 3300009176 Bacteria 2083
149 Ga0105242_10191319 3300009176 Bacteria 1812
150 Ga0105242_10216219 3300009176 Bacteria 1710
151 Ga0105248_10856491 3300009177 Bacteria 1026
152 Ga0105237_10055458 3300009545 Bacteria 3969
153 Ga0105238_11990466 3300009551 Bacteria 614
154 Ga0105238_12534613 3300009551 Unclassified 549
155 Ga0105249_10040716 3300009553 Bacteria 4221
156 Ga0105239_13228551 3300010375 Bacteria 531
157 Ga0157336_1009348 3300012477 Bacteria 728
158 Ga0157320_1004586 3300012481 Bacteria 888
159 Ga0157337_1017512 3300012483 Bacteria 631
160 Ga0157335_1041968 3300012492 Bacteria 519
161 Ga0157314_1000910 3300012500 Bacteria 2410
162 Ga0157342_1027066 3300012507 Unclassified 701
163 Ga0157326_1023037 3300012513 Bacteria 781
164 Ga0157326_1065825 3300012513 Bacteria 564
165 Ga0157371_10037467 3300013102 Bacteria 3470
166 Ga0157371_10129981 3300013102 Bacteria 1792
167 Ga0157370_10011840 3300013104 Bacteria 9099
168 Ga0157369_10173067 3300013105 Unclassified 2274
169 Ga0157374_10036562 3300013296 Bacteria 4499
170 Ga0157378_10162654 3300013297 Bacteria 2088
171 Ga0157378_10380143 3300013297 Bacteria 1387
172 Ga0163162_10354924 3300013306 Bacteria 1599
173 Ga0163162_13029945 3300013306 Bacteria 540
174 Ga0157375_10465177 3300013308 Bacteria 1430
175 Ga0157380_10061034 3300014326 Bacteria 3015
176 Ga0157380_10251182 3300014326 Unclassified 1601
177 Ga0157380_11914082 3300014326 Unclassified 654
178 Ga0157380_11963370 3300014326 Bacteria 646
179 Ga0182008_10186283 3300014497 Bacteria 1052
180 Ga0182008_10351971 3300014497 Bacteria 781
181 Ga0157379_11646370 3300014968 Bacteria 627
182 Ga0157376_10201846 3300014969 Bacteria 1830
183 Ga0157376_10297917 3300014969 Bacteria 1525
184 Ga0182007_10065056 3300015262 Bacteria 1195
185 Ga0197907_10382467 3300020069 Bacteria 2267
186 Ga0206356_10336229 3300020070 Bacteria 3109
187 Ga0206350_10080231 3300020080 Bacteria 766
188 Ga0206354_10879588 3300020081 Bacteria 1661
189 Ga0206353_11486596 3300020082 Bacteria 4674
190 Ga0154015_1571547 3300020610 Unclassified 853
191 Ga0224712_10026373 3300022467 Bacteria 2053
192 Ga0207653_10078187 3300025885 Bacteria 1141
193 Ga0207682_10194664 3300025893 Bacteria 930
194 Ga0207692_10012575 3300025898 Bacteria 3638
195 Ga0207642_10045802 3300025899 Bacteria 1944
196 Ga0207647_10665150 3300025904 Bacteria 570
197 Ga0207699_10101417 3300025906 Bacteria 1827
198 Ga0207699_10158295 3300025906 Bacteria 1505
199 Ga0207643_10466373 3300025908 Bacteria 805
200 Ga0207705_10197321 3300025909 Bacteria 1524
201 Ga0207684_10040830 3300025910 Bacteria 3934
202 Ga0207707_10160298 3300025912 Bacteria 1967
203 Ga0207695_10049879 3300025913 Bacteria 4407
204 Ga0207693_10004391 3300025915 Bacteria 11922
205 Ga0207693_10567021 3300025915 Bacteria 885
206 Ga0207663_10006641 3300025916 Bacteria 5944
207 Ga0207663_10074937 3300025916 Bacteria 2194
208 Ga0207663_10173886 3300025916 Bacteria 1532
209 Ga0207660_10099260 3300025917 Unclassified 2172
210 Ga0207660_10641795 3300025917 Bacteria 865
211 Ga0207662_10032091 3300025918 Bacteria 3055
212 Ga0207657_10027552 3300025919 Bacteria 5203
213 Ga0207652_10020845 3300025921 Bacteria 5403
214 Ga0207652_10434037 3300025921 Bacteria 1184
215 Ga0207646_10004153 3300025922 Bacteria 15887
216 Ga0207681_10197490 3300025923 Bacteria 1543
217 Ga0207681_10835260 3300025923 Bacteria 770
218 Ga0207687_10580697 3300025927 Bacteria 943
219 Ga0207664_10026593 3300025929 Bacteria 4376
220 Ga0207664_10064226 3300025929 Bacteria 2935
221 Ga0207664_10422002 3300025929 Bacteria 1188
222 Ga0207644_10107339 3300025931 Bacteria 2106
223 Ga0207690_11072020 3300025932 Bacteria 671
224 Ga0207706_10039970 3300025933 Bacteria 4158
225 Ga0207686_10524060 3300025934 Bacteria 923
226 Ga0207686_10933621 3300025934 Unclassified 701
227 Ga0207709_10068255 3300025935 Bacteria 2247
228 Ga0207670_10633740 3300025936 Bacteria 880
229 Ga0207669_10185762 3300025937 Unclassified 1495
230 Ga0207669_10599129 3300025937 Bacteria 895
231 Ga0207669_11061439 3300025937 Bacteria 683
232 Ga0207704_10140495 3300025938 Bacteria 1688
233 Ga0207704_10546402 3300025938 Unclassified 941
234 Ga0207704_11035646 3300025938 Bacteria 695
235 Ga0207665_10001503 3300025939 Bacteria 15673
236 Ga0207661_10014990 3300025944 Bacteria 5691
237 Ga0207661_11104606 3300025944 Bacteria 730
238 Ga0207679_10022538 3300025945 Bacteria 4291
239 Ga0207679_10158049 3300025945 Bacteria 1853
240 Ga0207667_10017450 3300025949 Bacteria 8076
241 Ga0207667_10230396 3300025949 Bacteria 1897
242 Ga0207651_10584372 3300025960 Bacteria 975
243 Ga0207712_10132747 3300025961 Bacteria 1900
244 Ga0207668_10871353 3300025972 Bacteria 800
245 Ga0207640_10301195 3300025981 Bacteria 1268
246 Ga0207639_10097463 3300026041 Bacteria 2368
247 Ga0207678_10047491 3300026067 Bacteria 3712
248 Ga0207678_10486648 3300026067 Bacteria 1075
249 Ga0207708_10013577 3300026075 Bacteria 6089
250 Ga0207641_10148602 3300026088 Bacteria 2121
251 Ga0207648_10014493 3300026089 Bacteria 7281
252 Ga0207648_10164592 3300026089 Bacteria 1960
