F472416

General Info

Members Datasets Scaffolds Average Seq Length
648 383 579 429

Family's Representative Sequence

Representative Sequence 3300053157|Ga0500624_000735|Ga0500624_000735_2242_3735
Length 497
Sequence LKHADLGLPLLINEIIFKYLLIGYSGLLRKLNRFSFTLKLMLPCSNQSPMKRKTFIQLSTTLMATPLISPLSAWAQQPRLKNWAGNLTYSTANVQYPHSVLEVQQLVKKHNKLKALGTRHCFNTIADSKDDLVSTKEMNKVLSLDKKNHTVTVEGGIKYGELAPYLHQQGFALHNLASLPHISVAGSITTATHGSGIKNGNLASAVTGLELVIADGSIVNLSKAADHEKLNAAVVGLGALGIITKVTLQIQPTYMMRQRVFLNLPMAQLKPNFEQIVSAGYSVSLFTDWQSDSINEVWIKSRVDTEKDHDQPEFYGAKAAIKNLHPIIDHPAESCTEQMGVPGPWYERLPHFKMGFTPSSGKELQSEYFVPLHHAVEAITAVSRLGKQIGPHLFITEIRTIASDNLWLSTAHNQTSVAIHFTWKQETKAVLKLLPLIEQELAPFNARPHWGKVFTLDPKVLASRYEKLADFKKLAAAYDPHGKFRNEFLDHNIYGGI

