F472416
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 648 | 383 | 579 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300053157|Ga0500624_000735|Ga0500624_000735_2242_3735 |
| Length | 497 |
| Sequence | LKHADLGLPLLINEIIFKYLLIGYSGLLRKLNRFSFTLKLMLPCSNQSPMKRKTFIQLSTTLMATPLISPLSAWAQQPRLKNWAGNLTYSTANVQYPHSVLEVQQLVKKHNKLKALGTRHCFNTIADSKDDLVSTKEMNKVLSLDKKNHTVTVEGGIKYGELAPYLHQQGFALHNLASLPHISVAGSITTATHGSGIKNGNLASAVTGLELVIADGSIVNLSKAADHEKLNAAVVGLGALGIITKVTLQIQPTYMMRQRVFLNLPMAQLKPNFEQIVSAGYSVSLFTDWQSDSINEVWIKSRVDTEKDHDQPEFYGAKAAIKNLHPIIDHPAESCTEQMGVPGPWYERLPHFKMGFTPSSGKELQSEYFVPLHHAVEAITAVSRLGKQIGPHLFITEIRTIASDNLWLSTAHNQTSVAIHFTWKQETKAVLKLLPLIEQELAPFNARPHWGKVFTLDPKVLASRYEKLADFKKLAAAYDPHGKFRNEFLDHNIYGGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 2 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 3 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 4 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 5 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 6 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 7 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 8 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 9 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 10 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 11 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 12 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 13 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 14 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 15 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 16 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 17 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 18 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 19 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 20 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 21 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 22 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 23 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 24 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 25 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 26 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 27 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 28 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 29 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 30 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 31 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 32 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 33 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 34 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 35 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 36 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 37 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 38 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 39 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 40 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 41 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 42 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 43 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 44 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 45 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 46 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 47 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 48 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 49 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 50 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 51 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 52 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 53 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 54 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 55 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 56 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 57 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 58 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 59 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 60 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 61 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 62 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 63 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 64 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 65 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 66 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 67 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 68 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 69 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 70 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 71 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 72 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 75 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 78 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 101 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 117 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 118 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 119 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 120 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 121 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 128 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 129 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 132 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 133 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 167 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 235 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 236 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 253 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 254 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 257 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 260 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 375 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 376 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 377 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 378 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 379 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 380 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 381 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 382 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 383 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.58 |
| Metatranscriptomes | 0.62 |
| Isolates | 10.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.87 |
| Nodule | 1.39 |
| Rhizoplane | 4.01 |
| Rhizosphere | 73.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000858 | 3300001989 | Bacteria | 11208 |
| 2 | JGI24739J22299_10008425 | 3300001989 | Bacteria | 3852 |
| 3 | JGI24737J22298_10000955 | 3300001990 | Bacteria | 10257 |
| 4 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 5 | JGI25162J39368_1000011 | 3300002737 | Bacteria | 379156 |
| 6 | JGI25151J46595_10004677 | 3300003187 | Bacteria | 7198 |
| 7 | rootH1_10002347 | 3300003316 | Bacteria | 21999 |
| 8 | rootH1_10002347 | 3300003323 | Bacteria | 88814 |
| 9 | rootH1_10017736 | 3300003316 | Bacteria | 2773 |
| 10 | rootH1_10039056 | 3300003316 | Bacteria | 2591 |
| 11 | rootH2_10002741 | 3300003320 | Bacteria | 45461 |
| 12 | rootH2_10004991 | 3300003320 | Bacteria | 34166 |
| 13 | rootH2_10025850 | 3300003320 | Bacteria | 4083 |
| 14 | rootH2_10038272 | 3300003320 | Bacteria | 20840 |
| 15 | rootH2_10143909 | 3300003320 | Bacteria | 6450 |
| 16 | rootL2_10093281 | 3300003322 | Unclassified | 4072 |
| 17 | rootH1_10001540 | 3300003323 | Bacteria | 14395 |
| 18 | rootH1_10109173 | 3300003323 | Bacteria | 4059 |
| 19 | JGI25160J50197_1001139 | 3300003354 | Bacteria | 13593 |
| 20 | Ga0006562J51391_1071400 | 3300003578 | Bacteria | 17010 |