253 Ga0207674_10010127 3300026116 Bacteria 10718
254 Ga0207675_100002622 3300026118 Bacteria 17797
255 Ga0207675_100030921 3300026118 Bacteria 4987
256 Ga0207683_10006806 3300026121 Bacteria 9790
257 Ga0207698_10049558 3300026142 Bacteria 3197
258 Ga0207698_10195467 3300026142 Bacteria 1806
259 Ga0207428_10036485 3300027907 Bacteria 4009
260 Ga0207428_10037754 3300027907 Bacteria 3929
261 Ga0268266_10467526 3300028379 Bacteria 1201
262 Ga0268265_10109207 3300028380 Bacteria 2254
263 Ga0265337_1042971 3300028556 Bacteria 1294
264 Ga0265319_1027997 3300028563 Bacteria 1992
265 Ga0265334_10074414 3300028573 Bacteria 1260
266 Ga0265336_10002098 3300028666 Bacteria 8473
267 Ga0265338_10001136 3300028800 Bacteria 44077
268 Ga0265338_10025465 3300028800 Bacteria 6001
269 Ga0265338_10047519 3300028800 Bacteria 3918
270 Ga0265324_10021030 3300029957 Bacteria 2341
271 Ga0265313_10015273 3300031595 Bacteria 4484
272 Ga0307416_100453182 3300032002 Bacteria 1336
273 Ga0307415_100212746 3300032126 Bacteria 1544
274 Ga0307415_100505679 3300032126 Unclassified 1057
275 Ga0373948_0016732 3300034817 Bacteria 1359
276 Ga0373958_0023541 3300034819 Bacteria 1159
277 Ga0373959_0193371 3300034820 Bacteria 534
278 Ga0373938_0092639 3300034957 Bacteria 750
279 Ga0373940_0026545 3300035088 Bacteria 1516
280 Ga0373949_0008047 3300035090 Bacteria 2310
281 Ga0373951_0008617 3300035091 Bacteria 2299
282 Ga0373932_0024122 3300035112 Bacteria 1634
283 Ga0373939_0056643 3300035114 Bacteria 1234
284 Ga0373941_0060289 3300035115 Unclassified 1233
285 Ga0373941_0066196 3300035115 Bacteria 1188
286 Ga0373960_0002727 3300035121 Bacteria 3994
287 Ga0373960_0400234 3300035121 Bacteria 530
288 Ga0373943_0091553 3300035170 Unclassified 1576
289 Ga0373943_0096557 3300035170 Unclassified 1539
290 Ga0373942_0023022 3300035207 Bacteria 1587
291 Ga0373942_0112159 3300035207 Unclassified 844
292 Ga0373962_0084958 3300035242 Bacteria 966
293 Ga0373931_0052283 3300035691 Bacteria 2178
294 Ga0373935_0073915 3300035692 Bacteria 2203
295 Ga0373935_0209172 3300035692 Bacteria 1351
296 Ga0373935_0750695 3300035692 Unclassified 719
297 Ga0373947_0208722 3300035725 Unclassified 1280
298 Ga0373925_0780243 3300037068 Bacteria 788
299 Ga0395899_0000944 3300037312 Bacteria 27256
300 Ga0395899_0006700 3300037312 Bacteria 8924
301 Ga0395899_0013000 3300037312 Bacteria 6369
302 Ga0395899_0212353 3300037312 Bacteria 1344
303 Ga0395899_0857902 3300037312 Bacteria 557
304 Ga0395900_0016836 3300037418 Bacteria 7459
305 Ga0395900_0082051 3300037418 Bacteria 3312
306 Ga0395900_0120626 3300037418 Bacteria 2690
307 Ga0395900_0259905 3300037418 Bacteria 1734
308 Ga0395900_0359983 3300037418 Bacteria 1426
309 Ga0395900_0427637 3300037418 Bacteria 1284
310 Ga0395900_0678304 3300037418 Bacteria 965
311 Ga0395898_0046692 3300037466 Bacteria 4253
312 Ga0395898_0052432 3300037466 Bacteria 3985
313 Ga0395898_0096427 3300037466 Unclassified 2841
314 Ga0395898_0186056 3300037466 Bacteria 1984
315 Ga0395898_0296828 3300037466 Unclassified 1541
316 Ga0395898_0297450 3300037466 Bacteria 1540
317 Ga0395898_0462074 3300037466 Bacteria 1208
318 Ga0395905_0003892 3300037471 Bacteria 15751
319 Ga0395905_0010609 3300037471 Bacteria 8943
320 Ga0395905_0017624 3300037471 Bacteria 6778
321 Ga0395905_0178130 3300037471 Unclassified 1996
322 Ga0395901_0013945 3300038443 Bacteria 8180
323 Ga0395901_0060402 3300038443 Bacteria 3944
324 Ga0395901_0116636 3300038443 Bacteria 2805
325 Ga0395901_0148016 3300038443 Bacteria 2467
326 Ga0395901_0162739 3300038443 Unclassified 2343
327 Ga0436363_0449192 3300039450 Bacteria 1411
328 Ga0436363_0632109 3300039450 Bacteria 637
329 Ga0451789_0002071 3300041443 Bacteria 1000
330 Ga0451789_1200083 3300041443 Unclassified 559
331 Ga0451793_0421659 3300041452 Unclassified 842
332 Ga0451797_1221365 3300041453 Bacteria 1015
333 Ga0451802_0043835 3300041460 Bacteria 821
334 Ga0451839_0552830 3300041496 Bacteria 3016
335 Ga0451845_0693541 3300041501 Bacteria 1898
336 Ga0451847_0404900 3300041503 Bacteria 2701
337 Ga0451849_1219108 3300041505 Bacteria 2660
338 Ga0451855_1324159 3300041511 Bacteria 2643
339 Ga0451853_1015021 3300041512 Unclassified 1328
340 Ga0451853_1969688 3300041512 Unclassified 1174
341 Ga0439448_0022260 3300042005 Bacteria 1969
342 Ga0439454_055619 3300042011 Bacteria 677
343 Ga0439459_0042768 3300042438 Bacteria 969
344 Ga0466963_0107087 3300044694 Bacteria 1917
345 Ga0466959_0240063 3300045049 Bacteria 1252
346 Ga0451576_1356936 3300045051 Archaea 740
347 Ga0466958_0661822 3300045836 Bacteria 680
348 Ga0466967_0118881 3300045976 Bacteria 2438
349 Ga0466967_0284919 3300045976 Bacteria 1586
350 Ga0466967_1390979 3300045976 Bacteria 699
351 Ga0495627_133018 3300046453 Unclassified 699
352 Ga0495627_133388 3300046453 Unclassified 698
353 Ga0495592_0871963 3300046454 Bacteria 531
354 Ga0495603_0020368 3300046455 Bacteria 4020
355 Ga0495603_0034882 3300046455 Bacteria 3024
356 Ga0495641_0018702 3300046461 Bacteria 3568
357 Ga0495641_0068798 3300046461 Bacteria 1592
358 Ga0495653_0264568 3300046463 Unclassified 1135