Samples

Sample ID Description Type Environment
1 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
2 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
3 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
4 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2643221546 Microbacterium sp. Root53 Isolate Unclassified
7 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
8 2643221572 Leifsonia sp. Root60 Isolate Unclassified
9 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
10 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
11 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
12 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
13 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
14 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
15 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
16 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
17 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
18 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
19 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
20 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
21 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
22 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
23 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
24 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
25 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
26 2857472729 Cohnella sp. R-74144 Isolate Unclassified
27 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
28 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
29 2858882152 Micromonospora noduli MED15 Isolate Nodule
30 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
31 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
32 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
33 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
34 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
35 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
36 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
37 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
38 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
39 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
40 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
41 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
42 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
43 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
44 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
45 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
46 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
47 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
48 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
49 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
50 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
51 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
52 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
53 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
54 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
55 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
56 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
57 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
58 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
59 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
60 2996887358 Rhizobium sp. R711 Isolate Nodule
61 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
62 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
63 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
67 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
68 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
69 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
73 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
74 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
92 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
93 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
117 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
118 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
119 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
126 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
128 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
257 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
260 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
375 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
376 8005258706 Rhizobium sp. R693 Isolate Nodule
377 8005321885 Rhizobium sp. R72 Isolate Nodule
378 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
379 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
380 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
381 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
382 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
383 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.58
Metatranscriptomes 0.62
Isolates 10.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 1.39
Rhizoplane 4.01
Rhizosphere 73.77
Stem 0
Stem Tuber 0
Unclassified 12.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000858 3300001989 Bacteria 11208
2 JGI24739J22299_10008425 3300001989 Bacteria 3852
3 JGI24737J22298_10000955 3300001990 Bacteria 10257
4 JGI24735J21928_10000001 3300002067 Bacteria 650042
5 JGI25162J39368_1000011 3300002737 Bacteria 379156
6 JGI25151J46595_10004677 3300003187 Bacteria 7198
7 rootH1_10002347 3300003316 Bacteria 21999
8 rootH1_10002347 3300003323 Bacteria 88814
9 rootH1_10017736 3300003316 Bacteria 2773
10 rootH1_10039056 3300003316 Bacteria 2591
11 rootH2_10002741 3300003320 Bacteria 45461
12 rootH2_10004991 3300003320 Bacteria 34166
13 rootH2_10025850 3300003320 Bacteria 4083
14 rootH2_10038272 3300003320 Bacteria 20840
15 rootH2_10143909 3300003320 Bacteria 6450
16 rootL2_10093281 3300003322 Unclassified 4072
17 rootH1_10001540 3300003323 Bacteria 14395
18 rootH1_10109173 3300003323 Bacteria 4059
19 JGI25160J50197_1001139 3300003354 Bacteria 13593
20 Ga0006562J51391_1071400 3300003578 Bacteria 17010
21 Ga0006562J51391_1071403 3300003578 Bacteria 16080
22 Ga0055524_1006795 3300003775 Bacteria 4933
23 Ga0055528_1000122 3300003790 Bacteria 61910
24 Ga0055528_1001795 3300003790 Bacteria 12305
25 Ga0055528_1002851 3300003790 Bacteria 9022
26 Ga0055528_1003222 3300003790 Bacteria 8324
27 Ga0055530_10000192 3300003791 Bacteria 54681
28 Ga0055531_10019370 3300003794 Bacteria 2755
29 Ga0055541_1002280 3300003841 Unclassified 3872
30 Ga0065165_1003174 3300005262 Bacteria 12041
31 Ga0065165_1012860 3300005262 Bacteria 3374
32 Ga0065714_10010493 3300005288 Unclassified 2726
33 Ga0070658_10000034 3300005327 Bacteria 146880
34 Ga0070658_10000047 3300005327 Bacteria 129483
35 Ga0070658_10001322 3300005327 Bacteria 21137
36 Ga0070658_10002721 3300005327 Bacteria 14705
37 Ga0070676_10000144 3300005328 Bacteria 27905
38 Ga0070676_10006110 3300005328 Bacteria 6430
39 Ga0070670_100265759 3300005331 Bacteria 1496
40 Ga0070680_100021522 3300005336 Bacteria 5126
41 Ga0068868_100036359 3300005338 Unclassified 3811
42 Ga0068868_100128119 3300005338 Bacteria 2075
43 Ga0070660_100009617 3300005339 Bacteria 6810
44 Ga0070660_100087869 3300005339 Bacteria 2447
45 Ga0070691_10027901 3300005341 Unclassified 2635
46 Ga0070661_100002750 3300005344 Bacteria 12061
47 Ga0070668_100002405 3300005347 Bacteria 13772
48 Ga0070668_100045181 3300005347 Bacteria 3380
49 Ga0070669_100217025 3300005353 Bacteria 1511
50 Ga0070675_100017991 3300005354 Bacteria 5624
51 Ga0070671_100044019 3300005355 Bacteria 3709
52 Ga0070674_100031040 3300005356 Bacteria 3537
53 Ga0070673_100001562 3300005364 Bacteria 13484
54 Ga0070673_100012206 3300005364 Bacteria 5891
55 Ga0070688_100065175 3300005365 Bacteria 2314
56 Ga0070659_100019639 3300005366 Bacteria 5125
57 Ga0070659_100030542 3300005366 Bacteria 4170
58 Ga0070659_100147535 3300005366 Bacteria 1917
59 Ga0070667_100051446 3300005367 Bacteria 3473
60 Ga0070713_100097439 3300005436 Bacteria 2541
61 Ga0070710_10001643 3300005437 Bacteria 10572
62 Ga0070710_10053126 3300005437 Bacteria 2281
63 Ga0070663_100046458 3300005455 Bacteria 3072
64 Ga0070662_100000083 3300005457 Bacteria 51358
65 Ga0070662_100015272 3300005457 Bacteria 5140
66 Ga0068867_100010471 3300005459 Bacteria 6544
67 Ga0068867_100043022 3300005459 Bacteria 3306
68 Ga0068867_100076784 3300005459 Bacteria 2509
69 Ga0070706_100005308 3300005467 Bacteria 12283
70 Ga0070699_100117412 3300005518 Unclassified 2338
71 Ga0070699_100160725 3300005518 Bacteria 1988
72 Ga0070679_100158139 3300005530 Bacteria 2241
73 Ga0070684_100035133 3300005535 Bacteria 4288
74 Ga0070697_100012295 3300005536 Bacteria 6705
75 Ga0068853_100022176 3300005539 Bacteria 5300
76 Ga0068853_100035432 3300005539 Bacteria 4239
77 Ga0068853_100037054 3300005539 Bacteria 4148
78 Ga0068853_100046898 3300005539 Bacteria 3707
79 Ga0070672_100031014 3300005543 Bacteria 4021
80 Ga0070695_100141681 3300005545 Unclassified 1668
81 Ga0070693_100011560 3300005547 Bacteria 4449
82 Ga0070665_100000267 3300005548 Bacteria 85526
83 Ga0070665_100126608 3300005548 Bacteria 2557
84 Ga0068855_100000033 3300005563 Bacteria 167299
85 Ga0068855_100000387 3300005563 Bacteria 54152
86 Ga0068855_100010601 3300005563 Bacteria 11111
87 Ga0068855_100016717 3300005563 Bacteria 8823
88 Ga0068855_100023962 3300005563 Bacteria 7307
89 Ga0068855_100035988 3300005563 Bacteria 5895
90 Ga0068855_100074648 3300005563 Bacteria 3938
91 Ga0068855_100187813 3300005563 Bacteria 2333
92 Ga0070664_100010434 3300005564 Bacteria 7532
93 Ga0068857_100001667 3300005577 Bacteria 17833
94 Ga0068857_100002243 3300005577 Bacteria 15733
95 Ga0068857_100010188 3300005577 Bacteria 8171
96 Ga0068857_100021646 3300005577 Bacteria 5657
97 Ga0068854_100104675 3300005578 Bacteria 2126
98 Ga0068854_100183734 3300005578 Bacteria 1635
99 Ga0068854_100266146 3300005578 Bacteria 1374
100 Ga0068856_100012578 3300005614 Bacteria 8191
101 Ga0068856_100024372 3300005614 Bacteria 5888
102 Ga0068856_100048542 3300005614 Bacteria 4184
103 Ga0068856_100107333 3300005614 Bacteria 2787
104 Ga0068856_100107858 3300005614 Bacteria 2781
105 Ga0068852_100004913 3300005616 Bacteria 9492
106 Ga0068852_100021679 3300005616 Bacteria 5137
107 Ga0068859_100023128 3300005617 Bacteria 6234
108 Ga0068859_100037581 3300005617 Bacteria 4859
109 Ga0068859_100174595 3300005617 Unclassified 2231
110 Ga0068864_100039737 3300005618 Unclassified 4021
111 Ga0068861_100036963 3300005719 Bacteria 3628
112 Ga0068851_10034675 3300005834 Bacteria 2519
113 Ga0068858_100115785 3300005842 Unclassified 2505
114 Ga0068860_100008334 3300005843 Bacteria 10316
115 Ga0068862_100016290 3300005844 Bacteria 6184
116 Ga0068862_100038325 3300005844 Bacteria 4065
117 Ga0068862_100078361 3300005844 Bacteria 2863
118 Ga0081455_10007021 3300005937 Bacteria 11960
119 Ga0081538_10003633 3300005981 Bacteria 14501
120 Ga0081540_1000176 3300005983 Bacteria 67057
121 Ga0081539_10000314 3300005985 Bacteria 108451
122 Ga0081539_10007233 3300005985 Bacteria 10203
123 Ga0075367_10003541 3300006178 Bacteria 7469