| 21 | Ga0006562J51391_1071403 | 3300003578 | Bacteria | 16080 |
| 22 | Ga0055524_1006795 | 3300003775 | Bacteria | 4933 |
| 23 | Ga0055528_1000122 | 3300003790 | Bacteria | 61910 |
| 24 | Ga0055528_1001795 | 3300003790 | Bacteria | 12305 |
| 25 | Ga0055528_1002851 | 3300003790 | Bacteria | 9022 |
| 26 | Ga0055528_1003222 | 3300003790 | Bacteria | 8324 |
| 27 | Ga0055530_10000192 | 3300003791 | Bacteria | 54681 |
| 28 | Ga0055531_10019370 | 3300003794 | Bacteria | 2755 |
| 29 | Ga0055541_1002280 | 3300003841 | Unclassified | 3872 |
| 30 | Ga0065165_1003174 | 3300005262 | Bacteria | 12041 |
| 31 | Ga0065165_1012860 | 3300005262 | Bacteria | 3374 |
| 32 | Ga0065714_10010493 | 3300005288 | Unclassified | 2726 |
| 33 | Ga0070658_10000034 | 3300005327 | Bacteria | 146880 |
| 34 | Ga0070658_10000047 | 3300005327 | Bacteria | 129483 |
| 35 | Ga0070658_10001322 | 3300005327 | Bacteria | 21137 |
| 36 | Ga0070658_10002721 | 3300005327 | Bacteria | 14705 |
| 37 | Ga0070676_10000144 | 3300005328 | Bacteria | 27905 |
| 38 | Ga0070676_10006110 | 3300005328 | Bacteria | 6430 |
| 39 | Ga0070670_100265759 | 3300005331 | Bacteria | 1496 |
| 40 | Ga0070680_100021522 | 3300005336 | Bacteria | 5126 |
| 41 | Ga0068868_100036359 | 3300005338 | Unclassified | 3811 |
| 42 | Ga0068868_100128119 | 3300005338 | Bacteria | 2075 |
| 43 | Ga0070660_100009617 | 3300005339 | Bacteria | 6810 |
| 44 | Ga0070660_100087869 | 3300005339 | Bacteria | 2447 |
| 45 | Ga0070691_10027901 | 3300005341 | Unclassified | 2635 |
| 46 | Ga0070661_100002750 | 3300005344 | Bacteria | 12061 |
| 47 | Ga0070668_100002405 | 3300005347 | Bacteria | 13772 |
| 48 | Ga0070668_100045181 | 3300005347 | Bacteria | 3380 |
| 49 | Ga0070669_100217025 | 3300005353 | Bacteria | 1511 |
| 50 | Ga0070675_100017991 | 3300005354 | Bacteria | 5624 |
| 51 | Ga0070671_100044019 | 3300005355 | Bacteria | 3709 |
| 52 | Ga0070674_100031040 | 3300005356 | Bacteria | 3537 |
| 53 | Ga0070673_100001562 | 3300005364 | Bacteria | 13484 |
| 54 | Ga0070673_100012206 | 3300005364 | Bacteria | 5891 |
| 55 | Ga0070688_100065175 | 3300005365 | Bacteria | 2314 |
| 56 | Ga0070659_100019639 | 3300005366 | Bacteria | 5125 |
| 57 | Ga0070659_100030542 | 3300005366 | Bacteria | 4170 |
| 58 | Ga0070659_100147535 | 3300005366 | Bacteria | 1917 |
| 59 | Ga0070667_100051446 | 3300005367 | Bacteria | 3473 |
| 60 | Ga0070713_100097439 | 3300005436 | Bacteria | 2541 |
| 61 | Ga0070710_10001643 | 3300005437 | Bacteria | 10572 |
| 62 | Ga0070710_10053126 | 3300005437 | Bacteria | 2281 |
| 63 | Ga0070663_100046458 | 3300005455 | Bacteria | 3072 |
| 64 | Ga0070662_100000083 | 3300005457 | Bacteria | 51358 |
| 65 | Ga0070662_100015272 | 3300005457 | Bacteria | 5140 |
| 66 | Ga0068867_100010471 | 3300005459 | Bacteria | 6544 |
| 67 | Ga0068867_100043022 | 3300005459 | Bacteria | 3306 |
| 68 | Ga0068867_100076784 | 3300005459 | Bacteria | 2509 |
| 69 | Ga0070706_100005308 | 3300005467 | Bacteria | 12283 |
| 70 | Ga0070699_100117412 | 3300005518 | Unclassified | 2338 |
| 71 | Ga0070699_100160725 | 3300005518 | Bacteria | 1988 |
| 72 | Ga0070679_100158139 | 3300005530 | Bacteria | 2241 |
| 73 | Ga0070684_100035133 | 3300005535 | Bacteria | 4288 |
| 74 | Ga0070697_100012295 | 3300005536 | Bacteria | 6705 |
| 75 | Ga0068853_100022176 | 3300005539 | Bacteria | 5300 |
| 76 | Ga0068853_100035432 | 3300005539 | Bacteria | 4239 |
| 77 | Ga0068853_100037054 | 3300005539 | Bacteria | 4148 |
| 78 | Ga0068853_100046898 | 3300005539 | Bacteria | 3707 |
| 79 | Ga0070672_100031014 | 3300005543 | Bacteria | 4021 |
| 80 | Ga0070695_100141681 | 3300005545 | Unclassified | 1668 |
| 81 | Ga0070693_100011560 | 3300005547 | Bacteria | 4449 |
| 82 | Ga0070665_100000267 | 3300005548 | Bacteria | 85526 |
| 83 | Ga0070665_100126608 | 3300005548 | Bacteria | 2557 |
| 84 | Ga0068855_100000033 | 3300005563 | Bacteria | 167299 |
| 85 | Ga0068855_100000387 | 3300005563 | Bacteria | 54152 |
| 86 | Ga0068855_100010601 | 3300005563 | Bacteria | 11111 |
| 87 | Ga0068855_100016717 | 3300005563 | Bacteria | 8823 |
| 88 | Ga0068855_100023962 | 3300005563 | Bacteria | 7307 |
| 89 | Ga0068855_100035988 | 3300005563 | Bacteria | 5895 |
| 90 | Ga0068855_100074648 | 3300005563 | Bacteria | 3938 |
| 91 | Ga0068855_100187813 | 3300005563 | Bacteria | 2333 |
| 92 | Ga0070664_100010434 | 3300005564 | Bacteria | 7532 |
| 93 | Ga0068857_100001667 | 3300005577 | Bacteria | 17833 |
| 94 | Ga0068857_100002243 | 3300005577 | Bacteria | 15733 |
| 95 | Ga0068857_100010188 | 3300005577 | Bacteria | 8171 |
| 96 | Ga0068857_100021646 | 3300005577 | Bacteria | 5657 |
| 97 | Ga0068854_100104675 | 3300005578 | Bacteria | 2126 |
| 98 | Ga0068854_100183734 | 3300005578 | Bacteria | 1635 |
| 99 | Ga0068854_100266146 | 3300005578 | Bacteria | 1374 |
| 100 | Ga0068856_100012578 | 3300005614 | Bacteria | 8191 |
| 101 | Ga0068856_100024372 | 3300005614 | Bacteria | 5888 |
| 102 | Ga0068856_100048542 | 3300005614 | Bacteria | 4184 |
| 103 | Ga0068856_100107333 | 3300005614 | Bacteria | 2787 |
| 104 | Ga0068856_100107858 | 3300005614 | Bacteria | 2781 |
| 105 | Ga0068852_100004913 | 3300005616 | Bacteria | 9492 |
| 106 | Ga0068852_100021679 | 3300005616 | Bacteria | 5137 |
| 107 | Ga0068859_100023128 | 3300005617 | Bacteria | 6234 |
| 108 | Ga0068859_100037581 | 3300005617 | Bacteria | 4859 |
| 109 | Ga0068859_100174595 | 3300005617 | Unclassified | 2231 |
| 110 | Ga0068864_100039737 | 3300005618 | Unclassified | 4021 |
| 111 | Ga0068861_100036963 | 3300005719 | Bacteria | 3628 |
| 112 | Ga0068851_10034675 | 3300005834 | Bacteria | 2519 |
| 113 | Ga0068858_100115785 | 3300005842 | Unclassified | 2505 |
| 114 | Ga0068860_100008334 | 3300005843 | Bacteria | 10316 |
| 115 | Ga0068862_100016290 | 3300005844 | Bacteria | 6184 |
| 116 | Ga0068862_100038325 | 3300005844 | Bacteria | 4065 |
| 117 | Ga0068862_100078361 | 3300005844 | Bacteria | 2863 |
| 118 | Ga0081455_10007021 | 3300005937 | Bacteria | 11960 |
| 119 | Ga0081538_10003633 | 3300005981 | Bacteria | 14501 |
| 120 | Ga0081540_1000176 | 3300005983 | Bacteria | 67057 |
| 121 | Ga0081539_10000314 | 3300005985 | Bacteria | 108451 |
| 122 | Ga0081539_10007233 | 3300005985 | Bacteria | 10203 |
| 123 | Ga0075367_10003541 | 3300006178 | Bacteria | 7469 |
| 124 | Ga0075366_10002535 | 3300006195 | Bacteria | 9392 |
| 125 | Ga0097621_100000259 | 3300006237 | Bacteria | 35593 |
| 126 | Ga0097621_100053048 | 3300006237 | Bacteria | 3304 |
| 127 | Ga0068871_100000824 | 3300006358 | Bacteria | 20776 |
| 128 | Ga0068871_100013546 | 3300006358 | Bacteria | 6053 |
| 129 | Ga0068871_100105153 | 3300006358 | Unclassified | 2368 |
| 130 | Ga0075428_100160792 | 3300006844 | Bacteria | 2438 |
| 131 | Ga0075431_100050550 | 3300006847 | Unclassified | 4286 |
| 132 | Ga0075431_100093275 | 3300006847 | Bacteria | 3107 |
| 133 | Ga0068865_100000492 | 3300006881 | Bacteria | 22165 |
| 134 | Ga0075436_100041614 | 3300006914 | Bacteria | 3170 |
| 135 | Ga0097620_100023128 | 3300006931 | Bacteria | 6234 |
| 136 | Ga0097620_100037579 | 3300006931 | Bacteria | 4859 |
| 137 | Ga0097620_100174576 | 3300006931 | Unclassified | 2231 |
| 138 | Ga0105240_10004820 | 3300009093 | Bacteria | 20332 |
| 139 | Ga0105240_10021463 | 3300009093 | Bacteria | 8587 |
| 140 | Ga0105240_10108054 | 3300009093 | Unclassified | 3371 |
| 141 | Ga0105240_10161539 | 3300009093 | Bacteria | 2661 |
| 142 | Ga0105240_10247714 | 3300009093 | Bacteria | 2062 |
| 143 | Ga0105240_10333699 | 3300009093 | Bacteria | 1725 |
| 144 | Ga0111539_10020817 | 3300009094 | Bacteria | 8076 |
| 145 | Ga0105245_10044462 | 3300009098 | Bacteria | 3964 |
| 146 | Ga0105245_10122021 | 3300009098 | Bacteria | 2435 |
| 147 | Ga0105247_10005689 | 3300009101 | Bacteria | 7811 |
| 148 | Ga0114129_10000363 | 3300009147 | Bacteria | 52419 |
| 149 | Ga0114129_10012826 | 3300009147 | Bacteria | 11927 |