359 Ga0495582_0014279 3300046473 Bacteria 4369
360 Ga0495582_0047912 3300046473 Bacteria 2354
361 Ga0495605_0013784 3300046474 Bacteria 4443
362 Ga0495639_0224044 3300046475 Unclassified 925
363 Ga0495584_0032136 3300046491 Bacteria 2657
364 Ga0495584_0510732 3300046491 Bacteria 612
365 Ga0495585_0133831 3300046492 Bacteria 1303
366 Ga0495596_0039423 3300046500 Bacteria 1866
367 Ga0495596_0119704 3300046500 Unclassified 1022
368 Ga0495607_0020903 3300046501 Bacteria 4126
369 Ga0495608_0913216 3300046511 Unclassified 513
370 Ga0495616_0040392 3300046513 Bacteria 2384
371 Ga0495628_0253856 3300046516 Bacteria 1312
372 Ga0495628_0981259 3300046516 Unclassified 582
373 Ga0495630_0164566 3300046517 Bacteria 1689
374 Ga0495630_0253929 3300046517 Bacteria 1343
375 Ga0495637_0116816 3300046520 Bacteria 1030
376 Ga0495637_0163109 3300046520 Bacteria 835
377 Ga0495637_0167924 3300046520 Bacteria 820
378 Ga0495644_0008552 3300046523 Bacteria 3941
379 Ga0495663_0022630 3300046525 Unclassified 1817
380 Ga0495663_0068115 3300046525 Bacteria 1130
381 Ga0495642_0355569 3300046528 Unclassified 644
382 Ga0495652_0307850 3300046529 Bacteria 1149
383 Ga0495586_0501089 3300046535 Bacteria 701
384 Ga0495609_0033783 3300046538 Unclassified 2321
385 Ga0495609_0140481 3300046538 Unclassified 1031
386 Ga0495597_0279296 3300046542 Unclassified 651
387 Ga0495667_0007852 3300046559 Bacteria 7232
388 Ga0495656_0024422 3300046615 Bacteria 2387
389 Ga0495656_0056934 3300046615 Bacteria 1691
390 Ga0495656_0088440 3300046615 Unclassified 1412
391 Ga0495656_0582589 3300046615 Bacteria 598
392 Ga0495668_0206036 3300046616 Bacteria 1077
393 Ga0495611_0043327 3300046648 Bacteria 2012
394 Ga0495611_0403482 3300046648 Bacteria 625
395 Ga0495635_0021837 3300046663 Bacteria 4461
396 Ga0495635_0524535 3300046663 Bacteria 778
397 Ga0495659_0115718 3300046664 Bacteria 1051
398 Ga0495659_0160866 3300046664 Unclassified 906
399 Ga0495659_0290187 3300046664 Bacteria 689
400 Ga0495661_0289746 3300046665 Bacteria 823
401 Ga0495657_0136579 3300046675 Unclassified 1531
402 Ga0495658_0080024 3300046683 Unclassified 1916
403 Ga0495658_0570282 3300046683 Unclassified 725
404 Ga0495669_0080515 3300046684 Bacteria 1494
405 Ga0495613_0192424 3300046689 Bacteria 1441
406 Ga0495613_0747263 3300046689 Unclassified 641
407 Ga0495670_0052036 3300046691 Bacteria 2050
408 Ga0495670_0203517 3300046691 Unclassified 1049
409 Ga0495671_0088223 3300046692 Bacteria 1519
410 Ga0495589_0035387 3300046794 Bacteria 2504
411 Ga0495589_0130603 3300046794 Unclassified 1206
412 Ga0495581_0458284 3300047315 Bacteria 742
413 Ga0495604_0454878 3300047317 Bacteria 836
414 Ga0495636_0117291 3300047318 Unclassified 1175
415 Ga0495674_0488839 3300047319 Bacteria 986
416 Ga0495676_0047332 3300047321 Bacteria 3478
417 Ga0495676_0079082 3300047321 Bacteria 2501
418 Ga0495676_0127620 3300047321 Bacteria 1841
419 Ga0495676_0256870 3300047321 Unclassified 1190
420 Ga0495680_0238193 3300047322 Unclassified 1293
421 Ga0495677_0171971 3300047445 Bacteria 838
422 Ga0495684_0016876 3300047471 Bacteria 5625
423 Ga0495684_0270691 3300047471 Bacteria 1229
424 Ga0495593_0294424 3300047673 Bacteria 811
425 Ga0495626_0167361 3300048091 Unclassified 918
426 Ga0496100_0218442 3300048903 Bacteria 1398
427 Ga0496100_0429056 3300048903 Bacteria 1010
428 Ga0496100_1343316 3300048903 Bacteria 564
429 Ga0496101_0031081 3300048904 Bacteria 3750
430 Ga0496101_0274878 3300048904 Bacteria 1315
431 Ga0496101_0752611 3300048904 Bacteria 769
432 Ga0496102_0012058 3300048905 Bacteria 7468
433 Ga0496102_0058090 3300048905 Bacteria 3534
434 Ga0496102_0357675 3300048905 Bacteria 1374
435 Ga0496102_1184996 3300048905 Unclassified 683
436 Ga0496103_0001595 3300048906 Bacteria 14915
437 Ga0496103_0031664 3300048906 Bacteria 3224
438 Ga0496103_0337147 3300048906 Bacteria 970
439 Ga0496104_0004374 3300048907 Bacteria 12304
440 Ga0496104_0300417 3300048907 Bacteria 1517
441 Ga0496104_1040018 3300048907 Unclassified 723
442 Ga0496105_0007168 3300048908 Bacteria 8604
443 Ga0496106_0051472 3300048909 Bacteria 3105
444 Ga0496106_0872924 3300048909 Bacteria 711
445 Ga0496107_0473747 3300048910 Bacteria 929
446 Ga0496109_0027044 3300048912 Bacteria 5119
447 Ga0496109_0057223 3300048912 Bacteria 3559
448 Ga0496109_0066999 3300048912 Bacteria 3288
449 Ga0496109_0092278 3300048912 Bacteria 2801
450 Ga0496110_0105137 3300048913 Bacteria 2533
451 Ga0496110_0933452 3300048913 Unclassified 774
452 Ga0496110_1197604 3300048913 Bacteria 668
453 Ga0496111_0075878 3300048914 Bacteria 2450
454 Ga0496112_0018556 3300048915 Bacteria 6553
455 Ga0496112_0074573 3300048915 Bacteria 3355
456 Ga0496113_0120816 3300048916 Bacteria 2048
457 Ga0496113_0130716 3300048916 Bacteria 1970
458 Ga0496114_0004740 3300048917 Bacteria 10586
459 Ga0496114_0220837 3300048917 Bacteria 1663
460 Ga0496114_0705064 3300048917 Bacteria 885
461 Ga0496114_0938086 3300048917 Bacteria 747
462 Ga0496115_0006287 3300048918 Bacteria 8692
463 Ga0496115_0024105 3300048918 Bacteria 4727
464 Ga0496115_0036368 3300048918 Bacteria 3898