124 Ga0075366_10002535 3300006195 Bacteria 9392
125 Ga0097621_100000259 3300006237 Bacteria 35593
126 Ga0097621_100053048 3300006237 Bacteria 3304
127 Ga0068871_100000824 3300006358 Bacteria 20776
128 Ga0068871_100013546 3300006358 Bacteria 6053
129 Ga0068871_100105153 3300006358 Unclassified 2368
130 Ga0075428_100160792 3300006844 Bacteria 2438
131 Ga0075431_100050550 3300006847 Unclassified 4286
132 Ga0075431_100093275 3300006847 Bacteria 3107
133 Ga0068865_100000492 3300006881 Bacteria 22165
134 Ga0075436_100041614 3300006914 Bacteria 3170
135 Ga0097620_100023128 3300006931 Bacteria 6234
136 Ga0097620_100037579 3300006931 Bacteria 4859
137 Ga0097620_100174576 3300006931 Unclassified 2231
138 Ga0105240_10004820 3300009093 Bacteria 20332
139 Ga0105240_10021463 3300009093 Bacteria 8587
140 Ga0105240_10108054 3300009093 Unclassified 3371
141 Ga0105240_10161539 3300009093 Bacteria 2661
142 Ga0105240_10247714 3300009093 Bacteria 2062
143 Ga0105240_10333699 3300009093 Bacteria 1725
144 Ga0111539_10020817 3300009094 Bacteria 8076
145 Ga0105245_10044462 3300009098 Bacteria 3964
146 Ga0105245_10122021 3300009098 Bacteria 2435
147 Ga0105247_10005689 3300009101 Bacteria 7811
148 Ga0114129_10000363 3300009147 Bacteria 52419
149 Ga0114129_10012826 3300009147 Bacteria 11927
150 Ga0105243_10027581 3300009148 Unclassified 4352
151 Ga0105243_10063838 3300009148 Bacteria 2953
152 Ga0105243_10187893 3300009148 Bacteria 1802
153 Ga0105241_10000786 3300009174 Bacteria 24114
154 Ga0105241_10002347 3300009174 Bacteria 14220
155 Ga0105241_10007925 3300009174 Bacteria 7810
156 Ga0105242_10016460 3300009176 Bacteria 5749
157 Ga0105248_10041383 3300009177 Bacteria 5165
158 Ga0105248_10305140 3300009177 Bacteria 1793
159 Ga0105237_10000168 3300009545 Bacteria 92212
160 Ga0105237_10001170 3300009545 Bacteria 35066
161 Ga0105237_10007518 3300009545 Bacteria 11914
162 Ga0105237_10009320 3300009545 Bacteria 10517
163 Ga0105237_10018980 3300009545 Bacteria 7106
164 Ga0105238_10003025 3300009551 Bacteria 16777
165 Ga0105238_10003233 3300009551 Bacteria 16278
166 Ga0105238_10010786 3300009551 Bacteria 9181
167 Ga0105238_10395541 3300009551 Bacteria 1375
168 Ga0105249_10006878 3300009553 Bacteria 9917
169 Ga0105249_10031409 3300009553 Bacteria 4804
170 Ga0105249_10034065 3300009553 Bacteria 4613
171 Ga0105249_10161194 3300009553 Unclassified 2168
172 Ga0105239_10000046 3300010375 Bacteria 181115
173 Ga0105239_10000691 3300010375 Bacteria 48085
174 Ga0105239_10001174 3300010375 Bacteria 35994
175 Ga0105239_10023559 3300010375 Bacteria 6781
176 Ga0105239_10040793 3300010375 Bacteria 5086
177 Ga0105239_10060910 3300010375 Bacteria 4143
178 Ga0105239_10071808 3300010375 Unclassified 3803
179 Ga0105239_10162442 3300010375 Bacteria 2496
180 Ga0105246_10136194 3300011119 Unclassified 1841
181 Ga0157373_10011815 3300013100 Bacteria 6414
182 Ga0157373_10063604 3300013100 Unclassified 2612
183 Ga0157371_10051266 3300013102 Bacteria 2933
184 Ga0157370_10005157 3300013104 Bacteria 14730
185 Ga0157370_10023885 3300013104 Bacteria 6062
186 Ga0157370_10028181 3300013104 Bacteria 5528
187 Ga0157370_10028589 3300013104 Bacteria 5482
188 Ga0157369_10139471 3300013105 Bacteria 2566
189 Ga0157369_10245482 3300013105 Bacteria 1869
190 Ga0157374_10001231 3300013296 Bacteria 21878
191 Ga0157374_10001437 3300013296 Bacteria 20134
192 Ga0157374_10004828 3300013296 Bacteria 11312
193 Ga0157378_10000186 3300013297 Bacteria 59580
194 Ga0157378_10002879 3300013297 Bacteria 15314
195 Ga0157378_10054570 3300013297 Bacteria 3558
196 Ga0157378_10075294 3300013297 Bacteria 3039
197 Ga0157378_10088068 3300013297 Unclassified 2817
198 Ga0163162_10000074 3300013306 Bacteria 91138
199 Ga0163162_10003517 3300013306 Bacteria 14983
200 Ga0163162_10218570 3300013306 Bacteria 2035
201 Ga0163162_10257129 3300013306 Bacteria 1878
202 Ga0157372_10001527 3300013307 Bacteria 25162
203 Ga0157372_10003673 3300013307 Bacteria 16500
204 Ga0157372_10010851 3300013307 Bacteria 9698
205 Ga0157372_10076564 3300013307 Bacteria 3777
206 Ga0157372_10143908 3300013307 Bacteria 2749
207 Ga0157375_10029531 3300013308 Bacteria 5158
208 Ga0157375_10074030 3300013308 Bacteria 3426
209 Ga0157375_10102767 3300013308 Bacteria 2944
210 Ga0157375_10138993 3300013308 Bacteria 2554
211 Ga0157375_10168871 3300013308 Unclassified 2334
212 Ga0157380_10001405 3300014326 Bacteria 15733
213 Ga0157377_10013191 3300014745 Bacteria 4178
214 Ga0157379_10013019 3300014968 Bacteria 7282
215 Ga0157379_10035219 3300014968 Bacteria 4463
216 Ga0157376_10031040 3300014969 Bacteria 4273
217 Ga0157376_10101232 3300014969 Unclassified 2517
218 Ga0157376_10261567 3300014969 Unclassified 1621
219 Ga0163161_10010871 3300017792 Bacteria 6309
220 Ga0206353_10653945 3300020082 Bacteria 1430
221 Ga0206353_11269176 3300020082 Bacteria 1557
222 Ga0213875_10021391 3300021388 Bacteria 3099
223 Ga0213875_10052474 3300021388 Bacteria 1910
224 Ga0209784_100315 3300025224 Bacteria 25280
225 Ga0209566_100160 3300025225 Bacteria 75483
226 Ga0209437_100017 3300025233 Bacteria 694471
227 Ga0209129_1000285 3300025258 Bacteria 48259
228 Ga0209129_1006025 3300025258 Bacteria 4067
229 Ga0209455_1003623 3300025272 Bacteria 5374
230 Ga0209673_1000041 3300025273 Bacteria 307397
231 Ga0209673_1002627 3300025273 Bacteria 12065
232 Ga0209673_1021143 3300025273 Bacteria 2284
233 Ga0209025_1001792 3300025294 Bacteria 25500
234 Ga0209025_1006333 3300025294 Bacteria 9228
235 Ga0209025_1035782 3300025294 Bacteria 2236
236 Ga0209564_1004107 3300025295 Bacteria 9155
237 Ga0209564_1004859 3300025295 Bacteria 7985
238 Ga0209564_1007535 3300025295 Bacteria 5606
239 Ga0209758_1005889 3300025297 Bacteria 9142
240 Ga0209758_1016045 3300025297 Bacteria 3829
241 Ga0209256_1000603 3300025299 Bacteria 49871
242 Ga0209256_1002359 3300025299 Bacteria 15682
243 Ga0207426_1000002 3300025302 Bacteria 1249660
244 Ga0207426_1000394 3300025302 Bacteria 74327
245 Ga0207692_10000114 3300025898 Bacteria 24131
246 Ga0207692_10017773 3300025898 Bacteria 3177
247 Ga0207710_10024392 3300025900 Bacteria 2604
248 Ga0207647_10000098 3300025904 Bacteria 67170
249 Ga0207647_10048582 3300025904 Bacteria 2634
250 Ga0207647_10057991 3300025904 Bacteria 2372
251 Ga0207645_10000185 3300025907 Bacteria 49988
252 Ga0207645_10016572 3300025907 Unclassified 4875
253 Ga0207643_10041849 3300025908 Bacteria 2582
254 Ga0207705_10000001 3300025909 Bacteria 2061880
255 Ga0207705_10000048 3300025909 Bacteria 171848
256 Ga0207705_10000052 3300025909 Bacteria 168319
257 Ga0207705_10001239 3300025909 Bacteria 20528
258 Ga0207705_10006268 3300025909 Bacteria 8834
259 Ga0207705_10120079 3300025909 Bacteria 1950
260 Ga0207684_10001098 3300025910 Bacteria 30303
261 Ga0207654_10007450 3300025911 Bacteria 5511
262 Ga0207654_10061419 3300025911 Unclassified 2199
263 Ga0207654_10167190 3300025911 Bacteria 1425
264 Ga0207707_10001640 3300025912 Bacteria 20648
265 Ga0207695_10007354 3300025913 Bacteria 14053
266 Ga0207695_10085411 3300025913 Bacteria 3185
267 Ga0207671_10017817 3300025914 Bacteria 5464
268 Ga0207671_10030572 3300025914 Bacteria 4015
269 Ga0207671_10041005 3300025914 Bacteria 3426
270 Ga0207657_10011825 3300025919 Bacteria 8641
271 Ga0207657_10024359 3300025919 Bacteria 5608
272 Ga0207657_10027110 3300025919 Bacteria 5252
273 Ga0207657_10136053 3300025919 Bacteria 2010
274 Ga0207649_10009213 3300025920 Bacteria 5398
275 Ga0207652_10012140 3300025921 Bacteria 6960
276 Ga0207652_10056866 3300025921 Bacteria 3368
277 Ga0207694_10058881 3300025924 Bacteria 2988
278 Ga0207664_10001655 3300025929 Bacteria 14675
279 Ga0207690_10096893 3300025932 Bacteria 2098
280 Ga0207690_10110219 3300025932 Bacteria 1981
281 Ga0207706_10000176 3300025933 Bacteria 70917
282 Ga0207706_10033783 3300025933 Bacteria 4552
283 Ga0207706_10040297 3300025933 Unclassified 4140
284 Ga0207706_10057545 3300025933 Bacteria 3424
285 Ga0207686_10120669 3300025934 Bacteria 1784
286 Ga0207669_10046608 3300025937 Bacteria 2563
287 Ga0207704_10000055 3300025938 Bacteria 78858
288 Ga0207691_10021434 3300025940 Bacteria 6101
289 Ga0207661_10001552 3300025944 Bacteria 15630
290 Ga0207661_10026636 3300025944 Bacteria 4408
291 Ga0207679_10000698 3300025945 Bacteria 22446
292 Ga0207667_10000046 3300025949 Bacteria 245420
293 Ga0207667_10001788 3300025949 Bacteria 27052
294 Ga0207667_10014403 3300025949 Bacteria 9019
295 Ga0207667_10028130 3300025949 Bacteria 6107
296 Ga0207667_10044710 3300025949 Bacteria 4691
297 Ga0207667_10046262 3300025949 Bacteria 4608
298 Ga0207667_10061022 3300025949 Bacteria 3946
299 Ga0207667_10109753 3300025949 Bacteria 2845
300 Ga0207667_10119828 3300025949 Bacteria 2712
301 Ga0207712_10032767 3300025961 Bacteria 3509
302 Ga0207712_10045262 3300025961 Unclassified 3046
303 Ga0207712_10049816 3300025961 Bacteria 2921
304 Ga0207712_10185611 3300025961 Bacteria 1637
305 Ga0207668_10004502 3300025972 Bacteria 8191
306 Ga0207640_10042170 3300025981 Bacteria 2908
307 Ga0207640_10121230 3300025981 Bacteria 1874
308 Ga0207640_10167721 3300025981 Bacteria 1632
309 Ga0207677_10003225 3300026023 Bacteria 8610
310 Ga0207639_10002131 3300026041 Bacteria 13323
311 Ga0207639_10041146 3300026041 Bacteria 3455
312 Ga0207639_10047294 3300026041 Bacteria 3251
313 Ga0207678_10002430 3300026067 Bacteria 16931
314 Ga0207678_10017456 3300026067 Bacteria 6304
315 Ga0207678_10110615 3300026067 Bacteria 2344
316 Ga0207702_10027939 3300026078 Bacteria 4688
317 Ga0207702_10039591 3300026078 Bacteria 3951
318 Ga0207702_10042042 3300026078 Bacteria 3833
319 Ga0207648_10000775 3300026089 Bacteria 36025
320 Ga0207648_10004402 3300026089 Bacteria 14469
321 Ga0207648_10053372 3300026089 Bacteria 3533
322 Ga0207648_10073349 3300026089 Bacteria 2983
323 Ga0207676_10058400 3300026095 Bacteria 3043
324 Ga0207674_10002306 3300026116 Bacteria 24173
325 Ga0207674_10004034 3300026116 Bacteria 17814
326 Ga0207674_10010609 3300026116 Bacteria 10422
327 Ga0207674_10121147 3300026116 Bacteria 2584
328 Ga0207674_10168020 3300026116 Bacteria 2147
329 Ga0207675_100001143 3300026118 Bacteria 26301
330 Ga0207683_10033313 3300026121 Bacteria 4475
331 Ga0207683_10129343 3300026121 Bacteria 2270
332 Ga0207698_10007539 3300026142 Bacteria 6819
333 Ga0207428_10003584 3300027907 Bacteria 14987
334 Ga0207428_10011294 3300027907 Bacteria 7909
335 Ga0268266_10000018 3300028379 Bacteria 569141
336 Ga0268266_10078736 3300028379 Bacteria 2869
337 Ga0268265_10003622 3300028380 Bacteria 11027
338 Ga0268264_10007604 3300028381 Bacteria 9033
339 Ga0307517_10010105 3300028786 Bacteria 13262
340 Ga0307515_10000218 3300028794 Bacteria 141810
341 Ga0307515_10004345 3300028794 Bacteria 29399
342 Ga0307515_10020770 3300028794 Bacteria 11687
343 Ga0307515_10025103 3300028794 Bacteria 10334
344 Ga0307515_10110197 3300028794 Bacteria 3225
345 Ga0265338_10094269 3300028800 Bacteria 2463
346 Ga0265338_10161769 3300028800 Bacteria 1728
347 Ga0307511_10000263 3300030521 Bacteria 54309
348 Ga0307513_10027356 3300031456 Bacteria 6551
349 Ga0307513_10092225 3300031456 Bacteria 3084