| 150 | Ga0105243_10027581 | 3300009148 | Unclassified | 4352 |
| 151 | Ga0105243_10063838 | 3300009148 | Bacteria | 2953 |
| 152 | Ga0105243_10187893 | 3300009148 | Bacteria | 1802 |
| 153 | Ga0105241_10000786 | 3300009174 | Bacteria | 24114 |
| 154 | Ga0105241_10002347 | 3300009174 | Bacteria | 14220 |
| 155 | Ga0105241_10007925 | 3300009174 | Bacteria | 7810 |
| 156 | Ga0105242_10016460 | 3300009176 | Bacteria | 5749 |
| 157 | Ga0105248_10041383 | 3300009177 | Bacteria | 5165 |
| 158 | Ga0105248_10305140 | 3300009177 | Bacteria | 1793 |
| 159 | Ga0105237_10000168 | 3300009545 | Bacteria | 92212 |
| 160 | Ga0105237_10001170 | 3300009545 | Bacteria | 35066 |
| 161 | Ga0105237_10007518 | 3300009545 | Bacteria | 11914 |
| 162 | Ga0105237_10009320 | 3300009545 | Bacteria | 10517 |
| 163 | Ga0105237_10018980 | 3300009545 | Bacteria | 7106 |
| 164 | Ga0105238_10003025 | 3300009551 | Bacteria | 16777 |
| 165 | Ga0105238_10003233 | 3300009551 | Bacteria | 16278 |
| 166 | Ga0105238_10010786 | 3300009551 | Bacteria | 9181 |
| 167 | Ga0105238_10395541 | 3300009551 | Bacteria | 1375 |
| 168 | Ga0105249_10006878 | 3300009553 | Bacteria | 9917 |
| 169 | Ga0105249_10031409 | 3300009553 | Bacteria | 4804 |
| 170 | Ga0105249_10034065 | 3300009553 | Bacteria | 4613 |
| 171 | Ga0105249_10161194 | 3300009553 | Unclassified | 2168 |
| 172 | Ga0105239_10000046 | 3300010375 | Bacteria | 181115 |
| 173 | Ga0105239_10000691 | 3300010375 | Bacteria | 48085 |
| 174 | Ga0105239_10001174 | 3300010375 | Bacteria | 35994 |
| 175 | Ga0105239_10023559 | 3300010375 | Bacteria | 6781 |
| 176 | Ga0105239_10040793 | 3300010375 | Bacteria | 5086 |
| 177 | Ga0105239_10060910 | 3300010375 | Bacteria | 4143 |
| 178 | Ga0105239_10071808 | 3300010375 | Unclassified | 3803 |
| 179 | Ga0105239_10162442 | 3300010375 | Bacteria | 2496 |
| 180 | Ga0105246_10136194 | 3300011119 | Unclassified | 1841 |
| 181 | Ga0157373_10011815 | 3300013100 | Bacteria | 6414 |
| 182 | Ga0157373_10063604 | 3300013100 | Unclassified | 2612 |
| 183 | Ga0157371_10051266 | 3300013102 | Bacteria | 2933 |
| 184 | Ga0157370_10005157 | 3300013104 | Bacteria | 14730 |
| 185 | Ga0157370_10023885 | 3300013104 | Bacteria | 6062 |
| 186 | Ga0157370_10028181 | 3300013104 | Bacteria | 5528 |
| 187 | Ga0157370_10028589 | 3300013104 | Bacteria | 5482 |
| 188 | Ga0157369_10139471 | 3300013105 | Bacteria | 2566 |
| 189 | Ga0157369_10245482 | 3300013105 | Bacteria | 1869 |
| 190 | Ga0157374_10001231 | 3300013296 | Bacteria | 21878 |
| 191 | Ga0157374_10001437 | 3300013296 | Bacteria | 20134 |
| 192 | Ga0157374_10004828 | 3300013296 | Bacteria | 11312 |
| 193 | Ga0157378_10000186 | 3300013297 | Bacteria | 59580 |
| 194 | Ga0157378_10002879 | 3300013297 | Bacteria | 15314 |
| 195 | Ga0157378_10054570 | 3300013297 | Bacteria | 3558 |
| 196 | Ga0157378_10075294 | 3300013297 | Bacteria | 3039 |
| 197 | Ga0157378_10088068 | 3300013297 | Unclassified | 2817 |
| 198 | Ga0163162_10000074 | 3300013306 | Bacteria | 91138 |
| 199 | Ga0163162_10003517 | 3300013306 | Bacteria | 14983 |
| 200 | Ga0163162_10218570 | 3300013306 | Bacteria | 2035 |
| 201 | Ga0163162_10257129 | 3300013306 | Bacteria | 1878 |
| 202 | Ga0157372_10001527 | 3300013307 | Bacteria | 25162 |
| 203 | Ga0157372_10003673 | 3300013307 | Bacteria | 16500 |
| 204 | Ga0157372_10010851 | 3300013307 | Bacteria | 9698 |
| 205 | Ga0157372_10076564 | 3300013307 | Bacteria | 3777 |
| 206 | Ga0157372_10143908 | 3300013307 | Bacteria | 2749 |
| 207 | Ga0157375_10029531 | 3300013308 | Bacteria | 5158 |
| 208 | Ga0157375_10074030 | 3300013308 | Bacteria | 3426 |
| 209 | Ga0157375_10102767 | 3300013308 | Bacteria | 2944 |
| 210 | Ga0157375_10138993 | 3300013308 | Bacteria | 2554 |
| 211 | Ga0157375_10168871 | 3300013308 | Unclassified | 2334 |
| 212 | Ga0157380_10001405 | 3300014326 | Bacteria | 15733 |
| 213 | Ga0157377_10013191 | 3300014745 | Bacteria | 4178 |
| 214 | Ga0157379_10013019 | 3300014968 | Bacteria | 7282 |
| 215 | Ga0157379_10035219 | 3300014968 | Bacteria | 4463 |
| 216 | Ga0157376_10031040 | 3300014969 | Bacteria | 4273 |
| 217 | Ga0157376_10101232 | 3300014969 | Unclassified | 2517 |
| 218 | Ga0157376_10261567 | 3300014969 | Unclassified | 1621 |
| 219 | Ga0163161_10010871 | 3300017792 | Bacteria | 6309 |
| 220 | Ga0206353_10653945 | 3300020082 | Bacteria | 1430 |
| 221 | Ga0206353_11269176 | 3300020082 | Bacteria | 1557 |
| 222 | Ga0213875_10021391 | 3300021388 | Bacteria | 3099 |
| 223 | Ga0213875_10052474 | 3300021388 | Bacteria | 1910 |
| 224 | Ga0209784_100315 | 3300025224 | Bacteria | 25280 |
| 225 | Ga0209566_100160 | 3300025225 | Bacteria | 75483 |
| 226 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 227 | Ga0209129_1000285 | 3300025258 | Bacteria | 48259 |
| 228 | Ga0209129_1006025 | 3300025258 | Bacteria | 4067 |
| 229 | Ga0209455_1003623 | 3300025272 | Bacteria | 5374 |
| 230 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 231 | Ga0209673_1002627 | 3300025273 | Bacteria | 12065 |
| 232 | Ga0209673_1021143 | 3300025273 | Bacteria | 2284 |
| 233 | Ga0209025_1001792 | 3300025294 | Bacteria | 25500 |
| 234 | Ga0209025_1006333 | 3300025294 | Bacteria | 9228 |
| 235 | Ga0209025_1035782 | 3300025294 | Bacteria | 2236 |
| 236 | Ga0209564_1004107 | 3300025295 | Bacteria | 9155 |
| 237 | Ga0209564_1004859 | 3300025295 | Bacteria | 7985 |
| 238 | Ga0209564_1007535 | 3300025295 | Bacteria | 5606 |
| 239 | Ga0209758_1005889 | 3300025297 | Bacteria | 9142 |
| 240 | Ga0209758_1016045 | 3300025297 | Bacteria | 3829 |
| 241 | Ga0209256_1000603 | 3300025299 | Bacteria | 49871 |
| 242 | Ga0209256_1002359 | 3300025299 | Bacteria | 15682 |
| 243 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 244 | Ga0207426_1000394 | 3300025302 | Bacteria | 74327 |
| 245 | Ga0207692_10000114 | 3300025898 | Bacteria | 24131 |
| 246 | Ga0207692_10017773 | 3300025898 | Bacteria | 3177 |
| 247 | Ga0207710_10024392 | 3300025900 | Bacteria | 2604 |
| 248 | Ga0207647_10000098 | 3300025904 | Bacteria | 67170 |
| 249 | Ga0207647_10048582 | 3300025904 | Bacteria | 2634 |
| 250 | Ga0207647_10057991 | 3300025904 | Bacteria | 2372 |
| 251 | Ga0207645_10000185 | 3300025907 | Bacteria | 49988 |
| 252 | Ga0207645_10016572 | 3300025907 | Unclassified | 4875 |
| 253 | Ga0207643_10041849 | 3300025908 | Bacteria | 2582 |
| 254 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 255 | Ga0207705_10000048 | 3300025909 | Bacteria | 171848 |
| 256 | Ga0207705_10000052 | 3300025909 | Bacteria | 168319 |
| 257 | Ga0207705_10001239 | 3300025909 | Bacteria | 20528 |
| 258 | Ga0207705_10006268 | 3300025909 | Bacteria | 8834 |
| 259 | Ga0207705_10120079 | 3300025909 | Bacteria | 1950 |
| 260 | Ga0207684_10001098 | 3300025910 | Bacteria | 30303 |
| 261 | Ga0207654_10007450 | 3300025911 | Bacteria | 5511 |
| 262 | Ga0207654_10061419 | 3300025911 | Unclassified | 2199 |
| 263 | Ga0207654_10167190 | 3300025911 | Bacteria | 1425 |
| 264 | Ga0207707_10001640 | 3300025912 | Bacteria | 20648 |
| 265 | Ga0207695_10007354 | 3300025913 | Bacteria | 14053 |
| 266 | Ga0207695_10085411 | 3300025913 | Bacteria | 3185 |
| 267 | Ga0207671_10017817 | 3300025914 | Bacteria | 5464 |
| 268 | Ga0207671_10030572 | 3300025914 | Bacteria | 4015 |
| 269 | Ga0207671_10041005 | 3300025914 | Bacteria | 3426 |
| 270 | Ga0207657_10011825 | 3300025919 | Bacteria | 8641 |
| 271 | Ga0207657_10024359 | 3300025919 | Bacteria | 5608 |
| 272 | Ga0207657_10027110 | 3300025919 | Bacteria | 5252 |
| 273 | Ga0207657_10136053 | 3300025919 | Bacteria | 2010 |
| 274 | Ga0207649_10009213 | 3300025920 | Bacteria | 5398 |
| 275 | Ga0207652_10012140 | 3300025921 | Bacteria | 6960 |
| 276 | Ga0207652_10056866 | 3300025921 | Bacteria | 3368 |
| 277 | Ga0207694_10058881 | 3300025924 | Bacteria | 2988 |
| 278 | Ga0207664_10001655 | 3300025929 | Bacteria | 14675 |