465 Ga0496115_0185816 3300048918 Bacteria 1717
466 Ga0501031_0003148 3300049568 Bacteria 10581
467 Ga0501031_0005385 3300049568 Bacteria 8329
468 Ga0501031_0077970 3300049568 Bacteria 2158
469 Ga0501031_0325447 3300049568 Bacteria 996
470 Ga0501031_0355236 3300049568 Bacteria 948
471 Ga0501032_0002823 3300049569 Bacteria 13515
472 Ga0501032_0006387 3300049569 Bacteria 8681
473 Ga0501032_0752968 3300049569 Bacteria 616
474 Ga0501033_0000721 3300049570 Bacteria 30336
475 Ga0501033_0102782 3300049570 Bacteria 2084
476 Ga0501033_0604353 3300049570 Bacteria 752
477 Ga0501034_0059333 3300049571 Bacteria 3843
478 Ga0501034_0880447 3300049571 Unclassified 784
479 Ga0501036_0002509 3300049572 Bacteria 14404
480 Ga0501036_0004931 3300049572 Bacteria 10786
481 Ga0501036_0010015 3300049572 Bacteria 7809
482 Ga0501036_0127772 3300049572 Bacteria 2146
483 Ga0501036_0176219 3300049572 Bacteria 1800
484 Ga0501036_0416564 3300049572 Bacteria 1120
485 Ga0501036_1122363 3300049572 Bacteria 642
486 Ga0501037_0001806 3300049573 Bacteria 15540
487 Ga0501037_0635482 3300049573 Unclassified 714
488 Ga0501038_0000667 3300049574 Bacteria 30546
489 Ga0501038_0020348 3300049574 Bacteria 5966
490 Ga0501038_0066803 3300049574 Bacteria 3061
491 Ga0501039_0000132 3300049575 Bacteria 51966
492 Ga0501039_0008485 3300049575 Bacteria 7833
493 Ga0501039_0027908 3300049575 Bacteria 4341
494 Ga0501039_0032722 3300049575 Bacteria 4009
495 Ga0501039_0444076 3300049575 Bacteria 1019
496 Ga0501039_0582748 3300049575 Bacteria 877
497 Ga0501040_0000039 3300049576 Bacteria 59106
498 Ga0501040_0004888 3300049576 Bacteria 8669
499 Ga0501040_0006738 3300049576 Bacteria 7451
500 Ga0501040_0035028 3300049576 Bacteria 3402
501 Ga0501040_0214018 3300049576 Bacteria 1370
502 Ga0501040_0408535 3300049576 Bacteria 975
503 Ga0501041_0000117 3300049577 Bacteria 33648
504 Ga0501041_0041578 3300049577 Bacteria 2792
505 Ga0501041_0232983 3300049577 Bacteria 1156
506 Ga0501041_0870928 3300049577 Unclassified 578
507 Ga0501042_0002833 3300049578 Bacteria 10747
508 Ga0501042_0023978 3300049578 Bacteria 4275
509 Ga0501042_0026202 3300049578 Bacteria 4097
510 Ga0501042_0108806 3300049578 Bacteria 1995
511 Ga0501042_0212904 3300049578 Bacteria 1394
512 Ga0501042_0251023 3300049578 Bacteria 1276
513 Ga0501043_0016248 3300049579 Bacteria 5837
514 Ga0501043_0035206 3300049579 Bacteria 3938
515 Ga0501043_0062314 3300049579 Bacteria 2928
516 Ga0501046_0005152 3300049580 Bacteria 11714
517 Ga0501046_0019727 3300049580 Bacteria 5588
518 Ga0501046_0029430 3300049580 Bacteria 4464
519 Ga0501046_0305740 3300049580 Bacteria 1160
520 Ga0501047_0007842 3300049581 Bacteria 10059
521 Ga0501047_0015137 3300049581 Bacteria 7344
522 Ga0501048_0003142 3300049582 Bacteria 12607
523 Ga0501048_0009637 3300049582 Bacteria 7247
524 Ga0501048_0014012 3300049582 Bacteria 5944
525 Ga0501048_0135191 3300049582 Bacteria 1742
526 Ga0501048_0249973 3300049582 Bacteria 1258
527 Ga0501067_0034642 3300049583 Bacteria 2802
528 Ga0501068_0006375 3300049584 Bacteria 6499
529 Ga0501068_0096202 3300049584 Bacteria 1831
530 Ga0501069_0027301 3300049585 Bacteria 3128
531 Ga0501070_0009512 3300049586 Bacteria 8215
532 Ga0501070_0090092 3300049586 Bacteria 2538
533 Ga0501070_0146670 3300049586 Bacteria 1948
534 Ga0501071_0000001 3300049587 Bacteria 123952
535 Ga0501071_0003905 3300049587 Bacteria 9392
536 Ga0501071_0076064 3300049587 Bacteria 2451
537 Ga0501071_0154926 3300049587 Bacteria 1710
538 Ga0501071_0250974 3300049587 Bacteria 1335
539 Ga0501071_0612129 3300049587 Bacteria 837
540 Ga0501072_0002417 3300049588 Bacteria 13980
541 Ga0501072_0008626 3300049588 Bacteria 7735
542 Ga0501072_0013572 3300049588 Bacteria 6234
543 Ga0501072_0017499 3300049588 Bacteria 5509
544 Ga0501072_0494073 3300049588 Bacteria 968
545 Ga0501072_0687648 3300049588 Bacteria 804
546 Ga0501073_0005116 3300049589 Bacteria 9837
547 Ga0501073_0010541 3300049589 Bacteria 6768
548 Ga0501073_0812726 3300049589 Bacteria 644
549 Ga0501074_0000686 3300049590 Bacteria 21149
550 Ga0501074_0010794 3300049590 Bacteria 6632
551 Ga0501074_0058363 3300049590 Bacteria 2780
552 Ga0501075_0000075 3300049591 Bacteria 44277
553 Ga0501075_0000731 3300049591 Bacteria 20383
554 Ga0501075_0059909 3300049591 Unclassified 2868
555 Ga0501075_0095559 3300049591 Bacteria 2255
556 Ga0501075_0123414 3300049591 Bacteria 1971
557 Ga0501076_0004850 3300049592 Bacteria 9605
558 Ga0501076_0007952 3300049592 Bacteria 7736
559 Ga0501076_0008697 3300049592 Bacteria 7456
560 Ga0501076_0010861 3300049592 Bacteria 6772
561 Ga0501076_0102579 3300049592 Bacteria 2306
562 Ga0501076_0177678 3300049592 Unclassified 1735
563 Ga0501077_0000190 3300049593 Bacteria 35334
564 Ga0501077_0001162 3300049593 Bacteria 15904
565 Ga0501077_0015738 3300049593 Bacteria 4763
566 Ga0501077_0046855 3300049593 Bacteria 2746
567 Ga0501077_0062421 3300049593 Unclassified 2364
568 Ga0501077_0240191 3300049593 Bacteria 1151
569 Ga0501077_0478510 3300049593 Bacteria 798
570 Ga0501079_0007569 3300049741 Bacteria 8223