350 Ga0307509_10018420 3300031507 Bacteria 8007
351 Ga0307408_100286411 3300031548 Bacteria 1374
352 Ga0307508_10002097 3300031616 Bacteria 21434
353 Ga0307514_10012444 3300031649 Bacteria 7079
354 Ga0307516_10000645 3300031730 Bacteria 47214
355 Ga0307410_10070846 3300031852 Bacteria 2416
356 Ga0307410_10114124 3300031852 Bacteria 1960
357 Ga0307406_10104701 3300031901 Bacteria 1934
358 Ga0307409_100090698 3300031995 Unclassified 2503
359 Ga0307416_100170224 3300032002 Bacteria 2026
360 Ga0307416_100184418 3300032002 Bacteria 1960
361 Ga0307411_10113699 3300032005 Bacteria 1943
362 Ga0307507_10000309 3300033179 Bacteria 98028
363 Ga0307507_10036864 3300033179 Bacteria 4989
364 Ga0307510_10003612 3300033180 Bacteria 18058
365 Ga0373956_0000100 3300035119 Bacteria 29550
366 Ga0373955_0000036 3300035172 Bacteria 53100
367 Ga0373942_0000988 3300035207 Bacteria 7727
368 Ga0373924_0000141 3300035410 Bacteria 21018
369 Ga0373927_0046299 3300035695 Bacteria 2814
370 Ga0373933_0000003 3300035724 Bacteria 150420
371 Ga0373937_0000016 3300036401 Bacteria 145523
372 Ga0373937_0194698 3300036401 Bacteria 1905
373 Ga0373925_0051500 3300037068 Bacteria 3073
374 Ga0395899_0001160 3300037312 Bacteria 23301
375 Ga0395899_0005413 3300037312 Bacteria 9914
376 Ga0395900_0001002 3300037418 Bacteria 36638
377 Ga0395900_0001549 3300037418 Bacteria 27320
378 Ga0395900_0034028 3300037418 Bacteria 5245
379 Ga0395898_0027333 3300037466 Bacteria 5730
380 Ga0395905_0000520 3300037471 Bacteria 52744
381 Ga0395905_0003309 3300037471 Bacteria 17296
382 Ga0395905_0145154 3300037471 Bacteria 2233
383 Ga0436364_1045843 3300037853 Bacteria 12100
384 Ga0436364_1370368 3300037853 Bacteria 3833
385 Ga0395901_0003411 3300038443 Bacteria 16009
386 Ga0395901_0003486 3300038443 Bacteria 15853
387 Ga0436365_0477741 3300039437 Bacteria 9398
388 Ga0439436_0000254 3300041404 Bacteria 12747
389 Ga0439439_0000573 3300041406 Bacteria 6422
390 Ga0451789_0569920 3300041443 Bacteria 2158
391 Ga0451853_0219621 3300041512 Bacteria 5306
392 Ga0439433_0006833 3300041999 Bacteria 2459
393 Ga0439442_016382 3300042002 Bacteria 1528
394 Ga0439448_0002774 3300042005 Bacteria 4791
395 Ga0439457_001494 3300042014 Bacteria 7010
396 Ga0439457_015518 3300042014 Bacteria 1700
397 Ga0439462_0002295 3300042015 Bacteria 4424
398 Ga0466972_0001129 3300044658 Bacteria 12796
399 Ga0466965_0000049 3300044683 Bacteria 41316
400 Ga0466965_0005037 3300044683 Bacteria 5920
401 Ga0466965_0044217 3300044683 Bacteria 2200
402 Ga0466971_0019854 3300044719 Bacteria 2985
403 Ga0466960_0001946 3300044901 Bacteria 7635
404 Ga0466959_0005261 3300045049 Bacteria 8838
405 Ga0466958_0024584 3300045836 Bacteria 3545
406 Ga0466958_0025139 3300045836 Bacteria 3509
407 Ga0466967_0083204 3300045976 Bacteria 2894
408 Ga0495592_0000276 3300046454 Bacteria 43983
409 Ga0495592_0132110 3300046454 Bacteria 1745
410 Ga0495603_0064589 3300046455 Bacteria 2158
411 Ga0495629_0058827 3300046459 Bacteria 2687
412 Ga0495638_0105317 3300046460 Bacteria 1681
413 Ga0495641_0022161 3300046461 Bacteria 3182
414 Ga0495651_0000009 3300046462 Bacteria 150455
415 Ga0495651_0007765 3300046462 Bacteria 8210
416 Ga0495653_0091501 3300046463 Bacteria 2224
417 Ga0495650_0000273 3300046471 Bacteria 98757
418 Ga0495582_0047595 3300046473 Bacteria 2362
419 Ga0495582_0070445 3300046473 Bacteria 1934
420 Ga0495585_0000132 3300046492 Bacteria 80905
421 Ga0495594_0018373 3300046499 Bacteria 3702
422 Ga0495606_0000130 3300046507 Bacteria 127805
423 Ga0495606_0001790 3300046507 Bacteria 27340
424 Ga0495606_0003939 3300046507 Bacteria 15274
425 Ga0495608_0000019 3300046511 Bacteria 180119
426 Ga0495608_0047673 3300046511 Bacteria 2848
427 Ga0495608_0126644 3300046511 Bacteria 1636
428 Ga0495610_0002154 3300046512 Bacteria 16751
429 Ga0495616_0017037 3300046513 Bacteria 4011
430 Ga0495616_0026948 3300046513 Bacteria 3053
431 Ga0495628_0001922 3300046516 Bacteria 18850
432 Ga0495631_0002317 3300046518 Bacteria 10849
433 Ga0495632_0001452 3300046519 Bacteria 19707
434 Ga0495648_0040209 3300046524 Bacteria 2967
435 Ga0495648_0045454 3300046524 Bacteria 2731
436 Ga0495648_0069070 3300046524 Bacteria 2058
437 Ga0495652_0000082 3300046529 Bacteria 102163
438 Ga0495652_0001220 3300046529 Bacteria 28817
439 Ga0495587_0001469 3300046536 Bacteria 15714
440 Ga0495609_0024937 3300046538 Bacteria 2742
441 Ga0495645_0065848 3300046543 Bacteria 2621
442 Ga0495633_0000015 3300046558 Bacteria 254484
443 Ga0495667_0001080 3300046559 Bacteria 17666
444 Ga0495668_0000041 3300046616 Bacteria 229462
445 Ga0495668_0000722 3300046616 Bacteria 39742
446 Ga0495625_0000941 3300046660 Bacteria 39077
447 Ga0495625_0001013 3300046660 Bacteria 37051
448 Ga0495625_0001068 3300046660 Bacteria 35670
449 Ga0495625_0007876 3300046660 Bacteria 9177
450 Ga0495625_0029015 3300046660 Bacteria 4142
451 Ga0495625_0029343 3300046660 Bacteria 4115
452 Ga0495625_0136554 3300046660 Bacteria 1657
453 Ga0495661_0001637 3300046665 Bacteria 18267
454 Ga0495661_0032357 3300046665 Unclassified 3306
455 Ga0495657_0000043 3300046675 Bacteria 114089
456 Ga0495599_0000078 3300046678 Bacteria 67349
457 Ga0495623_0000176 3300046679 Bacteria 40029
458 Ga0495646_0025482 3300046680 Bacteria 3719
459 Ga0495646_0028447 3300046680 Bacteria 3499
460 Ga0495649_0000419 3300046694 Bacteria 36929
461 Ga0495600_0001962 3300046809 Bacteria 11560
462 Ga0495600_0044297 3300046809 Bacteria 2903
463 Ga0495581_0035270 3300047315 Bacteria 2895
464 Ga0495604_0000149 3300047317 Bacteria 60591
465 Ga0495680_0000010 3300047322 Bacteria 142931
466 Ga0495680_0119838 3300047322 Bacteria 1944
467 Ga0495683_0051564 3300047323 Bacteria 2056
468 Ga0495687_000413 3300047443 Bacteria 52876
469 Ga0495687_002396 3300047443 Bacteria 15120
470 Ga0495687_019158 3300047443 Bacteria 3365
471 Ga0495675_0000385 3300047444 Bacteria 30543
472 Ga0495684_0148941 3300047471 Bacteria 1751
473 Ga0495686_0000039 3300047472 Bacteria 304821
474 Ga0495686_0000097 3300047472 Bacteria 183450
475 Ga0495686_0066493 3300047472 Bacteria 2227
476 Ga0495602_0000109 3300048088 Bacteria 79404
477 Ga0495614_0014816 3300048089 Bacteria 3408
478 Ga0495626_0000495 3300048091 Bacteria 39669
479 Ga0496101_0025618 3300048904 Bacteria 4093
480 Ga0496102_0004083 3300048905 Bacteria 12377
481 Ga0496102_0015429 3300048905 Bacteria 6655
482 Ga0496102_0116973 3300048905 Bacteria 2488
483 Ga0496103_0031517 3300048906 Bacteria 3230
484 Ga0496104_0174646 3300048907 Bacteria 2059
485 Ga0496105_0025977 3300048908 Bacteria 4772
486 Ga0496106_0056901 3300048909 Bacteria 2957
487 Ga0496107_0018294 3300048910 Bacteria 4933
488 Ga0496108_0000015 3300048911 Bacteria 243282
489 Ga0496108_0000411 3300048911 Bacteria 35165
490 Ga0496108_0004717 3300048911 Bacteria 10993
491 Ga0496108_0080330 3300048911 Bacteria 2762
492 Ga0496108_0099012 3300048911 Bacteria 2485
493 Ga0496109_0000029 3300048912 Bacteria 164675
494 Ga0496109_0055419 3300048912 Bacteria 3617
495 Ga0496109_0082189 3300048912 Bacteria 2968
496 Ga0496110_0002477 3300048913 Bacteria 13833
497 Ga0496110_0033092 3300048913 Bacteria 4470
498 Ga0496111_0000619 3300048914 Bacteria 18786
499 Ga0496112_0073587 3300048915 Bacteria 3378
500 Ga0496114_0015268 3300048917 Bacteria 6174
501 Ga0496114_0030971 3300048917 Bacteria 4401
502 Ga0496114_0208544 3300048917 Bacteria 1713
503 Ga0496121_0065153 3300048924 Bacteria 2966
504 Ga0496121_0092321 3300048924 Bacteria 2360
505 Ga0496122_0000360 3300048925 Bacteria 97913
506 Ga0496122_0001293 3300048925 Bacteria 41500
507 Ga0496122_0007604 3300048925 Bacteria 11976
508 Ga0496123_0010350 3300048926 Bacteria 8258
509 Ga0496124_0019119 3300048927 Bacteria 6392
510 Ga0496124_0157627 3300048927 Bacteria 1773
511 Ga0496125_0000015 3300048928 Bacteria 516648
512 Ga0496125_0036180 3300048928 Bacteria 4316
513 Ga0496126_0220285 3300048929 Bacteria 1594
514 Ga0495678_011761 3300049459 Bacteria 4176
515 Ga0501031_0028333 3300049568 Bacteria 3651
516 Ga0501031_0060826 3300049568 Bacteria 2461
517 Ga0501033_0004235 3300049570 Bacteria 11540
518 Ga0501033_0016842 3300049570 Bacteria 5526
519 Ga0501034_0009838 3300049571 Bacteria 9997
520 Ga0501034_0100360 3300049571 Bacteria 2889
521 Ga0501036_0002232 3300049572 Bacteria 15141
522 Ga0501036_0026775 3300049572 Bacteria 4871
523 Ga0501036_0074644 3300049572 Bacteria 2868
524 Ga0501037_0012541 3300049573 Bacteria 6244
525 Ga0501037_0061750 3300049573 Bacteria 2733
526 Ga0501038_0084069 3300049574 Bacteria 2678
527 Ga0501038_0146262 3300049574 Bacteria 1929
528 Ga0501043_0143626 3300049579 Bacteria 1868
529 Ga0501047_0049541 3300049581 Bacteria 4056
530 Ga0501047_0056453 3300049581 Bacteria 3797
531 Ga0501047_0189502 3300049581 Bacteria 1921
532 Ga0501067_0031265 3300049583 Bacteria 2954
533 Ga0501069_0053919 3300049585 Bacteria 2239
534 Ga0501070_0002851 3300049586 Bacteria 15073
535 Ga0501073_0060969 3300049589 Bacteria 2632
536 Ga0501074_0002212 3300049590 Bacteria 13490
537 Ga0501080_0011630 3300049742 Bacteria 8060
538 Ga0501083_0062281 3300049744 Bacteria 2489
539 Ga0501083_0087472 3300049744 Bacteria 2060
540 Ga0501035_0003383 3300049822 Bacteria 15258
541 Ga0501035_0004519 3300049822 Bacteria 13205
542 Ga0501044_0011585 3300049823 Bacteria 9556
543 Ga0501044_0040940 3300049823 Bacteria 4825
544 nmdc:mga0k408_57_c1 3300050493 Bacteria 56021
545 nmdc:mga04h51_11484_c1 3300050495 Bacteria 2459
546 nmdc:mga07m45_145102_c1 3300050496 Unclassified 1375
547 nmdc:mga05p37_4264_c2 3300050507 Unclassified 3357
548 nmdc:mga05p37_55462_c1 3300050507 Bacteria 4877
549 nmdc:mga05p37_9965_c1 3300050507 Bacteria 11286
550 nmdc:mga09592_182559_c1 3300050508 Unclassified 1815
551 nmdc:mga06r32_122481_c1 3300050510 Unclassified 2566
552 nmdc:mga06r32_29327_c1 3300050510 Bacteria 5155
553 nmdc:mga06r32_79114_c1 3300050510 Bacteria 3198
554 nmdc:mga06r32_94697_c1 3300050510 Bacteria 2922
555 nmdc:mga08y16_14258_c1 3300050511 Bacteria 8365
556 nmdc:mga08y16_18743_c1 3300050511 Bacteria 7290
557 nmdc:mga0n895_84023_c1 3300050512 Bacteria 3176
558 nmdc:mga0a205_47266_c1 3300050515 Bacteria 4152
559 Ga0495601_0001056 3300053077 Bacteria 15081
560 Ga0495601_0006954 3300053077 Bacteria 6626
561 Ga0495612_0040683 3300053078 Bacteria 1894
562 Ga0495595_0000888 3300053084 Bacteria 11497
563 Ga0495619_0131937 3300053085 Bacteria 1717
564 Ga0500555_000250 3300053103 Bacteria 23584
565 Ga0500608_000639 3300053122 Bacteria 12919
566 Ga0500618_000013 3300053125 Bacteria 183026
567 Ga0500618_005714 3300053125 Bacteria 3749
568 Ga0500568_0000508 3300053139 Bacteria 28665
569 Ga0500568_0002907 3300053139 Bacteria 9829
570 Ga0500573_0021088 3300053140 Bacteria 3732
571 Ga0500616_0000040 3300053153 Bacteria 367604
572 Ga0500616_0000206 3300053153 Bacteria 96372
573 Ga0500616_0000995 3300053153 Bacteria 30629
574 Ga0500624_000735 3300053157 Bacteria 8076
575 Ga0500645_000427 3300053730 Bacteria 29070
576 Ga0501084_0069948 3300054114 Bacteria 2939
577 Ga0501084_0099331 3300054114 Bacteria 2444
578 Ga0501082_0052149 3300060353 Bacteria 3526
579 Ga0466962_0003157 3300061719 Bacteria 7828