| 279 | Ga0207690_10096893 | 3300025932 | Bacteria | 2098 |
| 280 | Ga0207690_10110219 | 3300025932 | Bacteria | 1981 |
| 281 | Ga0207706_10000176 | 3300025933 | Bacteria | 70917 |
| 282 | Ga0207706_10033783 | 3300025933 | Bacteria | 4552 |
| 283 | Ga0207706_10040297 | 3300025933 | Unclassified | 4140 |
| 284 | Ga0207706_10057545 | 3300025933 | Bacteria | 3424 |
| 285 | Ga0207686_10120669 | 3300025934 | Bacteria | 1784 |
| 286 | Ga0207669_10046608 | 3300025937 | Bacteria | 2563 |
| 287 | Ga0207704_10000055 | 3300025938 | Bacteria | 78858 |
| 288 | Ga0207691_10021434 | 3300025940 | Bacteria | 6101 |
| 289 | Ga0207661_10001552 | 3300025944 | Bacteria | 15630 |
| 290 | Ga0207661_10026636 | 3300025944 | Bacteria | 4408 |
| 291 | Ga0207679_10000698 | 3300025945 | Bacteria | 22446 |
| 292 | Ga0207667_10000046 | 3300025949 | Bacteria | 245420 |
| 293 | Ga0207667_10001788 | 3300025949 | Bacteria | 27052 |
| 294 | Ga0207667_10014403 | 3300025949 | Bacteria | 9019 |
| 295 | Ga0207667_10028130 | 3300025949 | Bacteria | 6107 |
| 296 | Ga0207667_10044710 | 3300025949 | Bacteria | 4691 |
| 297 | Ga0207667_10046262 | 3300025949 | Bacteria | 4608 |
| 298 | Ga0207667_10061022 | 3300025949 | Bacteria | 3946 |
| 299 | Ga0207667_10109753 | 3300025949 | Bacteria | 2845 |
| 300 | Ga0207667_10119828 | 3300025949 | Bacteria | 2712 |
| 301 | Ga0207712_10032767 | 3300025961 | Bacteria | 3509 |
| 302 | Ga0207712_10045262 | 3300025961 | Unclassified | 3046 |
| 303 | Ga0207712_10049816 | 3300025961 | Bacteria | 2921 |
| 304 | Ga0207712_10185611 | 3300025961 | Bacteria | 1637 |
| 305 | Ga0207668_10004502 | 3300025972 | Bacteria | 8191 |
| 306 | Ga0207640_10042170 | 3300025981 | Bacteria | 2908 |
| 307 | Ga0207640_10121230 | 3300025981 | Bacteria | 1874 |
| 308 | Ga0207640_10167721 | 3300025981 | Bacteria | 1632 |
| 309 | Ga0207677_10003225 | 3300026023 | Bacteria | 8610 |
| 310 | Ga0207639_10002131 | 3300026041 | Bacteria | 13323 |
| 311 | Ga0207639_10041146 | 3300026041 | Bacteria | 3455 |
| 312 | Ga0207639_10047294 | 3300026041 | Bacteria | 3251 |
| 313 | Ga0207678_10002430 | 3300026067 | Bacteria | 16931 |
| 314 | Ga0207678_10017456 | 3300026067 | Bacteria | 6304 |
| 315 | Ga0207678_10110615 | 3300026067 | Bacteria | 2344 |
| 316 | Ga0207702_10027939 | 3300026078 | Bacteria | 4688 |
| 317 | Ga0207702_10039591 | 3300026078 | Bacteria | 3951 |
| 318 | Ga0207702_10042042 | 3300026078 | Bacteria | 3833 |
| 319 | Ga0207648_10000775 | 3300026089 | Bacteria | 36025 |
| 320 | Ga0207648_10004402 | 3300026089 | Bacteria | 14469 |
| 321 | Ga0207648_10053372 | 3300026089 | Bacteria | 3533 |
| 322 | Ga0207648_10073349 | 3300026089 | Bacteria | 2983 |
| 323 | Ga0207676_10058400 | 3300026095 | Bacteria | 3043 |
| 324 | Ga0207674_10002306 | 3300026116 | Bacteria | 24173 |
| 325 | Ga0207674_10004034 | 3300026116 | Bacteria | 17814 |
| 326 | Ga0207674_10010609 | 3300026116 | Bacteria | 10422 |
| 327 | Ga0207674_10121147 | 3300026116 | Bacteria | 2584 |
| 328 | Ga0207674_10168020 | 3300026116 | Bacteria | 2147 |
| 329 | Ga0207675_100001143 | 3300026118 | Bacteria | 26301 |
| 330 | Ga0207683_10033313 | 3300026121 | Bacteria | 4475 |
| 331 | Ga0207683_10129343 | 3300026121 | Bacteria | 2270 |
| 332 | Ga0207698_10007539 | 3300026142 | Bacteria | 6819 |
| 333 | Ga0207428_10003584 | 3300027907 | Bacteria | 14987 |
| 334 | Ga0207428_10011294 | 3300027907 | Bacteria | 7909 |
| 335 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 336 | Ga0268266_10078736 | 3300028379 | Bacteria | 2869 |
| 337 | Ga0268265_10003622 | 3300028380 | Bacteria | 11027 |
| 338 | Ga0268264_10007604 | 3300028381 | Bacteria | 9033 |
| 339 | Ga0307517_10010105 | 3300028786 | Bacteria | 13262 |
| 340 | Ga0307515_10000218 | 3300028794 | Bacteria | 141810 |
| 341 | Ga0307515_10004345 | 3300028794 | Bacteria | 29399 |
| 342 | Ga0307515_10020770 | 3300028794 | Bacteria | 11687 |
| 343 | Ga0307515_10025103 | 3300028794 | Bacteria | 10334 |
| 344 | Ga0307515_10110197 | 3300028794 | Bacteria | 3225 |
| 345 | Ga0265338_10094269 | 3300028800 | Bacteria | 2463 |
| 346 | Ga0265338_10161769 | 3300028800 | Bacteria | 1728 |
| 347 | Ga0307511_10000263 | 3300030521 | Bacteria | 54309 |
| 348 | Ga0307513_10027356 | 3300031456 | Bacteria | 6551 |
| 349 | Ga0307513_10092225 | 3300031456 | Bacteria | 3084 |
| 350 | Ga0307509_10018420 | 3300031507 | Bacteria | 8007 |
| 351 | Ga0307408_100286411 | 3300031548 | Bacteria | 1374 |
| 352 | Ga0307508_10002097 | 3300031616 | Bacteria | 21434 |
| 353 | Ga0307514_10012444 | 3300031649 | Bacteria | 7079 |
| 354 | Ga0307516_10000645 | 3300031730 | Bacteria | 47214 |
| 355 | Ga0307410_10070846 | 3300031852 | Bacteria | 2416 |
| 356 | Ga0307410_10114124 | 3300031852 | Bacteria | 1960 |
| 357 | Ga0307406_10104701 | 3300031901 | Bacteria | 1934 |
| 358 | Ga0307409_100090698 | 3300031995 | Unclassified | 2503 |
| 359 | Ga0307416_100170224 | 3300032002 | Bacteria | 2026 |
| 360 | Ga0307416_100184418 | 3300032002 | Bacteria | 1960 |
| 361 | Ga0307411_10113699 | 3300032005 | Bacteria | 1943 |
| 362 | Ga0307507_10000309 | 3300033179 | Bacteria | 98028 |
| 363 | Ga0307507_10036864 | 3300033179 | Bacteria | 4989 |
| 364 | Ga0307510_10003612 | 3300033180 | Bacteria | 18058 |
| 365 | Ga0373956_0000100 | 3300035119 | Bacteria | 29550 |
| 366 | Ga0373955_0000036 | 3300035172 | Bacteria | 53100 |
| 367 | Ga0373942_0000988 | 3300035207 | Bacteria | 7727 |
| 368 | Ga0373924_0000141 | 3300035410 | Bacteria | 21018 |
| 369 | Ga0373927_0046299 | 3300035695 | Bacteria | 2814 |
| 370 | Ga0373933_0000003 | 3300035724 | Bacteria | 150420 |
| 371 | Ga0373937_0000016 | 3300036401 | Bacteria | 145523 |
| 372 | Ga0373937_0194698 | 3300036401 | Bacteria | 1905 |
| 373 | Ga0373925_0051500 | 3300037068 | Bacteria | 3073 |
| 374 | Ga0395899_0001160 | 3300037312 | Bacteria | 23301 |
| 375 | Ga0395899_0005413 | 3300037312 | Bacteria | 9914 |
| 376 | Ga0395900_0001002 | 3300037418 | Bacteria | 36638 |
| 377 | Ga0395900_0001549 | 3300037418 | Bacteria | 27320 |
| 378 | Ga0395900_0034028 | 3300037418 | Bacteria | 5245 |
| 379 | Ga0395898_0027333 | 3300037466 | Bacteria | 5730 |
| 380 | Ga0395905_0000520 | 3300037471 | Bacteria | 52744 |
| 381 | Ga0395905_0003309 | 3300037471 | Bacteria | 17296 |
| 382 | Ga0395905_0145154 | 3300037471 | Bacteria | 2233 |
| 383 | Ga0436364_1045843 | 3300037853 | Bacteria | 12100 |
| 384 | Ga0436364_1370368 | 3300037853 | Bacteria | 3833 |
| 385 | Ga0395901_0003411 | 3300038443 | Bacteria | 16009 |
| 386 | Ga0395901_0003486 | 3300038443 | Bacteria | 15853 |
| 387 | Ga0436365_0477741 | 3300039437 | Bacteria | 9398 |
| 388 | Ga0439436_0000254 | 3300041404 | Bacteria | 12747 |
| 389 | Ga0439439_0000573 | 3300041406 | Bacteria | 6422 |
| 390 | Ga0451789_0569920 | 3300041443 | Bacteria | 2158 |
| 391 | Ga0451853_0219621 | 3300041512 | Bacteria | 5306 |
| 392 | Ga0439433_0006833 | 3300041999 | Bacteria | 2459 |
| 393 | Ga0439442_016382 | 3300042002 | Bacteria | 1528 |
| 394 | Ga0439448_0002774 | 3300042005 | Bacteria | 4791 |
| 395 | Ga0439457_001494 | 3300042014 | Bacteria | 7010 |
| 396 | Ga0439457_015518 | 3300042014 | Bacteria | 1700 |
| 397 | Ga0439462_0002295 | 3300042015 | Bacteria | 4424 |
| 398 | Ga0466972_0001129 | 3300044658 | Bacteria | 12796 |
| 399 | Ga0466965_0000049 | 3300044683 | Bacteria | 41316 |
| 400 | Ga0466965_0005037 | 3300044683 | Bacteria | 5920 |
| 401 | Ga0466965_0044217 | 3300044683 | Bacteria | 2200 |
| 402 | Ga0466971_0019854 | 3300044719 | Bacteria | 2985 |
| 403 | Ga0466960_0001946 | 3300044901 | Bacteria | 7635 |
| 404 | Ga0466959_0005261 | 3300045049 | Bacteria | 8838 |
| 405 | Ga0466958_0024584 | 3300045836 | Bacteria | 3545 |
| 406 | Ga0466958_0025139 | 3300045836 | Bacteria | 3509 |
| 407 | Ga0466967_0083204 | 3300045976 | Bacteria | 2894 |
| 408 | Ga0495592_0000276 | 3300046454 | Bacteria | 43983 |