571 Ga0501079_0007602 3300049741 Bacteria 8210
572 Ga0501079_0008465 3300049741 Bacteria 7797
573 Ga0501079_0021720 3300049741 Bacteria 4912
574 Ga0501079_0031007 3300049741 Bacteria 4108
575 Ga0501079_0738550 3300049741 Bacteria 775
576 Ga0501080_0018872 3300049742 Bacteria 6386
577 Ga0501080_0042652 3300049742 Bacteria 4223
578 Ga0501080_0054595 3300049742 Bacteria 3720
579 Ga0501080_0201689 3300049742 Bacteria 1826
580 Ga0501081_0002601 3300049743 Bacteria 11411
581 Ga0501081_0011694 3300049743 Bacteria 5745
582 Ga0501081_0012683 3300049743 Bacteria 5541
583 Ga0501081_0089859 3300049743 Bacteria 2158
584 Ga0501081_0191645 3300049743 Unclassified 1480
585 Ga0501081_0205708 3300049743 Unclassified 1428
586 Ga0501083_0012992 3300049744 Bacteria 5818
587 Ga0501083_0023686 3300049744 Bacteria 4257
588 Ga0501083_0071870 3300049744 Unclassified 2300
589 Ga0501083_0480881 3300049744 Bacteria 808
590 Ga0501035_0003401 3300049822 Bacteria 15220
591 Ga0501035_0034663 3300049822 Bacteria 4584
592 Ga0501035_0084135 3300049822 Bacteria 2806
593 Ga0501035_0266658 3300049822 Unclassified 1450
594 Ga0501044_0010743 3300049823 Bacteria 9938
595 Ga0501044_0057217 3300049823 Bacteria 4001
596 Ga0501044_0661449 3300049823 Bacteria 933
597 Ga0501045_0008819 3300049824 Bacteria 7044
598 Ga0501045_0013895 3300049824 Bacteria 5695
599 Ga0501045_0014826 3300049824 Bacteria 5528
600 Ga0501045_0029051 3300049824 Bacteria 3993
601 Ga0501045_0141144 3300049824 Bacteria 1791
602 Ga0501045_0167423 3300049824 Bacteria 1637
603 nmdc:mga05p37_100716_c1 3300050507 Bacteria 3559
604 nmdc:mga05p37_84351_c1 3300050507 Bacteria 3914
605 nmdc:mga06r32_52397_c1 3300050510 Bacteria 3908
606 nmdc:mga08y16_120693_c1 3300050511 Bacteria 2728
607 nmdc:mga08y16_273476_c1 3300050511 Bacteria 1743
608 nmdc:mga0n895_1039394_c1 3300050512 Bacteria 799
609 nmdc:mga0n895_139989_c1 3300050512 Bacteria 2448
610 nmdc:mga0n895_367481_c1 3300050512 Bacteria 1456
611 nmdc:mga0n895_42863_c1 3300050512 Bacteria 4406
612 nmdc:mga0rr50_1896156_c1 3300050513 Unclassified 501
613 nmdc:mga0rr50_25628_c1 3300050513 Bacteria 4102
614 nmdc:mga0rr50_41295_c1 3300050513 Bacteria 3360
615 nmdc:mga08x19_5408_c1 3300050514 Bacteria 7553
616 nmdc:mga08x19_680787_c1 3300050514 Bacteria 730
617 nmdc:mga0a205_47342_c1 3300050515 Bacteria 4149
618 Ga0495601_0241248 3300053077 Unclassified 1180
619 Ga0495655_0023980 3300053083 Bacteria 1413
620 Ga0495655_0027056 3300053083 Unclassified 1357
621 Ga0495595_0022280 3300053084 Unclassified 2779
622 Ga0495619_0023326 3300053085 Bacteria 3966
623 Ga0495619_0696191 3300053085 Bacteria 691
624 Ga0501084_0000321 3300054114 Bacteria 36617
625 Ga0501084_0006616 3300054114 Bacteria 9530
626 Ga0501084_0016865 3300054114 Bacteria 6068
627 Ga0501084_0020774 3300054114 Bacteria 5476
628 Ga0501084_0077668 3300054114 Bacteria 2783
629 Ga0501084_0404730 3300054114 Bacteria 1153
630 Ga0501084_1565758 3300054114 Bacteria 551
631 Ga0587073_0188337 3300059492 Unclassified 610
632 Ga0587073_0244676 3300059492 Bacteria 560
633 Ga0587091_135188 3300059511 Bacteria 612
634 Ga0587092_058939 3300059512 Bacteria 714
635 Ga0587092_066360 3300059512 Bacteria 686
636 Ga0587098_069774 3300059604 Bacteria 567
637 Ga0587067_050359 3300059640 Unclassified 840
638 Ga0587075_087467 3300059644 Bacteria 604
639 Ga0501082_0000607 3300060353 Bacteria 31518
640 Ga0501082_0003020 3300060353 Bacteria 14701
641 Ga0501082_0045598 3300060353 Bacteria 3780
642 Ga0501082_0277950 3300060353 Bacteria 1457
643 Ga0501082_0921701 3300060353 Bacteria 764
644 Ga0466962_0007319 3300061719 Bacteria 5296
645 Ga0530510_0000134 3300061734 Bacteria 42994
646 Ga0530510_0001602 3300061734 Bacteria 15280
647 Ga0530510_0004708 3300061734 Bacteria 9440
648 Ga0530510_0014937 3300061734 Bacteria 5483
649 Ga0530510_0204442 3300061734 Bacteria 1467
650 Ga0439450_225075
651 ARcpr5oldR_c011098
652 ARCol0yngRDRAFT_1008390
653 JGI25407J50210_10000994
654 JGI25407J50210_10042930
655 JGI25407J50210_10063179
656 JGI25407J50210_10072244
657 Ga0070658_10001923
658 Ga0070683_100015394
659 Ga0070683_101283763
660 Ga0070690_101752447
661 Ga0070677_10067188
662 Ga0068869_101069334
663 Ga0070680_100113111
664 Ga0070682_100076920
665 Ga0070682_100333607
666 Ga0068868_100009008
667 Ga0068868_100551355
668 Ga0070660_101080936
669 Ga0070691_10589762
670 Ga0070687_100067883
671 Ga0070661_100332518
672 Ga0070692_10040869
673 Ga0070668_100153230
674 Ga0070668_100356075
675 Ga0070669_100083160
676 Ga0070669_100836140
677 Ga0070671_100114101
678 Ga0070671_100461063
679 Ga0070674_100082936
680 Ga0070659_100007213
681 Ga0070703_10036668
682 Ga0070709_10052497
683 Ga0070709_10570980
684 Ga0070714_100188121
685 Ga0070714_100469615
686 Ga0070714_101348298
687 Ga0070713_101881909
688 Ga0070710_10201378
689 Ga0070701_10097938
690 Ga0070701_10145551
691 Ga0070711_100025093
692 Ga0070711_100054238
693 Ga0070711_100096797
694 Ga0070711_100123091
695 Ga0070711_100177481
696 Ga0070705_100054352
697 Ga0070705_100077645
698 Ga0070705_100623059
699 Ga0070700_100002630