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_55462_c1 nmdc:mga05p37_55462_c1_10_1020 329
2 3300046680 Ga0495646_0028447 Ga0495646_0028447_2476_3489 332
3 3300042002 Ga0439442_016382 Ga0439442_016382_461_1513 346
4 iso_pu_bacteria 2866065130 2866069758 354
5 3300047322 Ga0495680_0119838 Ga0495680_0119838_24_1154 355
6 iso_pu_bacteria 2895427314 2895437423 375
7 3300013104 Ga0157370_10005157 Ga0157370_1000515716 382
8 3300025904 Ga0207647_10048582 Ga0207647_100485822 382
9 3300044683 Ga0466965_0044217 Ga0466965_0044217_38_1240 382
10 3300005536 Ga0070697_100012295 Ga0070697_1000122953 383
11 3300025909 Ga0207705_10120079 Ga0207705_101200791 385
12 3300005262 Ga0065165_1012860 Ga0065165_10128601 388
13 3300028794 Ga0307515_10110197 Ga0307515_101101974 388
14 3300048907 Ga0496104_0174646 Ga0496104_0174646_501_1733 388
15 3300003187 JGI25151J46595_10004677 JGI25151J46595_100046777 389
16 3300025258 Ga0209129_1000285 Ga0209129_100028518 389
17 3300025294 Ga0209025_1001792 Ga0209025_100179232 389
18 3300025297 Ga0209758_1016045 Ga0209758_10160453 389
19 3300049742 Ga0501080_0011630 Ga0501080_0011630_4384_5589 389
20 3300003316 rootH1_10039056 rootH1_100390562 390
21 3300003790 Ga0055528_1001795 Ga0055528_100179516 390
22 3300003790 Ga0055528_1002851 Ga0055528_10028513 390
23 3300025273 Ga0209673_1000041 Ga0209673_1000041315 390
24 3300025294 Ga0209025_1006333 Ga0209025_10063333 390
25 3300025295 Ga0209564_1004859 Ga0209564_10048593 390
26 3300025299 Ga0209256_1000603 Ga0209256_100060349 390
27 3300009147 Ga0114129_10000363 Ga0114129_100003632 391
28 iso_pu_bacteria 2884693830 2884701746 391
29 iso_pu_bacteria 2895442618 2895446571 391
30 3300005518 Ga0070699_100160725 Ga0070699_1001607251 392
31 3300005539 Ga0068853_100037054 Ga0068853_1000370541 392
32 3300005563 Ga0068855_100016717 Ga0068855_1000167177 392
33 3300005577 Ga0068857_100002243 Ga0068857_10000224315 392
34 3300005616 Ga0068852_100021679 Ga0068852_1000216793 392
35 3300009093 Ga0105240_10108054 Ga0105240_101080544 392
36 3300009551 Ga0105238_10003233 Ga0105238_1000323316 392
37 3300013307 Ga0157372_10003673 Ga0157372_100036731 392
38 3300021388 Ga0213875_10052474 Ga0213875_100524742 392
39 3300025949 Ga0207667_10014403 Ga0207667_100144032 392
40 3300026041 Ga0207639_10047294 Ga0207639_100472942 392
41 3300026116 Ga0207674_10010609 Ga0207674_100106095 392
42 3300037853 Ga0436364_1045843 Ga0436364_1045843_2880_4127 392
43 iso_pu_bacteria 2675903060 2676496458 392
44 3300053077 Ga0495601_0001056 Ga0495601_0001056_2034_3290 393
45 3300005437 Ga0070710_10001643 Ga0070710_100016432 394
46 3300005548 Ga0070665_100126608 Ga0070665_1001266082 394
47 3300025898 Ga0207692_10000114 Ga0207692_100001143 394
48 3300028379 Ga0268266_10078736 Ga0268266_100787362 394
49 3300044658 Ga0466972_0001129 Ga0466972_0001129_7123_8325 394
50 3300044683 Ga0466965_0005037 Ga0466965_0005037_3334_4536 394
51 3300044901 Ga0466960_0001946 Ga0466960_0001946_2049_3251 394
52 3300049744 Ga0501083_0087472 Ga0501083_0087472_98_1345 394
53 3300048911 Ga0496108_0000411 Ga0496108_0000411_23263_24534 396
54 3300041512 Ga0451853_0219621 Ga0451853_0219621_2115_3338 398
55 3300046455 Ga0495603_0064589 Ga0495603_0064589_657_1976 399
56 3300046462 Ga0495651_0007765 Ga0495651_0007765_3266_4522 399
57 3300048911 Ga0496108_0099012 Ga0496108_0099012_269_1543 399
58 3300005436 Ga0070713_100097439 Ga0070713_1000974392 400
59 3300025929 Ga0207664_10001655 Ga0207664_100016555 400
60 3300048911 Ga0496108_0080330 Ga0496108_0080330_283_1491 400
61 3300049744 Ga0501083_0062281 Ga0501083_0062281_57_1334 401
62 3300054114 Ga0501084_0069948 Ga0501084_0069948_624_1874 401
63 3300060353 Ga0501082_0052149 Ga0501082_0052149_628_1878 401
64 3300026116 Ga0207674_10121147 Ga0207674_101211472 402
65 3300033179 Ga0307507_10036864 Ga0307507_100368643 402
66 3300003323 rootH1_10001540 rootH1_100015404 403
67 3300035207 Ga0373942_0000988 Ga0373942_0000988_5662_6903 403
68 3300046524 Ga0495648_0069070 Ga0495648_0069070_72_1283 403
69 iso_pu_bacteria 2852643534 2852645731 403
70 iso_pu_bacteria 2857733635 2857733647 403
71 3300005347 Ga0070668_100002405 Ga0070668_1000024056 404
72 3300005353 Ga0070669_100217025 Ga0070669_1002170251 404
73 3300005844 Ga0068862_100038325 Ga0068862_1000383254 404
74 3300025972 Ga0207668_10004502 Ga0207668_100045025 404
75 3300031456 Ga0307513_10027356 Ga0307513_100273563 404
76 3300045836 Ga0466958_0024584 Ga0466958_0024584_1799_3025 404
77 iso_pu_bacteria 2643221546 2643753878 404
78 iso_pu_bacteria 2831935698 2831936529 404
79 iso_pu_bacteria 2832004796 2832009923 404
80 3300048925 Ga0496122_0000360 Ga0496122_0000360_72514_73743 405
81 3300048926 Ga0496123_0010350 Ga0496123_0010350_6070_7299 405
82 iso_pu_bacteria 2513237088 2513596525 405
83 iso_pu_bacteria 2582581304 2585257869 405
84 iso_pu_bacteria 2582581867 2585402346 405
85 iso_pu_bacteria 2585427590 2585822967 405
86 iso_pu_bacteria 2643221567 2643851249 405
87 iso_pu_bacteria 2643221624 2644138120 405
88 iso_pu_bacteria 2643221632 2644182080 405
89 iso_pu_bacteria 2947224130 2947226020 405
90 iso_pu_bacteria 2990059506 2990067870 405
91 iso_pu_bacteria 2996887358 2996888986 405
92 iso_pu_bacteria 8005321885 8005323513 405
93 3300005356 Ga0070674_100031040 Ga0070674_1000310401 406
94 3300005367 Ga0070667_100051446 Ga0070667_1000514462 406
95 3300005985 Ga0081539_10007233 Ga0081539_100072335 406
96 3300028794 Ga0307515_10000218 Ga0307515_1000021896 406
97 3300031616 Ga0307508_10002097 Ga0307508_1000209716 406
98 3300031730 Ga0307516_10000645 Ga0307516_1000064542 406
99 3300048911 Ga0496108_0000015 Ga0496108_0000015_142060_143307 406
100 3300049568 Ga0501031_0060826 Ga0501031_0060826_54_1337 406
101 3300049574 Ga0501038_0146262 Ga0501038_0146262_507_1790 406
102 3300049583 Ga0501067_0031265 Ga0501067_0031265_577_1860 406
103 3300049589 Ga0501073_0060969 Ga0501073_0060969_201_1484 406
104 3300053140 Ga0500573_0021088 Ga0500573_0021088_1536_2804 406
105 3300053153 Ga0500616_0000995 Ga0500616_0000995_22886_24166 406
106 iso_pu_bacteria 2784132109 2784471055 406
107 iso_pu_bacteria 2895660088 2895662660 406
108 3300005467 Ga0070706_100005308 Ga0070706_10000530811 407
109 3300047472 Ga0495686_0066493 Ga0495686_0066493_565_1806 407
110 3300048908 Ga0496105_0025977 Ga0496105_0025977_2530_3777 407
111 3300048912 Ga0496109_0055419 Ga0496109_0055419_1792_3039 407
112 3300048915 Ga0496112_0073587 Ga0496112_0073587_621_1868 407
113 iso_pu_bacteria 2811994879 2812355122 407
114 iso_pu_bacteria 2887478801 2887486212 407
115 iso_pu_bacteria 2939657138 2939659557 407
116 iso_pu_bacteria 2946064051 2946070773 407
117 iso_pu_bacteria 2996221748 2996223497 407
118 3300003578 Ga0006562J51391_1071400 Ga0006562J51391_107140013 408
119 3300003578 Ga0006562J51391_1071403 Ga0006562J51391_10714032 408
120 3300003775 Ga0055524_1006795 Ga0055524_10067954 408
121 3300003790 Ga0055528_1003222 Ga0055528_10032225 408
122 3300005347 Ga0070668_100045181 Ga0070668_1000451813 408
123 3300005355 Ga0070671_100044019 Ga0070671_1000440192 408
124 3300025258 Ga0209129_1006025 Ga0209129_10060253 408
125 3300025273 Ga0209673_1002627 Ga0209673_10026277 408
126 3300025294 Ga0209025_1035782 Ga0209025_10357822 408
127 3300025295 Ga0209564_1007535 Ga0209564_10075352 408
128 3300025299 Ga0209256_1002359 Ga0209256_100235915 408
129 3300025302 Ga0207426_1000394 Ga0207426_100039449 408
130 3300028794 Ga0307515_10025103 Ga0307515_100251039 408
131 3300028800 Ga0265338_10094269 Ga0265338_100942693 408
132 3300046507 Ga0495606_0003939 Ga0495606_0003939_2115_3362 408
133 3300046519 Ga0495632_0001452 Ga0495632_0001452_7818_9065 408
134 3300048906 Ga0496103_0031517 Ga0496103_0031517_450_1697 408
135 3300048924 Ga0496121_0065153 Ga0496121_0065153_361_1608 408
136 3300048924 Ga0496121_0092321 Ga0496121_0092321_336_1583 408
137 3300048927 Ga0496124_0019119 Ga0496124_0019119_3676_4929 408
138 3300048927 Ga0496124_0157627 Ga0496124_0157627_421_1674 408
139 3300048929 Ga0496126_0220285 Ga0496126_0220285_161_1414 408
140 3300049570 Ga0501033_0004235 Ga0501033_0004235_8815_10059 408
141 3300049571 Ga0501034_0009838 Ga0501034_0009838_3520_4764 408
142 3300049572 Ga0501036_0002232 Ga0501036_0002232_4758_6002 408
143 3300049572 Ga0501036_0026775 Ga0501036_0026775_901_2145 408
144 3300049574 Ga0501038_0084069 Ga0501038_0084069_592_1836 408
145 3300049581 Ga0501047_0049541 Ga0501047_0049541_868_2112 408
146 3300049585 Ga0501069_0053919 Ga0501069_0053919_772_2016 408
147 3300049586 Ga0501070_0002851 Ga0501070_0002851_4089_5333 408
148 3300049590 Ga0501074_0002212 Ga0501074_0002212_2663_3907 408
149 3300049822 Ga0501035_0004519 Ga0501035_0004519_10480_11724 408
150 3300053125 Ga0500618_005714 Ga0500618_005714_13_1266 408
151 iso_pu_bacteria 2643221690 2644505049 408
152 iso_pu_bacteria 2643221694 2644527377 408
153 iso_pu_bacteria 2643221722 2644667559 408
154 3300005518 Ga0070699_100117412 Ga0070699_1001174122 409
155 3300005614 Ga0068856_100107333 Ga0068856_1001073332 409
156 3300005985 Ga0081539_10000314 Ga0081539_1000031426 409
157 3300041443 Ga0451789_0569920 Ga0451789_0569920_838_2082 409
158 3300045976 Ga0466967_0083204 Ga0466967_0083204_900_2141 409
159 3300046461 Ga0495641_0022161 Ga0495641_0022161_1587_2846 409
160 3300049568 Ga0501031_0028333 Ga0501031_0028333_372_1721 409
161 3300049570 Ga0501033_0016842 Ga0501033_0016842_111_1460 409
162 3300049571 Ga0501034_0100360 Ga0501034_0100360_667_2016 409
163 3300049572 Ga0501036_0074644 Ga0501036_0074644_933_2282 409
164 3300049573 Ga0501037_0061750 Ga0501037_0061750_837_2186 409
165 3300049581 Ga0501047_0056453 Ga0501047_0056453_1377_2726 409
166 3300049822 Ga0501035_0003383 Ga0501035_0003383_66_1415 409
167 3300049823 Ga0501044_0011585 Ga0501044_0011585_540_1889 409
168 3300005437 Ga0070710_10053126 Ga0070710_100531261 410
169 3300009551 Ga0105238_10010786 Ga0105238_100107865 410
170 3300025898 Ga0207692_10017773 Ga0207692_100177732 410
171 3300031456 Ga0307513_10092225 Ga0307513_100922252 410
172 3300049581 Ga0501047_0189502 Ga0501047_0189502_208_1458 410
173 iso_pu_bacteria 2643221572 2643877796 410
174 iso_pu_bacteria 2643221669 2644384851 410
175 iso_pu_bacteria 2747842429 2747954409 410
176 iso_pu_bacteria 2935409751 2935410531 410
177 iso_pu_bacteria 2946033335 2946036125 410
178 3300005577 Ga0068857_100010188 Ga0068857_1000101882 411
179 3300005981 Ga0081538_10003633 Ga0081538_100036332 411
180 3300009551 Ga0105238_10395541 Ga0105238_103955412 411
181 3300013308 Ga0157375_10074030 Ga0157375_100740305 411
182 3300021388 Ga0213875_10021391 Ga0213875_100213911 411
183 3300031548 Ga0307408_100286411 Ga0307408_1002864111 411
184 3300031852 Ga0307410_10070846 Ga0307410_100708462 411
185 3300032002 Ga0307416_100170224 Ga0307416_1001702243 411
186 3300032002 Ga0307416_100184418 Ga0307416_1001844182 411
187 3300032005 Ga0307411_10113699 Ga0307411_101136991 411
188 3300041404 Ga0439436_0000254 Ga0439436_0000254_10643_11899 411
189 3300041406 Ga0439439_0000573 Ga0439439_0000573_4302_5558 411
190 3300041999 Ga0439433_0006833 Ga0439433_0006833_689_1945 411
191 3300042014 Ga0439457_001494 Ga0439457_001494_3024_4280 411
192 3300042015 Ga0439462_0002295 Ga0439462_0002295_2544_3800 411
193 3300046507 Ga0495606_0001790 Ga0495606_0001790_71_1330 411
194 3300046616 Ga0495668_0000722 Ga0495668_0000722_38322_39581 411
195 3300047323 Ga0495683_0051564 Ga0495683_0051564_667_1926 411
196 3300048091 Ga0495626_0000495 Ga0495626_0000495_38305_39564 411
197 3300048925 Ga0496122_0001293 Ga0496122_0001293_37331_38593 411
198 3300048928 Ga0496125_0000015 Ga0496125_0000015_205260_206522 411
199 3300049823 Ga0501044_0040940 Ga0501044_0040940_3314_4588 411
200 3300053139 Ga0500568_0000508 Ga0500568_0000508_8785_10047 411
201 iso_pu_bacteria 2811994880 2812362336 411
202 iso_pu_bacteria 2884994152 2884994364 411
203 iso_pu_bacteria 8025530807 8025533313 411
204 3300031507 Ga0307509_10018420 Ga0307509_100184205 412
205 3300031901 Ga0307406_10104701 Ga0307406_101047011 412
206 3300044683 Ga0466965_0000049 Ga0466965_0000049_23878_25143 412
207 3300046529 Ga0495652_0001220 Ga0495652_0001220_344_1600 412
208 3300046809 Ga0495600_0044297 Ga0495600_0044297_493_1749 412
209 3300048928 Ga0496125_0036180 Ga0496125_0036180_745_2004 412
210 3300053077 Ga0495601_0006954 Ga0495601_0006954_5158_6414 412
211 3300053078 Ga0495612_0040683 Ga0495612_0040683_101_1357 412
212 iso_pu_bacteria 8057345674 8057346031 412
213 3300009098 Ga0105245_10044462 Ga0105245_100444621 413
214 3300013306 Ga0163162_10218570 Ga0163162_102185703 413
215 3300013308 Ga0157375_10138993 Ga0157375_101389933 413
216 3300014969 Ga0157376_10101232 Ga0157376_101012323 413
217 3300025934 Ga0207686_10120669 Ga0207686_101206692 413
218 3300005834 Ga0068851_10034675 Ga0068851_100346753 414
219 3300013307 Ga0157372_10076564 Ga0157372_100765642 414
220 3300020082 Ga0206353_10653945 Ga0206353_106539451 414