| 409 | Ga0495592_0132110 | 3300046454 | Bacteria | 1745 |
| 410 | Ga0495603_0064589 | 3300046455 | Bacteria | 2158 |
| 411 | Ga0495629_0058827 | 3300046459 | Bacteria | 2687 |
| 412 | Ga0495638_0105317 | 3300046460 | Bacteria | 1681 |
| 413 | Ga0495641_0022161 | 3300046461 | Bacteria | 3182 |
| 414 | Ga0495651_0000009 | 3300046462 | Bacteria | 150455 |
| 415 | Ga0495651_0007765 | 3300046462 | Bacteria | 8210 |
| 416 | Ga0495653_0091501 | 3300046463 | Bacteria | 2224 |
| 417 | Ga0495650_0000273 | 3300046471 | Bacteria | 98757 |
| 418 | Ga0495582_0047595 | 3300046473 | Bacteria | 2362 |
| 419 | Ga0495582_0070445 | 3300046473 | Bacteria | 1934 |
| 420 | Ga0495585_0000132 | 3300046492 | Bacteria | 80905 |
| 421 | Ga0495594_0018373 | 3300046499 | Bacteria | 3702 |
| 422 | Ga0495606_0000130 | 3300046507 | Bacteria | 127805 |
| 423 | Ga0495606_0001790 | 3300046507 | Bacteria | 27340 |
| 424 | Ga0495606_0003939 | 3300046507 | Bacteria | 15274 |
| 425 | Ga0495608_0000019 | 3300046511 | Bacteria | 180119 |
| 426 | Ga0495608_0047673 | 3300046511 | Bacteria | 2848 |
| 427 | Ga0495608_0126644 | 3300046511 | Bacteria | 1636 |
| 428 | Ga0495610_0002154 | 3300046512 | Bacteria | 16751 |
| 429 | Ga0495616_0017037 | 3300046513 | Bacteria | 4011 |
| 430 | Ga0495616_0026948 | 3300046513 | Bacteria | 3053 |
| 431 | Ga0495628_0001922 | 3300046516 | Bacteria | 18850 |
| 432 | Ga0495631_0002317 | 3300046518 | Bacteria | 10849 |
| 433 | Ga0495632_0001452 | 3300046519 | Bacteria | 19707 |
| 434 | Ga0495648_0040209 | 3300046524 | Bacteria | 2967 |
| 435 | Ga0495648_0045454 | 3300046524 | Bacteria | 2731 |
| 436 | Ga0495648_0069070 | 3300046524 | Bacteria | 2058 |
| 437 | Ga0495652_0000082 | 3300046529 | Bacteria | 102163 |
| 438 | Ga0495652_0001220 | 3300046529 | Bacteria | 28817 |
| 439 | Ga0495587_0001469 | 3300046536 | Bacteria | 15714 |
| 440 | Ga0495609_0024937 | 3300046538 | Bacteria | 2742 |
| 441 | Ga0495645_0065848 | 3300046543 | Bacteria | 2621 |
| 442 | Ga0495633_0000015 | 3300046558 | Bacteria | 254484 |
| 443 | Ga0495667_0001080 | 3300046559 | Bacteria | 17666 |
| 444 | Ga0495668_0000041 | 3300046616 | Bacteria | 229462 |
| 445 | Ga0495668_0000722 | 3300046616 | Bacteria | 39742 |
| 446 | Ga0495625_0000941 | 3300046660 | Bacteria | 39077 |
| 447 | Ga0495625_0001013 | 3300046660 | Bacteria | 37051 |
| 448 | Ga0495625_0001068 | 3300046660 | Bacteria | 35670 |
| 449 | Ga0495625_0007876 | 3300046660 | Bacteria | 9177 |
| 450 | Ga0495625_0029015 | 3300046660 | Bacteria | 4142 |
| 451 | Ga0495625_0029343 | 3300046660 | Bacteria | 4115 |
| 452 | Ga0495625_0136554 | 3300046660 | Bacteria | 1657 |
| 453 | Ga0495661_0001637 | 3300046665 | Bacteria | 18267 |
| 454 | Ga0495661_0032357 | 3300046665 | Unclassified | 3306 |
| 455 | Ga0495657_0000043 | 3300046675 | Bacteria | 114089 |
| 456 | Ga0495599_0000078 | 3300046678 | Bacteria | 67349 |
| 457 | Ga0495623_0000176 | 3300046679 | Bacteria | 40029 |
| 458 | Ga0495646_0025482 | 3300046680 | Bacteria | 3719 |
| 459 | Ga0495646_0028447 | 3300046680 | Bacteria | 3499 |
| 460 | Ga0495649_0000419 | 3300046694 | Bacteria | 36929 |
| 461 | Ga0495600_0001962 | 3300046809 | Bacteria | 11560 |
| 462 | Ga0495600_0044297 | 3300046809 | Bacteria | 2903 |
| 463 | Ga0495581_0035270 | 3300047315 | Bacteria | 2895 |
| 464 | Ga0495604_0000149 | 3300047317 | Bacteria | 60591 |
| 465 | Ga0495680_0000010 | 3300047322 | Bacteria | 142931 |
| 466 | Ga0495680_0119838 | 3300047322 | Bacteria | 1944 |
| 467 | Ga0495683_0051564 | 3300047323 | Bacteria | 2056 |
| 468 | Ga0495687_000413 | 3300047443 | Bacteria | 52876 |
| 469 | Ga0495687_002396 | 3300047443 | Bacteria | 15120 |
| 470 | Ga0495687_019158 | 3300047443 | Bacteria | 3365 |
| 471 | Ga0495675_0000385 | 3300047444 | Bacteria | 30543 |
| 472 | Ga0495684_0148941 | 3300047471 | Bacteria | 1751 |
| 473 | Ga0495686_0000039 | 3300047472 | Bacteria | 304821 |
| 474 | Ga0495686_0000097 | 3300047472 | Bacteria | 183450 |
| 475 | Ga0495686_0066493 | 3300047472 | Bacteria | 2227 |
| 476 | Ga0495602_0000109 | 3300048088 | Bacteria | 79404 |
| 477 | Ga0495614_0014816 | 3300048089 | Bacteria | 3408 |
| 478 | Ga0495626_0000495 | 3300048091 | Bacteria | 39669 |
| 479 | Ga0496101_0025618 | 3300048904 | Bacteria | 4093 |
| 480 | Ga0496102_0004083 | 3300048905 | Bacteria | 12377 |
| 481 | Ga0496102_0015429 | 3300048905 | Bacteria | 6655 |
| 482 | Ga0496102_0116973 | 3300048905 | Bacteria | 2488 |
| 483 | Ga0496103_0031517 | 3300048906 | Bacteria | 3230 |
| 484 | Ga0496104_0174646 | 3300048907 | Bacteria | 2059 |
| 485 | Ga0496105_0025977 | 3300048908 | Bacteria | 4772 |
| 486 | Ga0496106_0056901 | 3300048909 | Bacteria | 2957 |
| 487 | Ga0496107_0018294 | 3300048910 | Bacteria | 4933 |
| 488 | Ga0496108_0000015 | 3300048911 | Bacteria | 243282 |
| 489 | Ga0496108_0000411 | 3300048911 | Bacteria | 35165 |
| 490 | Ga0496108_0004717 | 3300048911 | Bacteria | 10993 |
| 491 | Ga0496108_0080330 | 3300048911 | Bacteria | 2762 |
| 492 | Ga0496108_0099012 | 3300048911 | Bacteria | 2485 |
| 493 | Ga0496109_0000029 | 3300048912 | Bacteria | 164675 |
| 494 | Ga0496109_0055419 | 3300048912 | Bacteria | 3617 |
| 495 | Ga0496109_0082189 | 3300048912 | Bacteria | 2968 |
| 496 | Ga0496110_0002477 | 3300048913 | Bacteria | 13833 |
| 497 | Ga0496110_0033092 | 3300048913 | Bacteria | 4470 |
| 498 | Ga0496111_0000619 | 3300048914 | Bacteria | 18786 |
| 499 | Ga0496112_0073587 | 3300048915 | Bacteria | 3378 |
| 500 | Ga0496114_0015268 | 3300048917 | Bacteria | 6174 |
| 501 | Ga0496114_0030971 | 3300048917 | Bacteria | 4401 |
| 502 | Ga0496114_0208544 | 3300048917 | Bacteria | 1713 |
| 503 | Ga0496121_0065153 | 3300048924 | Bacteria | 2966 |
| 504 | Ga0496121_0092321 | 3300048924 | Bacteria | 2360 |
| 505 | Ga0496122_0000360 | 3300048925 | Bacteria | 97913 |
| 506 | Ga0496122_0001293 | 3300048925 | Bacteria | 41500 |
| 507 | Ga0496122_0007604 | 3300048925 | Bacteria | 11976 |
| 508 | Ga0496123_0010350 | 3300048926 | Bacteria | 8258 |
| 509 | Ga0496124_0019119 | 3300048927 | Bacteria | 6392 |
| 510 | Ga0496124_0157627 | 3300048927 | Bacteria | 1773 |
| 511 | Ga0496125_0000015 | 3300048928 | Bacteria | 516648 |
| 512 | Ga0496125_0036180 | 3300048928 | Bacteria | 4316 |
| 513 | Ga0496126_0220285 | 3300048929 | Bacteria | 1594 |
| 514 | Ga0495678_011761 | 3300049459 | Bacteria | 4176 |
| 515 | Ga0501031_0028333 | 3300049568 | Bacteria | 3651 |
| 516 | Ga0501031_0060826 | 3300049568 | Bacteria | 2461 |
| 517 | Ga0501033_0004235 | 3300049570 | Bacteria | 11540 |
| 518 | Ga0501033_0016842 | 3300049570 | Bacteria | 5526 |
| 519 | Ga0501034_0009838 | 3300049571 | Bacteria | 9997 |
| 520 | Ga0501034_0100360 | 3300049571 | Bacteria | 2889 |
| 521 | Ga0501036_0002232 | 3300049572 | Bacteria | 15141 |
| 522 | Ga0501036_0026775 | 3300049572 | Bacteria | 4871 |
| 523 | Ga0501036_0074644 | 3300049572 | Bacteria | 2868 |
| 524 | Ga0501037_0012541 | 3300049573 | Bacteria | 6244 |
| 525 | Ga0501037_0061750 | 3300049573 | Bacteria | 2733 |
| 526 | Ga0501038_0084069 | 3300049574 | Bacteria | 2678 |
| 527 | Ga0501038_0146262 | 3300049574 | Bacteria | 1929 |
| 528 | Ga0501043_0143626 | 3300049579 | Bacteria | 1868 |
| 529 | Ga0501047_0049541 | 3300049581 | Bacteria | 4056 |
| 530 | Ga0501047_0056453 | 3300049581 | Bacteria | 3797 |
| 531 | Ga0501047_0189502 | 3300049581 | Bacteria | 1921 |
| 532 | Ga0501067_0031265 | 3300049583 | Bacteria | 2954 |
| 533 | Ga0501069_0053919 | 3300049585 | Bacteria | 2239 |
| 534 | Ga0501070_0002851 | 3300049586 | Bacteria | 15073 |
| 535 | Ga0501073_0060969 | 3300049589 | Bacteria | 2632 |
| 536 | Ga0501074_0002212 | 3300049590 | Bacteria | 13490 |
| 537 | Ga0501080_0011630 | 3300049742 | Bacteria | 8060 |
| 538 | Ga0501083_0062281 | 3300049744 | Bacteria | 2489 |
| 539 | Ga0501083_0087472 | 3300049744 | Bacteria | 2060 |