700 Ga0070694_100019045
701 Ga0070678_100163960
702 Ga0070662_100138023
703 Ga0070662_100157734
704 Ga0070681_10044718
705 Ga0070681_10622613
706 Ga0068867_100279312
707 Ga0068867_100360708
708 Ga0070706_100027202
709 Ga0070707_100006137
710 Ga0070699_100313869
711 Ga0070679_100310511
712 Ga0070679_100550149
713 Ga0070679_100593606
714 Ga0070684_100010540
715 Ga0070684_100327012
716 Ga0068853_100034131
717 Ga0068853_100986625
718 Ga0070672_100136726
719 Ga0070686_100499666
720 Ga0070695_100015936
721 Ga0070696_100011253
722 Ga0070696_100167448
723 Ga0070693_100011130
724 Ga0070693_100073013
725 Ga0070704_100126441
726 Ga0068855_100025529
727 Ga0068855_100069759
728 Ga0068857_100016618
729 Ga0068854_100135063
730 Ga0068856_100208836
731 Ga0070702_100086765
732 Ga0070702_100413326
733 Ga0070702_101073873
734 Ga0068852_100032190
735 Ga0068852_100892855
736 Ga0068866_10135772
737 Ga0068866_10136663
738 Ga0068861_100106325
739 Ga0068861_100129325
740 Ga0068870_10145672
741 Ga0068870_10713778
742 Ga0068863_101741834
743 Ga0068858_100487691
744 Ga0068860_100693579
745 Ga0068862_100051215
746 Ga0068862_100170042
747 Ga0068862_100567084
748 Ga0081455_10048998
749 Ga0081455_10215416
750 Ga0081538_10000254
751 Ga0081538_10000257
752 Ga0081538_10025620
753 Ga0081538_10042658
754 Ga0081538_10066866
755 Ga0081538_10095979
756 Ga0081538_10138128
757 Ga0070717_10010646
758 Ga0075432_10064451
759 Ga0070716_100051318
760 Ga0070712_100031999
761 Ga0070712_100121332
762 Ga0070712_100479856
763 Ga0070712_100786684
764 Ga0070712_101276427
765 Ga0070712_101406588
766 Ga0097621_100057119
767 Ga0097621_100469599
768 Ga0068871_100088549
769 Ga0068871_100117569
770 Ga0075428_100061014
771 Ga0075428_100524010
772 Ga0075431_100078669
773 Ga0075431_100716036
774 Ga0075433_10080883
775 Ga0075433_10527457
776 Ga0075434_100018923
777 Ga0075434_100426888
778 Ga0075434_100507406
779 Ga0075434_100690386
780 Ga0068865_100304298
781 Ga0068865_100336539
782 Ga0075436_100079455
783 Ga0075435_100019699
784 Ga0075435_100030111
785 Ga0075435_100277120
786 Ga0075435_101149928
787 Ga0105240_10019802
788 Ga0105240_10668906
789 Ga0111539_10059354
790 Ga0105245_10101699
791 Ga0105245_10399048
792 Ga0114129_10086374
793 Ga0114129_10219800
794 Ga0114129_13267857
795 Ga0105243_10030467
796 Ga0105243_10034832
797 Ga0105242_10142313
798 Ga0105242_10191319
799 Ga0105242_10216219
800 Ga0105248_10856491
801 Ga0105237_10055458
802 Ga0105238_11990466
803 Ga0105238_12534613
804 Ga0105249_10040716
805 Ga0105239_13228551
806 Ga0157336_1009348
807 Ga0157320_1004586
808 Ga0157337_1017512
809 Ga0157335_1041968
810 Ga0157314_1000910
811 Ga0157342_1027066
812 Ga0157326_1023037
813 Ga0157326_1065825
814 Ga0157371_10037467
815 Ga0157371_10129981
816 Ga0157370_10011840
817 Ga0157369_10173067
818 Ga0157374_10036562
819 Ga0157378_10162654
820 Ga0157378_10380143
821 Ga0163162_10354924
822 Ga0163162_13029945
823 Ga0157375_10465177
824 Ga0157380_10061034
825 Ga0157380_10251182
826 Ga0157380_11914082
827 Ga0157380_11963370
828 Ga0182008_10186283
829 Ga0182008_10351971
830 Ga0157379_11646370
831 Ga0157376_10201846
832 Ga0157376_10297917
833 Ga0182007_10065056
834 Ga0197907_10382467
835 Ga0206356_10336229
836 Ga0206350_10080231
837 Ga0206354_10879588
838 Ga0206353_11486596
839 Ga0154015_1571547
840 Ga0224712_10026373
841 Ga0207653_10078187
842 Ga0207682_10194664
843 Ga0207692_10012575
844 Ga0207642_10045802
845 Ga0207647_10665150
846 Ga0207699_10101417
847 Ga0207699_10158295
848 Ga0207643_10466373
849 Ga0207705_10197321
850 Ga0207684_10040830
851 Ga0207707_10160298
852 Ga0207695_10049879
853 Ga0207693_10004391
854 Ga0207693_10567021
855 Ga0207663_10006641
856 Ga0207663_10074937
857 Ga0207663_10173886
858 Ga0207660_10099260
859 Ga0207660_10641795
860 Ga0207662_10032091
861 Ga0207657_10027552
862 Ga0207652_10020845
863 Ga0207652_10434037
864 Ga0207646_10004153
865 Ga0207681_10197490
866 Ga0207681_10835260
867 Ga0207687_10580697
868 Ga0207664_10026593
869 Ga0207664_10064226
870 Ga0207664_10422002
871 Ga0207644_10107339
872 Ga0207690_11072020
873 Ga0207706_10039970
874 Ga0207686_10524060
875 Ga0207686_10933621
876 Ga0207709_10068255
877 Ga0207670_10633740
878 Ga0207669_10185762
879 Ga0207669_10599129
880 Ga0207669_11061439
881 Ga0207704_10140495
882 Ga0207704_10546402
883 Ga0207704_11035646
884 Ga0207665_10001503
885 Ga0207661_10014990
886 Ga0207661_11104606
887 Ga0207679_10022538
888 Ga0207679_10158049
889 Ga0207667_10017450
890 Ga0207667_10230396
891 Ga0207651_10584372
892 Ga0207712_10132747
893 Ga0207668_10871353
894 Ga0207640_10301195
895 Ga0207639_10097463
896 Ga0207678_10047491
897 Ga0207678_10486648
898 Ga0207708_10013577
899 Ga0207641_10148602
900 Ga0207648_10014493
901 Ga0207648_10164592
902 Ga0207674_10010127
903 Ga0207675_100002622
904 Ga0207675_100030921
905 Ga0207683_10006806
906 Ga0207698_10049558
907 Ga0207698_10195467
908 Ga0207428_10036485
909 Ga0207428_10037754
910 Ga0268266_10467526
911 Ga0268265_10109207
912 Ga0265337_1042971
913 Ga0265319_1027997
914 Ga0265334_10074414
915 Ga0265336_10002098
916 Ga0265338_10001136