221 3300025919 Ga0207657_10024359 Ga0207657_100243593 414
222 3300037853 Ga0436364_1370368 Ga0436364_1370368_556_1857 414
223 3300049579 Ga0501043_0143626 Ga0501043_0143626_358_1641 414
224 iso_pu_bacteria 2721755702 2723641100 414
225 iso_pu_bacteria 2855676851 2855678044 414
226 iso_pu_bacteria 2857288857 2857291361 414
227 iso_pu_bacteria 2858848962 2858848991 414
228 iso_pu_bacteria 2858882152 2858886471 414
229 iso_pu_bacteria 2858888857 2858893954 414
230 iso_pu_bacteria 2858895516 2858902364 414
231 iso_pu_bacteria 2869048445 2869051246 414
232 iso_pu_bacteria 2869061728 2869066577 414
233 iso_pu_bacteria 2869068681 2869072019 414
234 iso_pu_bacteria 2880489317 2880489414 414
235 iso_pu_bacteria 2880495981 2880496302 414
236 iso_pu_bacteria 2929226422 2929232097 414
237 iso_pu_bacteria 8054704163 8054705382 414
238 iso_pu_bacteria 8054727385 8054729683 414
239 iso_pu_bacteria 8054734606 8054739237 414
240 3300003320 rootH2_10025850 rootH2_100258504 415
241 3300005327 Ga0070658_10002721 Ga0070658_1000272112 415
242 3300005336 Ga0070680_100021522 Ga0070680_1000215222 415
243 3300010375 Ga0105239_10162442 Ga0105239_101624422 415
244 3300025909 Ga0207705_10000048 Ga0207705_10000048114 415
245 3300025909 Ga0207705_10001239 Ga0207705_1000123921 415
246 3300025944 Ga0207661_10026636 Ga0207661_100266362 415
247 3300031649 Ga0307514_10012444 Ga0307514_100124443 415
248 3300048925 Ga0496122_0007604 Ga0496122_0007604_3358_4629 415
249 3300053153 Ga0500616_0000040 Ga0500616_0000040_281274_282545 415
250 iso_pu_bacteria 2857472729 2857473807 415
251 iso_pu_bacteria 2888578766 2888581506 415
252 iso_pu_bacteria 2929219909 2929224958 415
253 iso_pu_bacteria 8003830390 8003837020 415
254 3300009148 Ga0105243_10187893 Ga0105243_101878931 416
255 3300042005 Ga0439448_0002774 Ga0439448_0002774_950_2230 416
256 3300046499 Ga0495594_0018373 Ga0495594_0018373_906_2165 416
257 3300005327 Ga0070658_10000034 Ga0070658_1000003426 417
258 3300005339 Ga0070660_100087869 Ga0070660_1000878692 417
259 3300005455 Ga0070663_100046458 Ga0070663_1000464581 417
260 3300005563 Ga0068855_100023962 Ga0068855_1000239623 417
261 3300005563 Ga0068855_100187813 Ga0068855_1001878132 417
262 3300005983 Ga0081540_1000176 Ga0081540_100017638 417
263 3300013104 Ga0157370_10023885 Ga0157370_100238856 417
264 3300013104 Ga0157370_10028589 Ga0157370_100285891 417
265 3300025909 Ga0207705_10000001 Ga0207705_10000001299 417
266 3300025919 Ga0207657_10136053 Ga0207657_101360533 417
267 3300025932 Ga0207690_10110219 Ga0207690_101102192 417
268 3300025949 Ga0207667_10046262 Ga0207667_100462624 417
269 3300025949 Ga0207667_10109753 Ga0207667_101097531 417
270 3300026067 Ga0207678_10002430 Ga0207678_100024306 417
271 3300026067 Ga0207678_10110615 Ga0207678_101106152 417
272 3300035119 Ga0373956_0000100 Ga0373956_0000100_13882_15150 417
273 3300035172 Ga0373955_0000036 Ga0373955_0000036_13838_15106 417
274 3300035410 Ga0373924_0000141 Ga0373924_0000141_19647_20915 417
275 3300035724 Ga0373933_0000003 Ga0373933_0000003_14415_15683 417
276 3300036401 Ga0373937_0000016 Ga0373937_0000016_128945_130213 417
277 3300046454 Ga0495592_0000276 Ga0495592_0000276_960_2228 417
278 3300046462 Ga0495651_0000009 Ga0495651_0000009_14447_15715 417
279 3300046463 Ga0495653_0091501 Ga0495653_0091501_933_2201 417
280 3300046511 Ga0495608_0000019 Ga0495608_0000019_44111_45379 417
281 3300046511 Ga0495608_0126644 Ga0495608_0126644_28_1308 417
282 3300046516 Ga0495628_0001922 Ga0495628_0001922_14440_15708 417
283 3300046529 Ga0495652_0000082 Ga0495652_0000082_15311_16579 417
284 3300046536 Ga0495587_0001469 Ga0495587_0001469_12_1280 417
285 3300046543 Ga0495645_0065848 Ga0495645_0065848_1221_2507 417
286 3300046559 Ga0495667_0001080 Ga0495667_0001080_1088_2356 417
287 3300046675 Ga0495657_0000043 Ga0495657_0000043_55889_57157 417
288 3300046678 Ga0495599_0000078 Ga0495599_0000078_52177_53445 417
289 3300046679 Ga0495623_0000176 Ga0495623_0000176_14424_15692 417
290 3300046680 Ga0495646_0025482 Ga0495646_0025482_515_1783 417
291 3300046809 Ga0495600_0001962 Ga0495600_0001962_8497_9765 417
292 3300047317 Ga0495604_0000149 Ga0495604_0000149_45429_46697 417
293 3300047322 Ga0495680_0000010 Ga0495680_0000010_134735_136003 417
294 3300047444 Ga0495675_0000385 Ga0495675_0000385_7158_8426 417
295 3300048088 Ga0495602_0000109 Ga0495602_0000109_14447_15715 417
296 3300048905 Ga0496102_0004083 Ga0496102_0004083_6306_7586 417
297 3300048911 Ga0496108_0004717 Ga0496108_0004717_9108_10388 417
298 3300048912 Ga0496109_0082189 Ga0496109_0082189_606_1886 417
299 3300048913 Ga0496110_0002477 Ga0496110_0002477_9949_11229 417
300 3300048914 Ga0496111_0000619 Ga0496111_0000619_10360_11640 417
301 3300048917 Ga0496114_0015268 Ga0496114_0015268_4774_6054 417
302 3300053084 Ga0495595_0000888 Ga0495595_0000888_39_1307 417
303 3300053085 Ga0495619_0131937 Ga0495619_0131937_419_1687 417
304 3300003323 rootH1_10109173 rootH1_101091734 418
305 3300009098 Ga0105245_10122021 Ga0105245_101220213 418
306 3300009148 Ga0105243_10063838 Ga0105243_100638383 418
307 3300009176 Ga0105242_10016460 Ga0105242_100164603 418
308 3300009177 Ga0105248_10305140 Ga0105248_103051402 418
309 3300013297 Ga0157378_10002879 Ga0157378_1000287912 418
310 3300025224 Ga0209784_100315 Ga0209784_1003157 418
311 3300025937 Ga0207669_10046608 Ga0207669_100466082 418
312 3300025981 Ga0207640_10121230 Ga0207640_101212301 418
313 3300026089 Ga0207648_10004402 Ga0207648_1000440216 418
314 3300026121 Ga0207683_10129343 Ga0207683_101293432 418
315 3300048904 Ga0496101_0025618 Ga0496101_0025618_882_2141 418
316 3300048910 Ga0496107_0018294 Ga0496107_0018294_1035_2294 418
317 3300048913 Ga0496110_0033092 Ga0496110_0033092_3093_4352 418
318 iso_pu_bacteria 8003870546 8003875888 418
319 3300005578 Ga0068854_100266146 Ga0068854_1002661461 419
320 3300006914 Ga0075436_100041614 Ga0075436_1000416144 419
321 3300009147 Ga0114129_10012826 Ga0114129_1001282610 419
322 3300050507 nmdc:mga05p37_9965_c1 nmdc:mga05p37_9965_c1_8296_9573 419
323 3300050515 nmdc:mga0a205_47266_c1 nmdc:mga0a205_47266_c1_2228_3505 419
324 3300005578 Ga0068854_100183734 Ga0068854_1001837342 420
325 3300025910 Ga0207684_10001098 Ga0207684_100010981 420
326 3300025981 Ga0207640_10167721 Ga0207640_101677212 420
327 3300037068 Ga0373925_0051500 Ga0373925_0051500_365_1642 420
328 3300044719 Ga0466971_0019854 Ga0466971_0019854_1024_2286 420
329 3300045049 Ga0466959_0005261 Ga0466959_0005261_6088_7350 420
330 3300045836 Ga0466958_0025139 Ga0466958_0025139_1098_2360 420
331 3300048905 Ga0496102_0116973 Ga0496102_0116973_1021_2310 420
332 3300048917 Ga0496114_0208544 Ga0496114_0208544_394_1683 420
333 3300061719 Ga0466962_0003157 Ga0466962_0003157_220_1482 420
334 iso_pu_bacteria 2912757875 2912763989 420
335 3300025909 Ga0207705_10006268 Ga0207705_100062682 421
336 3300042014 Ga0439457_015518 Ga0439457_015518_49_1332 421
337 3300031995 Ga0307409_100090698 Ga0307409_1000906983 422
338 3300046459 Ga0495629_0058827 Ga0495629_0058827_752_2047 422
339 3300046473 Ga0495582_0070445 Ga0495582_0070445_561_1856 422
340 3300047315 Ga0495581_0035270 Ga0495581_0035270_204_1499 422
341 3300048917 Ga0496114_0030971 Ga0496114_0030971_1477_2772 422
342 3300013105 Ga0157369_10139471 Ga0157369_101394712 423
343 iso_pu_bacteria 2858902515 2858907664 423
344 iso_pu_bacteria 8055412473 8055415063 424
345 3300003316 rootH1_10002347 rootH1_1000234719 425
346 3300003322 rootL2_10093281 rootL2_100932817 425
347 3300003354 JGI25160J50197_1001139 JGI25160J50197_100113910 425
348 3300003841 Ga0055541_1002280 Ga0055541_10022803 425
349 3300014969 Ga0157376_10031040 Ga0157376_100310405 425
350 3300025225 Ga0209566_100160 Ga0209566_10016022 425
351 3300025302 Ga0207426_1000002 Ga0207426_1000002266 425
352 3300050496 nmdc:mga07m45_145102_c1 nmdc:mga07m45_145102_c1_44_1327 425
353 3300053139 Ga0500568_0002907 Ga0500568_0002907_3615_4898 425
354 3300005328 Ga0070676_10006110 Ga0070676_100061104 426
355 3300026067 Ga0207678_10017456 Ga0207678_100174566 426
356 iso_pu_bacteria 8005258706 8005260357 426
357 3300005530 Ga0070679_100158139 Ga0070679_1001581391 427
358 3300025921 Ga0207652_10056866 Ga0207652_100568662 427
359 3300025932 Ga0207690_10096893 Ga0207690_100968931 427
360 3300025949 Ga0207667_10044710 Ga0207667_100447102 427
361 3300046460 Ga0495638_0105317 Ga0495638_0105317_160_1572 427
362 3300046473 Ga0495582_0047595 Ga0495582_0047595_817_2163 429
363 3300046558 Ga0495633_0000015 Ga0495633_0000015_153243_154625 430
364 iso_pu_bacteria 2599185184 2599477160 430
365 3300005366 Ga0070659_100019639 Ga0070659_1000196394 431
366 3300025919 Ga0207657_10011825 Ga0207657_100118253 431
367 3300025981 Ga0207640_10042170 Ga0207640_100421702 431
368 3300031852 Ga0307410_10114124 Ga0307410_101141242 431
369 3300005539 Ga0068853_100046898 Ga0068853_1000468981 432
370 3300005563 Ga0068855_100010601 Ga0068855_1000106015 432
371 3300006358 Ga0068871_100105153 Ga0068871_1001051532 432
372 3300013308 Ga0157375_10102767 Ga0157375_101027672 432
373 3300014969 Ga0157376_10261567 Ga0157376_102615671 432
374 3300025911 Ga0207654_10167190 Ga0207654_101671902 432
375 3300025914 Ga0207671_10017817 Ga0207671_100178175 432
376 3300025949 Ga0207667_10119828 Ga0207667_101198282 432
377 3300033180 Ga0307510_10003612 Ga0307510_1000361212 432
378 3300046511 Ga0495608_0047673 Ga0495608_0047673_1517_2827 432
379 3300002737 JGI25162J39368_1000011 JGI25162J39368_100001150 433
380 3300005327 Ga0070658_10000047 Ga0070658_10000047100 433
381 3300005339 Ga0070660_100009617 Ga0070660_1000096172 433
382 3300005539 Ga0068853_100022176 Ga0068853_1000221762 433
383 3300005563 Ga0068855_100000387 Ga0068855_10000038716 433
384 3300005614 Ga0068856_100107858 Ga0068856_1001078582 433
385 3300025233 Ga0209437_100017 Ga0209437_100017213 433
386 3300025272 Ga0209455_1003623 Ga0209455_10036233 433
387 3300025909 Ga0207705_10000052 Ga0207705_10000052101 433
388 3300025914 Ga0207671_10030572 Ga0207671_100305721 433
389 3300025914 Ga0207671_10041005 Ga0207671_100410053 433
390 3300025919 Ga0207657_10027110 Ga0207657_100271104 433
391 3300025949 Ga0207667_10001788 Ga0207667_1000178814 433
392 3300028786 Ga0307517_10010105 Ga0307517_100101051 433
393 3300046518 Ga0495631_0002317 Ga0495631_0002317_9166_10470 433
394 3300046660 Ga0495625_0029015 Ga0495625_0029015_2661_3965 433
395 3300053122 Ga0500608_000639 Ga0500608_000639_8033_9337 433
396 3300001989 JGI24739J22299_10008425 JGI24739J22299_100084251 434
397 3300001990 JGI24737J22298_10000955 JGI24737J22298_100009557 434
398 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001470 434
399 3300005341 Ga0070691_10027901 Ga0070691_100279012 434
400 3300005547 Ga0070693_100011560 Ga0070693_1000115603 434
401 3300005563 Ga0068855_100074648 Ga0068855_1000746483 434
402 3300005614 Ga0068856_100012578 Ga0068856_1000125782 434
403 3300025911 Ga0207654_10061419 Ga0207654_100614193 434
404 3300025912 Ga0207707_10001640 Ga0207707_1000164018 434
405 3300025913 Ga0207695_10085411 Ga0207695_100854112 434
406 3300025921 Ga0207652_10012140 Ga0207652_100121403 434
407 3300025949 Ga0207667_10061022 Ga0207667_100610223 434
408 3300026078 Ga0207702_10042042 Ga0207702_100420423 434
409 3300003320 rootH2_10002741 rootH2_1000274122 435
410 3300009553 Ga0105249_10031409 Ga0105249_100314094 435
411 3300020082 Ga0206353_11269176 Ga0206353_112691762 435
412 3300025924 Ga0207694_10058881 Ga0207694_100588813 435
413 3300003320 rootH2_10038272 rootH2_1003827214 436
414 3300005614 Ga0068856_100048542 Ga0068856_1000485422 436
415 3300013307 Ga0157372_10010851 Ga0157372_100108513 436
416 3300026078 Ga0207702_10039591 Ga0207702_100395912 436
417 3300053153 Ga0500616_0000206 Ga0500616_0000206_43549_44868 437
418 3300003316 rootH1_10017736 rootH1_100177362 438
419 3300053103 Ga0500555_000250 Ga0500555_000250_18995_20317 438
420 3300053730 Ga0500645_000427 Ga0500645_000427_8082_9404 438
421 3300005288 Ga0065714_10010493 Ga0065714_100104932 439
422 3300025904 Ga0207647_10057991 Ga0207647_100579913 439
423 3300039437 Ga0436365_0477741 Ga0436365_0477741_7739_9088 440
424 3300005338 Ga0068868_100036359 Ga0068868_1000363593 443
425 3300005617 Ga0068859_100174595 Ga0068859_1001745953 443
426 3300006931 Ga0097620_100174576 Ga0097620_1001745763 443
427 3300013297 Ga0157378_10088068 Ga0157378_100880682 443
428 3300025907 Ga0207645_10016572 Ga0207645_100165726 443
429 3300025933 Ga0207706_10040297 Ga0207706_100402974 443
430 iso_pu_bacteria 2919437846 2919440847 443
431 iso_pu_bacteria 2928078545 2928079074 443
432 iso_pu_bacteria 2928147474 2928148556 443
433 iso_pu_bacteria 2932082852 2932085850 443
434 3300005344 Ga0070661_100002750 Ga0070661_10000275012 444
435 3300005366 Ga0070659_100030542 Ga0070659_1000305423 444
436 3300005535 Ga0070684_100035133 Ga0070684_1000351333 444
437 3300005539 Ga0068853_100035432 Ga0068853_1000354323 444
438 3300005545 Ga0070695_100141681 Ga0070695_1001416811 444