| 540 | Ga0501035_0003383 | 3300049822 | Bacteria | 15258 |
| 541 | Ga0501035_0004519 | 3300049822 | Bacteria | 13205 |
| 542 | Ga0501044_0011585 | 3300049823 | Bacteria | 9556 |
| 543 | Ga0501044_0040940 | 3300049823 | Bacteria | 4825 |
| 544 | nmdc:mga0k408_57_c1 | 3300050493 | Bacteria | 56021 |
| 545 | nmdc:mga04h51_11484_c1 | 3300050495 | Bacteria | 2459 |
| 546 | nmdc:mga07m45_145102_c1 | 3300050496 | Unclassified | 1375 |
| 547 | nmdc:mga05p37_4264_c2 | 3300050507 | Unclassified | 3357 |
| 548 | nmdc:mga05p37_55462_c1 | 3300050507 | Bacteria | 4877 |
| 549 | nmdc:mga05p37_9965_c1 | 3300050507 | Bacteria | 11286 |
| 550 | nmdc:mga09592_182559_c1 | 3300050508 | Unclassified | 1815 |
| 551 | nmdc:mga06r32_122481_c1 | 3300050510 | Unclassified | 2566 |
| 552 | nmdc:mga06r32_29327_c1 | 3300050510 | Bacteria | 5155 |
| 553 | nmdc:mga06r32_79114_c1 | 3300050510 | Bacteria | 3198 |
| 554 | nmdc:mga06r32_94697_c1 | 3300050510 | Bacteria | 2922 |
| 555 | nmdc:mga08y16_14258_c1 | 3300050511 | Bacteria | 8365 |
| 556 | nmdc:mga08y16_18743_c1 | 3300050511 | Bacteria | 7290 |
| 557 | nmdc:mga0n895_84023_c1 | 3300050512 | Bacteria | 3176 |
| 558 | nmdc:mga0a205_47266_c1 | 3300050515 | Bacteria | 4152 |
| 559 | Ga0495601_0001056 | 3300053077 | Bacteria | 15081 |
| 560 | Ga0495601_0006954 | 3300053077 | Bacteria | 6626 |
| 561 | Ga0495612_0040683 | 3300053078 | Bacteria | 1894 |
| 562 | Ga0495595_0000888 | 3300053084 | Bacteria | 11497 |
| 563 | Ga0495619_0131937 | 3300053085 | Bacteria | 1717 |
| 564 | Ga0500555_000250 | 3300053103 | Bacteria | 23584 |
| 565 | Ga0500608_000639 | 3300053122 | Bacteria | 12919 |
| 566 | Ga0500618_000013 | 3300053125 | Bacteria | 183026 |
| 567 | Ga0500618_005714 | 3300053125 | Bacteria | 3749 |
| 568 | Ga0500568_0000508 | 3300053139 | Bacteria | 28665 |
| 569 | Ga0500568_0002907 | 3300053139 | Bacteria | 9829 |
| 570 | Ga0500573_0021088 | 3300053140 | Bacteria | 3732 |
| 571 | Ga0500616_0000040 | 3300053153 | Bacteria | 367604 |
| 572 | Ga0500616_0000206 | 3300053153 | Bacteria | 96372 |
| 573 | Ga0500616_0000995 | 3300053153 | Bacteria | 30629 |
| 574 | Ga0500624_000735 | 3300053157 | Bacteria | 8076 |
| 575 | Ga0500645_000427 | 3300053730 | Bacteria | 29070 |
| 576 | Ga0501084_0069948 | 3300054114 | Bacteria | 2939 |
| 577 | Ga0501084_0099331 | 3300054114 | Bacteria | 2444 |
| 578 | Ga0501082_0052149 | 3300060353 | Bacteria | 3526 |
| 579 | Ga0466962_0003157 | 3300061719 | Bacteria | 7828 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_55462_c1 | nmdc:mga05p37_55462_c1_10_1020 | 329 |
| 2 | 3300046680 | Ga0495646_0028447 | Ga0495646_0028447_2476_3489 | 332 |
| 3 | 3300042002 | Ga0439442_016382 | Ga0439442_016382_461_1513 | 346 |
| 4 | iso_pu_bacteria | 2866065130 | 2866069758 | 354 |
| 5 | 3300047322 | Ga0495680_0119838 | Ga0495680_0119838_24_1154 | 355 |
| 6 | iso_pu_bacteria | 2895427314 | 2895437423 | 375 |
| 7 | 3300013104 | Ga0157370_10005157 | Ga0157370_1000515716 | 382 |
| 8 | 3300025904 | Ga0207647_10048582 | Ga0207647_100485822 | 382 |
| 9 | 3300044683 | Ga0466965_0044217 | Ga0466965_0044217_38_1240 | 382 |
| 10 | 3300005536 | Ga0070697_100012295 | Ga0070697_1000122953 | 383 |
| 11 | 3300025909 | Ga0207705_10120079 | Ga0207705_101200791 | 385 |
| 12 | 3300005262 | Ga0065165_1012860 | Ga0065165_10128601 | 388 |
| 13 | 3300028794 | Ga0307515_10110197 | Ga0307515_101101974 | 388 |
| 14 | 3300048907 | Ga0496104_0174646 | Ga0496104_0174646_501_1733 | 388 |
| 15 | 3300003187 | JGI25151J46595_10004677 | JGI25151J46595_100046777 | 389 |
| 16 | 3300025258 | Ga0209129_1000285 | Ga0209129_100028518 | 389 |
| 17 | 3300025294 | Ga0209025_1001792 | Ga0209025_100179232 | 389 |
| 18 | 3300025297 | Ga0209758_1016045 | Ga0209758_10160453 | 389 |
| 19 | 3300049742 | Ga0501080_0011630 | Ga0501080_0011630_4384_5589 | 389 |
| 20 | 3300003316 | rootH1_10039056 | rootH1_100390562 | 390 |
| 21 | 3300003790 | Ga0055528_1001795 | Ga0055528_100179516 | 390 |
| 22 | 3300003790 | Ga0055528_1002851 | Ga0055528_10028513 | 390 |
| 23 | 3300025273 | Ga0209673_1000041 | Ga0209673_1000041315 | 390 |
| 24 | 3300025294 | Ga0209025_1006333 | Ga0209025_10063333 | 390 |
| 25 | 3300025295 | Ga0209564_1004859 | Ga0209564_10048593 | 390 |
| 26 | 3300025299 | Ga0209256_1000603 | Ga0209256_100060349 | 390 |
| 27 | 3300009147 | Ga0114129_10000363 | Ga0114129_100003632 | 391 |
| 28 | iso_pu_bacteria | 2884693830 | 2884701746 | 391 |
| 29 | iso_pu_bacteria | 2895442618 | 2895446571 | 391 |
| 30 | 3300005518 | Ga0070699_100160725 | Ga0070699_1001607251 | 392 |
| 31 | 3300005539 | Ga0068853_100037054 | Ga0068853_1000370541 | 392 |
| 32 | 3300005563 | Ga0068855_100016717 | Ga0068855_1000167177 | 392 |
| 33 | 3300005577 | Ga0068857_100002243 | Ga0068857_10000224315 | 392 |
| 34 | 3300005616 | Ga0068852_100021679 | Ga0068852_1000216793 | 392 |
| 35 | 3300009093 | Ga0105240_10108054 | Ga0105240_101080544 | 392 |
| 36 | 3300009551 | Ga0105238_10003233 | Ga0105238_1000323316 | 392 |
| 37 | 3300013307 | Ga0157372_10003673 | Ga0157372_100036731 | 392 |
| 38 | 3300021388 | Ga0213875_10052474 | Ga0213875_100524742 | 392 |
| 39 | 3300025949 | Ga0207667_10014403 | Ga0207667_100144032 | 392 |
| 40 | 3300026041 | Ga0207639_10047294 | Ga0207639_100472942 | 392 |
| 41 | 3300026116 | Ga0207674_10010609 | Ga0207674_100106095 | 392 |
| 42 | 3300037853 | Ga0436364_1045843 | Ga0436364_1045843_2880_4127 | 392 |
| 43 | iso_pu_bacteria | 2675903060 | 2676496458 | 392 |
| 44 | 3300053077 | Ga0495601_0001056 | Ga0495601_0001056_2034_3290 | 393 |
| 45 | 3300005437 | Ga0070710_10001643 | Ga0070710_100016432 | 394 |
| 46 | 3300005548 | Ga0070665_100126608 | Ga0070665_1001266082 | 394 |
| 47 | 3300025898 | Ga0207692_10000114 | Ga0207692_100001143 | 394 |
| 48 | 3300028379 | Ga0268266_10078736 | Ga0268266_100787362 | 394 |
| 49 | 3300044658 | Ga0466972_0001129 | Ga0466972_0001129_7123_8325 | 394 |
| 50 | 3300044683 | Ga0466965_0005037 | Ga0466965_0005037_3334_4536 | 394 |
| 51 | 3300044901 | Ga0466960_0001946 | Ga0466960_0001946_2049_3251 | 394 |
| 52 | 3300049744 | Ga0501083_0087472 | Ga0501083_0087472_98_1345 | 394 |
| 53 | 3300048911 | Ga0496108_0000411 | Ga0496108_0000411_23263_24534 | 396 |
| 54 | 3300041512 | Ga0451853_0219621 | Ga0451853_0219621_2115_3338 | 398 |
| 55 | 3300046455 | Ga0495603_0064589 | Ga0495603_0064589_657_1976 | 399 |
| 56 | 3300046462 | Ga0495651_0007765 | Ga0495651_0007765_3266_4522 | 399 |
| 57 | 3300048911 | Ga0496108_0099012 | Ga0496108_0099012_269_1543 | 399 |
| 58 | 3300005436 | Ga0070713_100097439 | Ga0070713_1000974392 | 400 |
| 59 | 3300025929 | Ga0207664_10001655 | Ga0207664_100016555 | 400 |
| 60 | 3300048911 | Ga0496108_0080330 | Ga0496108_0080330_283_1491 | 400 |
| 61 | 3300049744 | Ga0501083_0062281 | Ga0501083_0062281_57_1334 | 401 |
| 62 | 3300054114 | Ga0501084_0069948 | Ga0501084_0069948_624_1874 | 401 |
| 63 | 3300060353 | Ga0501082_0052149 | Ga0501082_0052149_628_1878 | 401 |
| 64 | 3300026116 | Ga0207674_10121147 | Ga0207674_101211472 | 402 |
| 65 | 3300033179 | Ga0307507_10036864 | Ga0307507_100368643 | 402 |
| 66 | 3300003323 | rootH1_10001540 | rootH1_100015404 | 403 |
| 67 | 3300035207 | Ga0373942_0000988 | Ga0373942_0000988_5662_6903 | 403 |
| 68 | 3300046524 | Ga0495648_0069070 | Ga0495648_0069070_72_1283 | 403 |
| 69 | iso_pu_bacteria | 2852643534 | 2852645731 | 403 |
| 70 | iso_pu_bacteria | 2857733635 | 2857733647 | 403 |
| 71 | 3300005347 | Ga0070668_100002405 | Ga0070668_1000024056 | 404 |
| 72 | 3300005353 | Ga0070669_100217025 | Ga0070669_1002170251 | 404 |
| 73 | 3300005844 | Ga0068862_100038325 | Ga0068862_1000383254 | 404 |
| 74 | 3300025972 | Ga0207668_10004502 | Ga0207668_100045025 | 404 |
| 75 | 3300031456 | Ga0307513_10027356 | Ga0307513_100273563 | 404 |
| 76 | 3300045836 | Ga0466958_0024584 | Ga0466958_0024584_1799_3025 | 404 |