917 Ga0265338_10025465
918 Ga0265338_10047519
919 Ga0265324_10021030
920 Ga0265313_10015273
921 Ga0307416_100453182
922 Ga0307415_100212746
923 Ga0307415_100505679
924 Ga0373948_0016732
925 Ga0373958_0023541
926 Ga0373959_0193371
927 Ga0373938_0092639
928 Ga0373940_0026545
929 Ga0373949_0008047
930 Ga0373951_0008617
931 Ga0373932_0024122
932 Ga0373939_0056643
933 Ga0373941_0060289
934 Ga0373941_0066196
935 Ga0373960_0002727
936 Ga0373960_0400234
937 Ga0373943_0091553
938 Ga0373943_0096557
939 Ga0373942_0023022
940 Ga0373942_0112159
941 Ga0373962_0084958
942 Ga0373931_0052283
943 Ga0373935_0073915
944 Ga0373935_0209172
945 Ga0373935_0750695
946 Ga0373947_0208722
947 Ga0373925_0780243
948 Ga0395899_0000944
949 Ga0395899_0006700
950 Ga0395899_0013000
951 Ga0395899_0212353
952 Ga0395899_0857902
953 Ga0395900_0016836
954 Ga0395900_0082051
955 Ga0395900_0120626
956 Ga0395900_0259905
957 Ga0395900_0359983
958 Ga0395900_0427637
959 Ga0395900_0678304
960 Ga0395898_0046692
961 Ga0395898_0052432
962 Ga0395898_0096427
963 Ga0395898_0186056
964 Ga0395898_0296828
965 Ga0395898_0297450
966 Ga0395898_0462074
967 Ga0395905_0003892
968 Ga0395905_0010609
969 Ga0395905_0017624
970 Ga0395905_0178130
971 Ga0395901_0013945
972 Ga0395901_0060402
973 Ga0395901_0116636
974 Ga0395901_0148016
975 Ga0395901_0162739
976 Ga0436363_0449192
977 Ga0436363_0632109
978 Ga0451789_0002071
979 Ga0451789_1200083
980 Ga0451793_0421659
981 Ga0451797_1221365
982 Ga0451802_0043835
983 Ga0451839_0552830
984 Ga0451845_0693541
985 Ga0451847_0404900
986 Ga0451849_1219108
987 Ga0451855_1324159
988 Ga0451853_1015021
989 Ga0451853_1969688
990 Ga0439448_0022260
991 Ga0439454_055619
992 Ga0439459_0042768
993 Ga0466963_0107087
994 Ga0466959_0240063
995 Ga0451576_1356936
996 Ga0466958_0661822
997 Ga0466967_0118881
998 Ga0466967_0284919
999 Ga0466967_1390979
1000 Ga0495627_133018
1001 Ga0495627_133388
1002 Ga0495592_0871963
1003 Ga0495603_0020368
1004 Ga0495603_0034882
1005 Ga0495641_0018702
1006 Ga0495641_0068798
1007 Ga0495653_0264568
1008 Ga0495582_0014279
1009 Ga0495582_0047912
1010 Ga0495605_0013784
1011 Ga0495639_0224044
1012 Ga0495584_0032136
1013 Ga0495584_0510732
1014 Ga0495585_0133831
1015 Ga0495596_0039423
1016 Ga0495596_0119704
1017 Ga0495607_0020903
1018 Ga0495608_0913216
1019 Ga0495616_0040392
1020 Ga0495628_0253856
1021 Ga0495628_0981259
1022 Ga0495630_0164566
1023 Ga0495630_0253929
1024 Ga0495637_0116816
1025 Ga0495637_0163109
1026 Ga0495637_0167924
1027 Ga0495644_0008552
1028 Ga0495663_0022630
1029 Ga0495663_0068115
1030 Ga0495642_0355569
1031 Ga0495652_0307850
1032 Ga0495586_0501089
1033 Ga0495609_0033783
1034 Ga0495609_0140481
1035 Ga0495597_0279296
1036 Ga0495667_0007852
1037 Ga0495656_0024422
1038 Ga0495656_0056934
1039 Ga0495656_0088440
1040 Ga0495656_0582589
1041 Ga0495668_0206036
1042 Ga0495611_0043327
1043 Ga0495611_0403482
1044 Ga0495635_0021837
1045 Ga0495635_0524535
1046 Ga0495659_0115718
1047 Ga0495659_0160866
1048 Ga0495659_0290187
1049 Ga0495661_0289746
1050 Ga0495657_0136579
1051 Ga0495658_0080024
1052 Ga0495658_0570282
1053 Ga0495669_0080515
1054 Ga0495613_0192424
1055 Ga0495613_0747263
1056 Ga0495670_0052036
1057 Ga0495670_0203517
1058 Ga0495671_0088223
1059 Ga0495589_0035387
1060 Ga0495589_0130603
1061 Ga0495581_0458284
1062 Ga0495604_0454878
1063 Ga0495636_0117291
1064 Ga0495674_0488839
1065 Ga0495676_0047332
1066 Ga0495676_0079082
1067 Ga0495676_0127620
1068 Ga0495676_0256870
1069 Ga0495680_0238193
1070 Ga0495677_0171971
1071 Ga0495684_0016876
1072 Ga0495684_0270691
1073 Ga0495593_0294424
1074 Ga0495626_0167361
1075 Ga0496100_0218442
1076 Ga0496100_0429056
1077 Ga0496100_1343316
1078 Ga0496101_0031081
1079 Ga0496101_0274878
1080 Ga0496101_0752611
1081 Ga0496102_0012058
1082 Ga0496102_0058090
1083 Ga0496102_0357675
1084 Ga0496102_1184996
1085 Ga0496103_0001595
1086 Ga0496103_0031664
1087 Ga0496103_0337147
1088 Ga0496104_0004374
1089 Ga0496104_0300417
1090 Ga0496104_1040018
1091 Ga0496105_0007168
1092 Ga0496106_0051472
1093 Ga0496106_0872924
1094 Ga0496107_0473747
1095 Ga0496109_0027044
1096 Ga0496109_0057223
1097 Ga0496109_0066999
1098 Ga0496109_0092278
1099 Ga0496110_0105137
1100 Ga0496110_0933452
1101 Ga0496110_1197604
1102 Ga0496111_0075878
1103 Ga0496112_0018556
1104 Ga0496112_0074573
1105 Ga0496113_0120816
1106 Ga0496113_0130716
1107 Ga0496114_0004740
1108 Ga0496114_0220837
1109 Ga0496114_0705064
1110 Ga0496114_0938086
1111 Ga0496115_0006287
1112 Ga0496115_0024105
1113 Ga0496115_0036368
1114 Ga0496115_0185816
1115 Ga0501031_0003148
1116 Ga0501031_0005385
1117 Ga0501031_0077970
1118 Ga0501031_0325447
1119 Ga0501031_0355236
1120 Ga0501032_0002823
1121 Ga0501032_0006387
1122 Ga0501032_0752968
1123 Ga0501033_0000721
1124 Ga0501033_0102782
1125 Ga0501033_0604353
1126 Ga0501034_0059333
1127 Ga0501034_0880447
1128 Ga0501036_0002509
1129 Ga0501036_0004931
1130 Ga0501036_0010015
1131 Ga0501036_0127772
1132 Ga0501036_0176219
1133 Ga0501036_0416564
1134 Ga0501036_1122363
1135 Ga0501037_0001806
1136 Ga0501037_0635482
1137 Ga0501038_0000667
1138 Ga0501038_0020348