439 3300005564 Ga0070664_100010434 Ga0070664_1000104345 444
440 3300005577 Ga0068857_100001667 Ga0068857_1000016673 444
441 3300013100 Ga0157373_10011815 Ga0157373_100118153 444
442 3300025920 Ga0207649_10009213 Ga0207649_100092133 444
443 3300025944 Ga0207661_10001552 Ga0207661_100015523 444
444 3300025945 Ga0207679_10000698 Ga0207679_100006983 444
445 3300026041 Ga0207639_10002131 Ga0207639_100021313 444
446 3300026116 Ga0207674_10004034 Ga0207674_1000403415 444
447 3300005328 Ga0070676_10000144 Ga0070676_1000014418 445
448 3300005338 Ga0068868_100128119 Ga0068868_1001281192 445
449 3300005364 Ga0070673_100001562 Ga0070673_1000015629 445
450 3300005459 Ga0068867_100010471 Ga0068867_1000104715 445
451 3300005459 Ga0068867_100076784 Ga0068867_1000767842 445
452 3300005548 Ga0070665_100000267 Ga0070665_10000026764 445
453 3300005616 Ga0068852_100004913 Ga0068852_1000049132 445
454 3300006237 Ga0097621_100000259 Ga0097621_10000025933 445
455 3300006237 Ga0097621_100053048 Ga0097621_1000530483 445
456 3300006358 Ga0068871_100000824 Ga0068871_10000082412 445
457 3300006358 Ga0068871_100013546 Ga0068871_1000135463 445
458 3300006881 Ga0068865_100000492 Ga0068865_10000049211 445
459 3300009093 Ga0105240_10004820 Ga0105240_1000482011 445
460 3300009093 Ga0105240_10247714 Ga0105240_102477141 445
461 3300009148 Ga0105243_10027581 Ga0105243_100275812 445
462 3300009174 Ga0105241_10007925 Ga0105241_100079255 445
463 3300009545 Ga0105237_10000168 Ga0105237_100001688 445
464 3300009545 Ga0105237_10001170 Ga0105237_1000117016 445
465 3300009551 Ga0105238_10003025 Ga0105238_100030257 445
466 3300010375 Ga0105239_10023559 Ga0105239_100235593 445
467 3300010375 Ga0105239_10060910 Ga0105239_100609102 445
468 3300013296 Ga0157374_10001437 Ga0157374_1000143710 445
469 3300013297 Ga0157378_10054570 Ga0157378_100545703 445
470 3300013297 Ga0157378_10075294 Ga0157378_100752942 445
471 3300013306 Ga0163162_10000074 Ga0163162_100000749 445
472 3300014968 Ga0157379_10035219 Ga0157379_100352192 445
473 3300025907 Ga0207645_10000185 Ga0207645_1000018533 445
474 3300025908 Ga0207643_10041849 Ga0207643_100418491 445
475 3300025913 Ga0207695_10007354 Ga0207695_100073545 445
476 3300025938 Ga0207704_10000055 Ga0207704_1000005510 445
477 3300026023 Ga0207677_10003225 Ga0207677_100032253 445
478 3300026041 Ga0207639_10041146 Ga0207639_100411462 445
479 3300026089 Ga0207648_10000775 Ga0207648_100007752 445
480 3300026089 Ga0207648_10073349 Ga0207648_100733492 445
481 3300026121 Ga0207683_10033313 Ga0207683_100333133 445
482 3300026142 Ga0207698_10007539 Ga0207698_100075395 445
483 3300028379 Ga0268266_10000018 Ga0268266_10000018469 445
484 3300035695 Ga0373927_0046299 Ga0373927_0046299_89_1435 445
485 3300046454 Ga0495592_0132110 Ga0495592_0132110_133_1482 445
486 3300047471 Ga0495684_0148941 Ga0495684_0148941_55_1404 445
487 3300003320 rootH2_10004991 rootH2_1000499124 446
488 3300005457 Ga0070662_100000083 Ga0070662_10000008341 446
489 3300005563 Ga0068855_100035988 Ga0068855_1000359887 446
490 3300005614 Ga0068856_100024372 Ga0068856_1000243722 446
491 3300005842 Ga0068858_100115785 Ga0068858_1001157852 446
492 3300005937 Ga0081455_10007021 Ga0081455_100070218 446
493 3300006178 Ga0075367_10003541 Ga0075367_100035412 446
494 3300006195 Ga0075366_10002535 Ga0075366_100025356 446
495 3300006847 Ga0075431_100050550 Ga0075431_1000505503 446
496 3300006847 Ga0075431_100093275 Ga0075431_1000932753 446
497 3300009093 Ga0105240_10333699 Ga0105240_103336992 446
498 3300009174 Ga0105241_10002347 Ga0105241_100023473 446
499 3300009545 Ga0105237_10007518 Ga0105237_100075187 446
500 3300009545 Ga0105237_10009320 Ga0105237_100093207 446
501 3300009545 Ga0105237_10018980 Ga0105237_100189806 446
502 3300009553 Ga0105249_10034065 Ga0105249_100340653 446
503 3300010375 Ga0105239_10000691 Ga0105239_100006916 446
504 3300010375 Ga0105239_10001174 Ga0105239_1000117426 446
505 3300010375 Ga0105239_10040793 Ga0105239_100407934 446
506 3300010375 Ga0105239_10071808 Ga0105239_100718082 446
507 3300011119 Ga0105246_10136194 Ga0105246_101361942 446
508 3300013100 Ga0157373_10063604 Ga0157373_100636042 446
509 3300013296 Ga0157374_10001231 Ga0157374_1000123110 446
510 3300013296 Ga0157374_10004828 Ga0157374_100048284 446
511 3300013308 Ga0157375_10029531 Ga0157375_100295314 446
512 3300017792 Ga0163161_10010871 Ga0163161_100108713 446
513 3300025904 Ga0207647_10000098 Ga0207647_1000009836 446
514 3300025911 Ga0207654_10007450 Ga0207654_100074504 446
515 3300025933 Ga0207706_10000176 Ga0207706_1000017639 446
516 3300025933 Ga0207706_10057545 Ga0207706_100575452 446
517 3300025949 Ga0207667_10028130 Ga0207667_100281302 446
518 3300026078 Ga0207702_10027939 Ga0207702_100279394 446
519 3300027907 Ga0207428_10003584 Ga0207428_100035842 446
520 3300028794 Ga0307515_10004345 Ga0307515_1000434524 446
521 3300028794 Ga0307515_10020770 Ga0307515_100207706 446
522 3300028800 Ga0265338_10161769 Ga0265338_101617691 446
523 3300030521 Ga0307511_10000263 Ga0307511_1000026322 446
524 3300033179 Ga0307507_10000309 Ga0307507_1000030977 446
525 3300037312 Ga0395899_0001160 Ga0395899_0001160_16504_17883 446
526 3300037312 Ga0395899_0005413 Ga0395899_0005413_2192_3544 446
527 3300037418 Ga0395900_0001002 Ga0395900_0001002_24951_26291 446
528 3300037418 Ga0395900_0001549 Ga0395900_0001549_2072_3451 446
529 3300037418 Ga0395900_0034028 Ga0395900_0034028_634_1986 446
530 3300037466 Ga0395898_0027333 Ga0395898_0027333_3093_4472 446
531 3300037471 Ga0395905_0000520 Ga0395905_0000520_16596_17948 446
532 3300037471 Ga0395905_0003309 Ga0395905_0003309_13882_15261 446
533 3300038443 Ga0395901_0003411 Ga0395901_0003411_10182_11561 446
534 3300038443 Ga0395901_0003486 Ga0395901_0003486_13314_14666 446
535 3300046524 Ga0495648_0040209 Ga0495648_0040209_1512_2891 446
536 3300046524 Ga0495648_0045454 Ga0495648_0045454_77_1417 446
537 3300046538 Ga0495609_0024937 Ga0495609_0024937_11_1390 446
538 3300046616 Ga0495668_0000041 Ga0495668_0000041_10042_11421 446
539 3300046660 Ga0495625_0000941 Ga0495625_0000941_25769_27148 446
540 3300046660 Ga0495625_0001068 Ga0495625_0001068_12032_13372 446
541 3300047443 Ga0495687_002396 Ga0495687_002396_13705_15048 446
542 3300047472 Ga0495686_0000097 Ga0495686_0000097_51590_52930 446
543 3300048089 Ga0495614_0014816 Ga0495614_0014816_683_2062 446
544 3300048912 Ga0496109_0000029 Ga0496109_0000029_40091_41467 446
545 3300050493 nmdc:mga0k408_57_c1 nmdc:mga0k408_57_c1_52032_53411 446
546 3300050495 nmdc:mga04h51_11484_c1 nmdc:mga04h51_11484_c1_315_1721 446
547 3300050507 nmdc:mga05p37_4264_c2 nmdc:mga05p37_4264_c2_267_1643 446
548 3300050508 nmdc:mga09592_182559_c1 nmdc:mga09592_182559_c1_157_1533 446
549 3300050510 nmdc:mga06r32_122481_c1 nmdc:mga06r32_122481_c1_163_1539 446
550 3300050510 nmdc:mga06r32_29327_c1 nmdc:mga06r32_29327_c1_2145_3500 446
551 3300050510 nmdc:mga06r32_79114_c1 nmdc:mga06r32_79114_c1_1073_2449 446
552 3300050511 nmdc:mga08y16_14258_c1 nmdc:mga08y16_14258_c1_5329_6705 446
553 3300050512 nmdc:mga0n895_84023_c1 nmdc:mga0n895_84023_c1_305_1681 446
554 3300053125 Ga0500618_000013 Ga0500618_000013_37632_38972 446
555 3300054114 Ga0501084_0099331 Ga0501084_0099331_407_1837 446
556 3300003320 rootH2_10143909 rootH2_101439095 447
557 3300005327 Ga0070658_10001322 Ga0070658_100013227 447
558 3300005354 Ga0070675_100017991 Ga0070675_1000179914 447
559 3300005364 Ga0070673_100012206 Ga0070673_1000122062 447
560 3300005365 Ga0070688_100065175 Ga0070688_1000651752 447
561 3300005457 Ga0070662_100015272 Ga0070662_1000152722 447
562 3300005459 Ga0068867_100043022 Ga0068867_1000430221 447
563 3300005543 Ga0070672_100031014 Ga0070672_1000310142 447
564 3300005563 Ga0068855_100000033 Ga0068855_10000003312 447
565 3300005577 Ga0068857_100021646 Ga0068857_1000216462 447
566 3300005578 Ga0068854_100104675 Ga0068854_1001046751 447
567 3300005617 Ga0068859_100037581 Ga0068859_1000375812 447
568 3300005618 Ga0068864_100039737 Ga0068864_1000397373 447
569 3300005719 Ga0068861_100036963 Ga0068861_1000369632 447
570 3300005844 Ga0068862_100016290 Ga0068862_1000162902 447
571 3300006931 Ga0097620_100037579 Ga0097620_1000375792 447
572 3300009093 Ga0105240_10021463 Ga0105240_100214634 447
573 3300009094 Ga0111539_10020817 Ga0111539_100208173 447
574 3300009174 Ga0105241_10000786 Ga0105241_1000078610 447
575 3300013102 Ga0157371_10051266 Ga0157371_100512661 447
576 3300013104 Ga0157370_10028181 Ga0157370_100281812 447
577 3300013105 Ga0157369_10245482 Ga0157369_102454821 447
578 3300013306 Ga0163162_10257129 Ga0163162_102571292 447
579 3300013307 Ga0157372_10001527 Ga0157372_100015276 447
580 3300013307 Ga0157372_10143908 Ga0157372_101439083 447
581 3300013308 Ga0157375_10168871 Ga0157375_101688712 447
582 3300014326 Ga0157380_10001405 Ga0157380_100014051 447
583 3300014745 Ga0157377_10013191 Ga0157377_100131912 447
584 3300025933 Ga0207706_10033783 Ga0207706_100337832 447
585 3300025940 Ga0207691_10021434 Ga0207691_100214343 447
586 3300025949 Ga0207667_10000046 Ga0207667_1000004691 447
587 3300025961 Ga0207712_10049816 Ga0207712_100498162 447
588 3300026089 Ga0207648_10053372 Ga0207648_100533722 447
589 3300026116 Ga0207674_10002306 Ga0207674_100023062 447
590 3300026118 Ga0207675_100001143 Ga0207675_1000011433 447
591 3300027907 Ga0207428_10011294 Ga0207428_100112943 447
592 3300028380 Ga0268265_10003622 Ga0268265_100036222 447
593 3300037471 Ga0395905_0145154 Ga0395905_0145154_129_1472 447
594 3300046471 Ga0495650_0000273 Ga0495650_0000273_69959_71302 447
595 3300046492 Ga0495585_0000132 Ga0495585_0000132_53736_55079 447
596 3300046507 Ga0495606_0000130 Ga0495606_0000130_71647_72990 447
597 3300046512 Ga0495610_0002154 Ga0495610_0002154_9345_10688 447
598 3300046513 Ga0495616_0017037 Ga0495616_0017037_317_1660 447
599 3300046513 Ga0495616_0026948 Ga0495616_0026948_207_1550 447
600 3300046660 Ga0495625_0001013 Ga0495625_0001013_27152_28495 447
601 3300046660 Ga0495625_0007876 Ga0495625_0007876_2639_3982 447
602 3300046660 Ga0495625_0029343 Ga0495625_0029343_1065_2408 447
603 3300046660 Ga0495625_0136554 Ga0495625_0136554_148_1491 447
604 3300046665 Ga0495661_0001637 Ga0495661_0001637_16592_17935 447
605 3300046665 Ga0495661_0032357 Ga0495661_0032357_546_1892 447
606 3300046694 Ga0495649_0000419 Ga0495649_0000419_8467_9810 447
607 3300047443 Ga0495687_000413 Ga0495687_000413_19972_21315 447
608 3300047443 Ga0495687_019158 Ga0495687_019158_1307_2650 447
609 3300047472 Ga0495686_0000039 Ga0495686_0000039_256890_258233 447
610 3300049459 Ga0495678_011761 Ga0495678_011761_408_1751 447
611 3300049573 Ga0501037_0012541 Ga0501037_0012541_2389_3792 447
612 3300050511 nmdc:mga08y16_18743_c1 nmdc:mga08y16_18743_c1_5585_6937 447
613 3300053157 Ga0500624_000735 Ga0500624_000735_2242_3735 447
614 3300001989 JGI24739J22299_10000858 JGI24739J22299_100008582 448
615 3300003790 Ga0055528_1000122 Ga0055528_100012219 448
616 3300003791 Ga0055530_10000192 Ga0055530_1000019231 448
617 3300003794 Ga0055531_10019370 Ga0055531_100193702 448
618 3300005262 Ga0065165_1003174 Ga0065165_10031748 448
619 3300005331 Ga0070670_100265759 Ga0070670_1002657591 448
620 3300005366 Ga0070659_100147535 Ga0070659_1001475352 448
621 3300005617 Ga0068859_100023128 Ga0068859_1000231285 448
622 3300005843 Ga0068860_100008334 Ga0068860_1000083347 448
623 3300005844 Ga0068862_100078361 Ga0068862_1000783614 448
624 3300006844 Ga0075428_100160792 Ga0075428_1001607922 448
625 3300006931 Ga0097620_100023128 Ga0097620_1000231285 448
626 3300009093 Ga0105240_10161539 Ga0105240_101615393 448
627 3300009101 Ga0105247_10005689 Ga0105247_100056894 448
628 3300009177 Ga0105248_10041383 Ga0105248_100413833 448
629 3300009553 Ga0105249_10006878 Ga0105249_100068785 448
630 3300009553 Ga0105249_10161194 Ga0105249_101611942 448
631 3300010375 Ga0105239_10000046 Ga0105239_10000046104 448
632 3300013297 Ga0157378_10000186 Ga0157378_1000018625 448
633 3300013306 Ga0163162_10003517 Ga0163162_1000351715 448
634 3300014968 Ga0157379_10013019 Ga0157379_100130196 448
635 3300025273 Ga0209673_1021143 Ga0209673_10211432 448
636 3300025295 Ga0209564_1004107 Ga0209564_10041077 448
637 3300025297 Ga0209758_1005889 Ga0209758_10058897 448
638 3300025900 Ga0207710_10024392 Ga0207710_100243924 448
639 3300025961 Ga0207712_10032767 Ga0207712_100327673 448
640 3300025961 Ga0207712_10045262 Ga0207712_100452622 448
641 3300025961 Ga0207712_10185611 Ga0207712_101856112 448
642 3300026095 Ga0207676_10058400 Ga0207676_100584003 448
643 3300026116 Ga0207674_10168020 Ga0207674_101680203 448
644 3300028381 Ga0268264_10007604 Ga0268264_100076045 448
645 3300036401 Ga0373937_0194698 Ga0373937_0194698_18_1364 448
646 3300048905 Ga0496102_0015429 Ga0496102_0015429_1165_2511 448
647 3300048909 Ga0496106_0056901 Ga0496106_0056901_1103_2449 448
648 3300050510 nmdc:mga06r32_94697_c1 nmdc:mga06r32_94697_c1_273_1619 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