| 77 | iso_pu_bacteria | 2643221546 | 2643753878 | 404 |
| 78 | iso_pu_bacteria | 2831935698 | 2831936529 | 404 |
| 79 | iso_pu_bacteria | 2832004796 | 2832009923 | 404 |
| 80 | 3300048925 | Ga0496122_0000360 | Ga0496122_0000360_72514_73743 | 405 |
| 81 | 3300048926 | Ga0496123_0010350 | Ga0496123_0010350_6070_7299 | 405 |
| 82 | iso_pu_bacteria | 2513237088 | 2513596525 | 405 |
| 83 | iso_pu_bacteria | 2582581304 | 2585257869 | 405 |
| 84 | iso_pu_bacteria | 2582581867 | 2585402346 | 405 |
| 85 | iso_pu_bacteria | 2585427590 | 2585822967 | 405 |
| 86 | iso_pu_bacteria | 2643221567 | 2643851249 | 405 |
| 87 | iso_pu_bacteria | 2643221624 | 2644138120 | 405 |
| 88 | iso_pu_bacteria | 2643221632 | 2644182080 | 405 |
| 89 | iso_pu_bacteria | 2947224130 | 2947226020 | 405 |
| 90 | iso_pu_bacteria | 2990059506 | 2990067870 | 405 |
| 91 | iso_pu_bacteria | 2996887358 | 2996888986 | 405 |
| 92 | iso_pu_bacteria | 8005321885 | 8005323513 | 405 |
| 93 | 3300005356 | Ga0070674_100031040 | Ga0070674_1000310401 | 406 |
| 94 | 3300005367 | Ga0070667_100051446 | Ga0070667_1000514462 | 406 |
| 95 | 3300005985 | Ga0081539_10007233 | Ga0081539_100072335 | 406 |
| 96 | 3300028794 | Ga0307515_10000218 | Ga0307515_1000021896 | 406 |
| 97 | 3300031616 | Ga0307508_10002097 | Ga0307508_1000209716 | 406 |
| 98 | 3300031730 | Ga0307516_10000645 | Ga0307516_1000064542 | 406 |
| 99 | 3300048911 | Ga0496108_0000015 | Ga0496108_0000015_142060_143307 | 406 |
| 100 | 3300049568 | Ga0501031_0060826 | Ga0501031_0060826_54_1337 | 406 |
| 101 | 3300049574 | Ga0501038_0146262 | Ga0501038_0146262_507_1790 | 406 |
| 102 | 3300049583 | Ga0501067_0031265 | Ga0501067_0031265_577_1860 | 406 |
| 103 | 3300049589 | Ga0501073_0060969 | Ga0501073_0060969_201_1484 | 406 |
| 104 | 3300053140 | Ga0500573_0021088 | Ga0500573_0021088_1536_2804 | 406 |
| 105 | 3300053153 | Ga0500616_0000995 | Ga0500616_0000995_22886_24166 | 406 |
| 106 | iso_pu_bacteria | 2784132109 | 2784471055 | 406 |
| 107 | iso_pu_bacteria | 2895660088 | 2895662660 | 406 |
| 108 | 3300005467 | Ga0070706_100005308 | Ga0070706_10000530811 | 407 |
| 109 | 3300047472 | Ga0495686_0066493 | Ga0495686_0066493_565_1806 | 407 |
| 110 | 3300048908 | Ga0496105_0025977 | Ga0496105_0025977_2530_3777 | 407 |
| 111 | 3300048912 | Ga0496109_0055419 | Ga0496109_0055419_1792_3039 | 407 |
| 112 | 3300048915 | Ga0496112_0073587 | Ga0496112_0073587_621_1868 | 407 |
| 113 | iso_pu_bacteria | 2811994879 | 2812355122 | 407 |
| 114 | iso_pu_bacteria | 2887478801 | 2887486212 | 407 |
| 115 | iso_pu_bacteria | 2939657138 | 2939659557 | 407 |
| 116 | iso_pu_bacteria | 2946064051 | 2946070773 | 407 |
| 117 | iso_pu_bacteria | 2996221748 | 2996223497 | 407 |
| 118 | 3300003578 | Ga0006562J51391_1071400 | Ga0006562J51391_107140013 | 408 |
| 119 | 3300003578 | Ga0006562J51391_1071403 | Ga0006562J51391_10714032 | 408 |
| 120 | 3300003775 | Ga0055524_1006795 | Ga0055524_10067954 | 408 |
| 121 | 3300003790 | Ga0055528_1003222 | Ga0055528_10032225 | 408 |
| 122 | 3300005347 | Ga0070668_100045181 | Ga0070668_1000451813 | 408 |
| 123 | 3300005355 | Ga0070671_100044019 | Ga0070671_1000440192 | 408 |
| 124 | 3300025258 | Ga0209129_1006025 | Ga0209129_10060253 | 408 |
| 125 | 3300025273 | Ga0209673_1002627 | Ga0209673_10026277 | 408 |
| 126 | 3300025294 | Ga0209025_1035782 | Ga0209025_10357822 | 408 |
| 127 | 3300025295 | Ga0209564_1007535 | Ga0209564_10075352 | 408 |
| 128 | 3300025299 | Ga0209256_1002359 | Ga0209256_100235915 | 408 |
| 129 | 3300025302 | Ga0207426_1000394 | Ga0207426_100039449 | 408 |
| 130 | 3300028794 | Ga0307515_10025103 | Ga0307515_100251039 | 408 |
| 131 | 3300028800 | Ga0265338_10094269 | Ga0265338_100942693 | 408 |
| 132 | 3300046507 | Ga0495606_0003939 | Ga0495606_0003939_2115_3362 | 408 |
| 133 | 3300046519 | Ga0495632_0001452 | Ga0495632_0001452_7818_9065 | 408 |
| 134 | 3300048906 | Ga0496103_0031517 | Ga0496103_0031517_450_1697 | 408 |
| 135 | 3300048924 | Ga0496121_0065153 | Ga0496121_0065153_361_1608 | 408 |
| 136 | 3300048924 | Ga0496121_0092321 | Ga0496121_0092321_336_1583 | 408 |
| 137 | 3300048927 | Ga0496124_0019119 | Ga0496124_0019119_3676_4929 | 408 |
| 138 | 3300048927 | Ga0496124_0157627 | Ga0496124_0157627_421_1674 | 408 |
| 139 | 3300048929 | Ga0496126_0220285 | Ga0496126_0220285_161_1414 | 408 |
| 140 | 3300049570 | Ga0501033_0004235 | Ga0501033_0004235_8815_10059 | 408 |
| 141 | 3300049571 | Ga0501034_0009838 | Ga0501034_0009838_3520_4764 | 408 |
| 142 | 3300049572 | Ga0501036_0002232 | Ga0501036_0002232_4758_6002 | 408 |
| 143 | 3300049572 | Ga0501036_0026775 | Ga0501036_0026775_901_2145 | 408 |
| 144 | 3300049574 | Ga0501038_0084069 | Ga0501038_0084069_592_1836 | 408 |
| 145 | 3300049581 | Ga0501047_0049541 | Ga0501047_0049541_868_2112 | 408 |
| 146 | 3300049585 | Ga0501069_0053919 | Ga0501069_0053919_772_2016 | 408 |
| 147 | 3300049586 | Ga0501070_0002851 | Ga0501070_0002851_4089_5333 | 408 |
| 148 | 3300049590 | Ga0501074_0002212 | Ga0501074_0002212_2663_3907 | 408 |
| 149 | 3300049822 | Ga0501035_0004519 | Ga0501035_0004519_10480_11724 | 408 |
| 150 | 3300053125 | Ga0500618_005714 | Ga0500618_005714_13_1266 | 408 |
| 151 | iso_pu_bacteria | 2643221690 | 2644505049 | 408 |
| 152 | iso_pu_bacteria | 2643221694 | 2644527377 | 408 |
| 153 | iso_pu_bacteria | 2643221722 | 2644667559 | 408 |
| 154 | 3300005518 | Ga0070699_100117412 | Ga0070699_1001174122 | 409 |
| 155 | 3300005614 | Ga0068856_100107333 | Ga0068856_1001073332 | 409 |
| 156 | 3300005985 | Ga0081539_10000314 | Ga0081539_1000031426 | 409 |
| 157 | 3300041443 | Ga0451789_0569920 | Ga0451789_0569920_838_2082 | 409 |
| 158 | 3300045976 | Ga0466967_0083204 | Ga0466967_0083204_900_2141 | 409 |
| 159 | 3300046461 | Ga0495641_0022161 | Ga0495641_0022161_1587_2846 | 409 |
| 160 | 3300049568 | Ga0501031_0028333 | Ga0501031_0028333_372_1721 | 409 |
| 161 | 3300049570 | Ga0501033_0016842 | Ga0501033_0016842_111_1460 | 409 |
| 162 | 3300049571 | Ga0501034_0100360 | Ga0501034_0100360_667_2016 | 409 |
| 163 | 3300049572 | Ga0501036_0074644 | Ga0501036_0074644_933_2282 | 409 |
| 164 | 3300049573 | Ga0501037_0061750 | Ga0501037_0061750_837_2186 | 409 |
| 165 | 3300049581 | Ga0501047_0056453 | Ga0501047_0056453_1377_2726 | 409 |
| 166 | 3300049822 | Ga0501035_0003383 | Ga0501035_0003383_66_1415 | 409 |
| 167 | 3300049823 | Ga0501044_0011585 | Ga0501044_0011585_540_1889 | 409 |
| 168 | 3300005437 | Ga0070710_10053126 | Ga0070710_100531261 | 410 |
| 169 | 3300009551 | Ga0105238_10010786 | Ga0105238_100107865 | 410 |
| 170 | 3300025898 | Ga0207692_10017773 | Ga0207692_100177732 | 410 |
| 171 | 3300031456 | Ga0307513_10092225 | Ga0307513_100922252 | 410 |
| 172 | 3300049581 | Ga0501047_0189502 | Ga0501047_0189502_208_1458 | 410 |
| 173 | iso_pu_bacteria | 2643221572 | 2643877796 | 410 |
| 174 | iso_pu_bacteria | 2643221669 | 2644384851 | 410 |
| 175 | iso_pu_bacteria | 2747842429 | 2747954409 | 410 |
| 176 | iso_pu_bacteria | 2935409751 | 2935410531 | 410 |
| 177 | iso_pu_bacteria | 2946033335 | 2946036125 | 410 |
| 178 | 3300005577 | Ga0068857_100010188 | Ga0068857_1000101882 | 411 |
| 179 | 3300005981 | Ga0081538_10003633 | Ga0081538_100036332 | 411 |
| 180 | 3300009551 | Ga0105238_10395541 | Ga0105238_103955412 | 411 |
| 181 | 3300013308 | Ga0157375_10074030 | Ga0157375_100740305 | 411 |
| 182 | 3300021388 | Ga0213875_10021391 | Ga0213875_100213911 | 411 |
| 183 | 3300031548 | Ga0307408_100286411 | Ga0307408_1002864111 | 411 |
| 184 | 3300031852 | Ga0307410_10070846 | Ga0307410_100708462 | 411 |
| 185 | 3300032002 | Ga0307416_100170224 | Ga0307416_1001702243 | 411 |
| 186 | 3300032002 | Ga0307416_100184418 | Ga0307416_1001844182 | 411 |
| 187 | 3300032005 | Ga0307411_10113699 | Ga0307411_101136991 | 411 |
| 188 | 3300041404 | Ga0439436_0000254 | Ga0439436_0000254_10643_11899 | 411 |