1139 Ga0501038_0066803
1140 Ga0501039_0000132
1141 Ga0501039_0008485
1142 Ga0501039_0027908
1143 Ga0501039_0032722
1144 Ga0501039_0444076
1145 Ga0501039_0582748
1146 Ga0501040_0000039
1147 Ga0501040_0004888
1148 Ga0501040_0006738
1149 Ga0501040_0035028
1150 Ga0501040_0214018
1151 Ga0501040_0408535
1152 Ga0501041_0000117
1153 Ga0501041_0041578
1154 Ga0501041_0232983
1155 Ga0501041_0870928
1156 Ga0501042_0002833
1157 Ga0501042_0023978
1158 Ga0501042_0026202
1159 Ga0501042_0108806
1160 Ga0501042_0212904
1161 Ga0501042_0251023
1162 Ga0501043_0016248
1163 Ga0501043_0035206
1164 Ga0501043_0062314
1165 Ga0501046_0005152
1166 Ga0501046_0019727
1167 Ga0501046_0029430
1168 Ga0501046_0305740
1169 Ga0501047_0007842
1170 Ga0501047_0015137
1171 Ga0501048_0003142
1172 Ga0501048_0009637
1173 Ga0501048_0014012
1174 Ga0501048_0135191
1175 Ga0501048_0249973
1176 Ga0501067_0034642
1177 Ga0501068_0006375
1178 Ga0501068_0096202
1179 Ga0501069_0027301
1180 Ga0501070_0009512
1181 Ga0501070_0090092
1182 Ga0501070_0146670
1183 Ga0501071_0000001
1184 Ga0501071_0003905
1185 Ga0501071_0076064
1186 Ga0501071_0154926
1187 Ga0501071_0250974
1188 Ga0501071_0612129
1189 Ga0501072_0002417
1190 Ga0501072_0008626
1191 Ga0501072_0013572
1192 Ga0501072_0017499
1193 Ga0501072_0494073
1194 Ga0501072_0687648
1195 Ga0501073_0005116
1196 Ga0501073_0010541
1197 Ga0501073_0812726
1198 Ga0501074_0000686
1199 Ga0501074_0010794
1200 Ga0501074_0058363
1201 Ga0501075_0000075
1202 Ga0501075_0000731
1203 Ga0501075_0059909
1204 Ga0501075_0095559
1205 Ga0501075_0123414
1206 Ga0501076_0004850
1207 Ga0501076_0007952
1208 Ga0501076_0008697
1209 Ga0501076_0010861
1210 Ga0501076_0102579
1211 Ga0501076_0177678
1212 Ga0501077_0000190
1213 Ga0501077_0001162
1214 Ga0501077_0015738
1215 Ga0501077_0046855
1216 Ga0501077_0062421
1217 Ga0501077_0240191
1218 Ga0501077_0478510
1219 Ga0501079_0007569
1220 Ga0501079_0007602
1221 Ga0501079_0008465
1222 Ga0501079_0021720
1223 Ga0501079_0031007
1224 Ga0501079_0738550
1225 Ga0501080_0018872
1226 Ga0501080_0042652
1227 Ga0501080_0054595
1228 Ga0501080_0201689
1229 Ga0501081_0002601
1230 Ga0501081_0011694
1231 Ga0501081_0012683
1232 Ga0501081_0089859
1233 Ga0501081_0191645
1234 Ga0501081_0205708
1235 Ga0501083_0012992
1236 Ga0501083_0023686
1237 Ga0501083_0071870
1238 Ga0501083_0480881
1239 Ga0501035_0003401
1240 Ga0501035_0034663
1241 Ga0501035_0084135
1242 Ga0501035_0266658
1243 Ga0501044_0010743
1244 Ga0501044_0057217
1245 Ga0501044_0661449
1246 Ga0501045_0008819
1247 Ga0501045_0013895
1248 Ga0501045_0014826
1249 Ga0501045_0029051
1250 Ga0501045_0141144
1251 Ga0501045_0167423
1252 nmdc:mga05p37_100716_c1
1253 nmdc:mga05p37_84351_c1
1254 nmdc:mga06r32_52397_c1
1255 nmdc:mga08y16_120693_c1
1256 nmdc:mga08y16_273476_c1
1257 nmdc:mga0n895_1039394_c1
1258 nmdc:mga0n895_139989_c1
1259 nmdc:mga0n895_367481_c1
1260 nmdc:mga0n895_42863_c1
1261 nmdc:mga0rr50_1896156_c1
1262 nmdc:mga0rr50_25628_c1
1263 nmdc:mga0rr50_41295_c1
1264 nmdc:mga08x19_5408_c1
1265 nmdc:mga08x19_680787_c1
1266 nmdc:mga0a205_47342_c1
1267 Ga0495601_0241248
1268 Ga0495655_0023980
1269 Ga0495655_0027056
1270 Ga0495595_0022280
1271 Ga0495619_0023326
1272 Ga0495619_0696191
1273 Ga0501084_0000321
1274 Ga0501084_0006616
1275 Ga0501084_0016865
1276 Ga0501084_0020774
1277 Ga0501084_0077668
1278 Ga0501084_0404730
1279 Ga0501084_1565758
1280 Ga0587073_0188337
1281 Ga0587073_0244676
1282 Ga0587091_135188
1283 Ga0587092_058939
1284 Ga0587092_066360
1285 Ga0587098_069774
1286 Ga0587067_050359
1287 Ga0587075_087467
1288 Ga0501082_0000607
1289 Ga0501082_0003020
1290 Ga0501082_0045598
1291 Ga0501082_0277950
1292 Ga0501082_0921701
1293 Ga0466962_0007319
1294 Ga0530510_0000134
1295 Ga0530510_0001602
1296 Ga0530510_0004708
1297 Ga0530510_0014937
1298 Ga0530510_0204442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13466

STAS_2

STAS domain

20

100

0.97

PF01740

STAS

STAS domain

8

112

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9228 2 114
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.911 1 112
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.91 2 102
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9064 2 100
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.902 1 113
ID Description Score Start End Superfamily
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9119 3 114 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9092 1 106 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9051 2 112 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8933 1 106 3.30.750.24
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8893 44 116 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7V9GVD6-F1-model_v4 Anti-sigma factor antagonist 0.9766 1 112 GO:0043856
AF-A0A838I9W5-F1-model_v4 Anti-sigma factor antagonist 0.9746 1 86 GO:0043856
AF-A0A538DBA0-F1-model_v4 Anti-sigma factor antagonist 0.9702 3 116 GO:0043856
AF-A0A538ARG3-F1-model_v4 Anti-sigma factor antagonist 0.9682 5 109 GO:0043856
AF-A0A538KEL9-F1-model_v4 Anti-sigma factor antagonist 0.9647 3 114 GO:0043856

Map