91

222

0.92

PF04030

ALO

D-arabinono-1,4-lactone oxidase

357

492

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vfs-assembly1.cif.gz_A alditol oxidase from streptomyces coelicolor a3(2): complex with xylitol 0.9674 31 445
2vfs-assembly1.cif.gz_A alditol oxidase from streptomyces coelicolor a3(2): complex with xylitol 0.9582 31 445
6hfw-assembly2.cif.gz_B mycobacterium tuberculosis dpre1 in complex with cmp1 0.8045 29 444
3js8-assembly1.cif.gz_A solvent-stable cholesterol oxidase 0.8015 32 445
6hf3-assembly2.cif.gz_B m tuberculosis dpre1 in complex with a covalently bound nitrobenzothiazinone 0.7983 29 444
ID Description Score Start End Superfamily
2vfrA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9937 316 408 3.30.70.2520
2vfrA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9729 316 408 3.30.70.2520
af_P9WIT3_70_193_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9698 92 203 3.30.465.10
af_A4HXL3_75_196_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9688 92 203 3.30.465.10
2vfuA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9685 92 203 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A7S4HS62-F1-model_v4 D-arabinono-1,4-lactone oxidase C-terminal domain-containing protein 0.9866 325 448 GO:0003885
GO:0016020
GO:0080049
AF-A0A441XLM3-F1-model_v4 FAD-binding protein 0.9836 89 205 GO:0016899
GO:0071949
AF-A0A4Q7TJC3-F1-model_v4 Xylitol oxidase 0.981 32 444 GO:0003885
GO:0016020
GO:0071949
GO:0080049
AF-A0A2E9GEE2-F1-model_v4 deleted 0.9806 121 446
AF-A0A358D6V9-F1-model_v4 FAD-binding protein 0.9787 272 444 GO:0003885
GO:0016020
GO:0080049

Feature Viewer

pLDDT pTM Quality
91.82 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map