| 189 | 3300041406 | Ga0439439_0000573 | Ga0439439_0000573_4302_5558 | 411 |
| 190 | 3300041999 | Ga0439433_0006833 | Ga0439433_0006833_689_1945 | 411 |
| 191 | 3300042014 | Ga0439457_001494 | Ga0439457_001494_3024_4280 | 411 |
| 192 | 3300042015 | Ga0439462_0002295 | Ga0439462_0002295_2544_3800 | 411 |
| 193 | 3300046507 | Ga0495606_0001790 | Ga0495606_0001790_71_1330 | 411 |
| 194 | 3300046616 | Ga0495668_0000722 | Ga0495668_0000722_38322_39581 | 411 |
| 195 | 3300047323 | Ga0495683_0051564 | Ga0495683_0051564_667_1926 | 411 |
| 196 | 3300048091 | Ga0495626_0000495 | Ga0495626_0000495_38305_39564 | 411 |
| 197 | 3300048925 | Ga0496122_0001293 | Ga0496122_0001293_37331_38593 | 411 |
| 198 | 3300048928 | Ga0496125_0000015 | Ga0496125_0000015_205260_206522 | 411 |
| 199 | 3300049823 | Ga0501044_0040940 | Ga0501044_0040940_3314_4588 | 411 |
| 200 | 3300053139 | Ga0500568_0000508 | Ga0500568_0000508_8785_10047 | 411 |
| 201 | iso_pu_bacteria | 2811994880 | 2812362336 | 411 |
| 202 | iso_pu_bacteria | 2884994152 | 2884994364 | 411 |
| 203 | iso_pu_bacteria | 8025530807 | 8025533313 | 411 |
| 204 | 3300031507 | Ga0307509_10018420 | Ga0307509_100184205 | 412 |
| 205 | 3300031901 | Ga0307406_10104701 | Ga0307406_101047011 | 412 |
| 206 | 3300044683 | Ga0466965_0000049 | Ga0466965_0000049_23878_25143 | 412 |
| 207 | 3300046529 | Ga0495652_0001220 | Ga0495652_0001220_344_1600 | 412 |
| 208 | 3300046809 | Ga0495600_0044297 | Ga0495600_0044297_493_1749 | 412 |
| 209 | 3300048928 | Ga0496125_0036180 | Ga0496125_0036180_745_2004 | 412 |
| 210 | 3300053077 | Ga0495601_0006954 | Ga0495601_0006954_5158_6414 | 412 |
| 211 | 3300053078 | Ga0495612_0040683 | Ga0495612_0040683_101_1357 | 412 |
| 212 | iso_pu_bacteria | 8057345674 | 8057346031 | 412 |
| 213 | 3300009098 | Ga0105245_10044462 | Ga0105245_100444621 | 413 |
| 214 | 3300013306 | Ga0163162_10218570 | Ga0163162_102185703 | 413 |
| 215 | 3300013308 | Ga0157375_10138993 | Ga0157375_101389933 | 413 |
| 216 | 3300014969 | Ga0157376_10101232 | Ga0157376_101012323 | 413 |
| 217 | 3300025934 | Ga0207686_10120669 | Ga0207686_101206692 | 413 |
| 218 | 3300005834 | Ga0068851_10034675 | Ga0068851_100346753 | 414 |
| 219 | 3300013307 | Ga0157372_10076564 | Ga0157372_100765642 | 414 |
| 220 | 3300020082 | Ga0206353_10653945 | Ga0206353_106539451 | 414 |
| 221 | 3300025919 | Ga0207657_10024359 | Ga0207657_100243593 | 414 |
| 222 | 3300037853 | Ga0436364_1370368 | Ga0436364_1370368_556_1857 | 414 |
| 223 | 3300049579 | Ga0501043_0143626 | Ga0501043_0143626_358_1641 | 414 |
| 224 | iso_pu_bacteria | 2721755702 | 2723641100 | 414 |
| 225 | iso_pu_bacteria | 2855676851 | 2855678044 | 414 |
| 226 | iso_pu_bacteria | 2857288857 | 2857291361 | 414 |
| 227 | iso_pu_bacteria | 2858848962 | 2858848991 | 414 |
| 228 | iso_pu_bacteria | 2858882152 | 2858886471 | 414 |
| 229 | iso_pu_bacteria | 2858888857 | 2858893954 | 414 |
| 230 | iso_pu_bacteria | 2858895516 | 2858902364 | 414 |
| 231 | iso_pu_bacteria | 2869048445 | 2869051246 | 414 |
| 232 | iso_pu_bacteria | 2869061728 | 2869066577 | 414 |
| 233 | iso_pu_bacteria | 2869068681 | 2869072019 | 414 |
| 234 | iso_pu_bacteria | 2880489317 | 2880489414 | 414 |
| 235 | iso_pu_bacteria | 2880495981 | 2880496302 | 414 |
| 236 | iso_pu_bacteria | 2929226422 | 2929232097 | 414 |
| 237 | iso_pu_bacteria | 8054704163 | 8054705382 | 414 |
| 238 | iso_pu_bacteria | 8054727385 | 8054729683 | 414 |
| 239 | iso_pu_bacteria | 8054734606 | 8054739237 | 414 |
| 240 | 3300003320 | rootH2_10025850 | rootH2_100258504 | 415 |
| 241 | 3300005327 | Ga0070658_10002721 | Ga0070658_1000272112 | 415 |
| 242 | 3300005336 | Ga0070680_100021522 | Ga0070680_1000215222 | 415 |
| 243 | 3300010375 | Ga0105239_10162442 | Ga0105239_101624422 | 415 |
| 244 | 3300025909 | Ga0207705_10000048 | Ga0207705_10000048114 | 415 |
| 245 | 3300025909 | Ga0207705_10001239 | Ga0207705_1000123921 | 415 |
| 246 | 3300025944 | Ga0207661_10026636 | Ga0207661_100266362 | 415 |
| 247 | 3300031649 | Ga0307514_10012444 | Ga0307514_100124443 | 415 |
| 248 | 3300048925 | Ga0496122_0007604 | Ga0496122_0007604_3358_4629 | 415 |
| 249 | 3300053153 | Ga0500616_0000040 | Ga0500616_0000040_281274_282545 | 415 |
| 250 | iso_pu_bacteria | 2857472729 | 2857473807 | 415 |
| 251 | iso_pu_bacteria | 2888578766 | 2888581506 | 415 |
| 252 | iso_pu_bacteria | 2929219909 | 2929224958 | 415 |
| 253 | iso_pu_bacteria | 8003830390 | 8003837020 | 415 |
| 254 | 3300009148 | Ga0105243_10187893 | Ga0105243_101878931 | 416 |
| 255 | 3300042005 | Ga0439448_0002774 | Ga0439448_0002774_950_2230 | 416 |
| 256 | 3300046499 | Ga0495594_0018373 | Ga0495594_0018373_906_2165 | 416 |
| 257 | 3300005327 | Ga0070658_10000034 | Ga0070658_1000003426 | 417 |
| 258 | 3300005339 | Ga0070660_100087869 | Ga0070660_1000878692 | 417 |
| 259 | 3300005455 | Ga0070663_100046458 | Ga0070663_1000464581 | 417 |
| 260 | 3300005563 | Ga0068855_100023962 | Ga0068855_1000239623 | 417 |
| 261 | 3300005563 | Ga0068855_100187813 | Ga0068855_1001878132 | 417 |
| 262 | 3300005983 | Ga0081540_1000176 | Ga0081540_100017638 | 417 |
| 263 | 3300013104 | Ga0157370_10023885 | Ga0157370_100238856 | 417 |
| 264 | 3300013104 | Ga0157370_10028589 | Ga0157370_100285891 | 417 |
| 265 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001299 | 417 |
| 266 | 3300025919 | Ga0207657_10136053 | Ga0207657_101360533 | 417 |
| 267 | 3300025932 | Ga0207690_10110219 | Ga0207690_101102192 | 417 |
| 268 | 3300025949 | Ga0207667_10046262 | Ga0207667_100462624 | 417 |
| 269 | 3300025949 | Ga0207667_10109753 | Ga0207667_101097531 | 417 |
| 270 | 3300026067 | Ga0207678_10002430 | Ga0207678_100024306 | 417 |
| 271 | 3300026067 | Ga0207678_10110615 | Ga0207678_101106152 | 417 |
| 272 | 3300035119 | Ga0373956_0000100 | Ga0373956_0000100_13882_15150 | 417 |
| 273 | 3300035172 | Ga0373955_0000036 | Ga0373955_0000036_13838_15106 | 417 |
| 274 | 3300035410 | Ga0373924_0000141 | Ga0373924_0000141_19647_20915 | 417 |
| 275 | 3300035724 | Ga0373933_0000003 | Ga0373933_0000003_14415_15683 | 417 |
| 276 | 3300036401 | Ga0373937_0000016 | Ga0373937_0000016_128945_130213 | 417 |
| 277 | 3300046454 | Ga0495592_0000276 | Ga0495592_0000276_960_2228 | 417 |
| 278 | 3300046462 | Ga0495651_0000009 | Ga0495651_0000009_14447_15715 | 417 |
| 279 | 3300046463 | Ga0495653_0091501 | Ga0495653_0091501_933_2201 | 417 |
| 280 | 3300046511 | Ga0495608_0000019 | Ga0495608_0000019_44111_45379 | 417 |
| 281 | 3300046511 | Ga0495608_0126644 | Ga0495608_0126644_28_1308 | 417 |
| 282 | 3300046516 | Ga0495628_0001922 | Ga0495628_0001922_14440_15708 | 417 |
| 283 | 3300046529 | Ga0495652_0000082 | Ga0495652_0000082_15311_16579 | 417 |
| 284 | 3300046536 | Ga0495587_0001469 | Ga0495587_0001469_12_1280 | 417 |
| 285 | 3300046543 | Ga0495645_0065848 | Ga0495645_0065848_1221_2507 | 417 |
| 286 | 3300046559 | Ga0495667_0001080 | Ga0495667_0001080_1088_2356 | 417 |
| 287 | 3300046675 | Ga0495657_0000043 | Ga0495657_0000043_55889_57157 | 417 |
| 288 | 3300046678 | Ga0495599_0000078 | Ga0495599_0000078_52177_53445 | 417 |
| 289 | 3300046679 | Ga0495623_0000176 | Ga0495623_0000176_14424_15692 | 417 |
| 290 | 3300046680 | Ga0495646_0025482 | Ga0495646_0025482_515_1783 | 417 |
| 291 | 3300046809 | Ga0495600_0001962 | Ga0495600_0001962_8497_9765 | 417 |
| 292 | 3300047317 | Ga0495604_0000149 | Ga0495604_0000149_45429_46697 | 417 |
| 293 | 3300047322 | Ga0495680_0000010 | Ga0495680_0000010_134735_136003 | 417 |
| 294 | 3300047444 | Ga0495675_0000385 | Ga0495675_0000385_7158_8426 | 417 |
| 295 | 3300048088 | Ga0495602_0000109 | Ga0495602_0000109_14447_15715 | 417 |
| 296 | 3300048905 | Ga0496102_0004083 | Ga0496102_0004083_6306_7586 | 417 |
| 297 | 3300048911 | Ga0496108_0004717 | Ga0496108_0004717_9108_10388 | 417 |
| 298 | 3300048912 | Ga0496109_0082189 | Ga0496109_0082189_606_1886 | 417 |
| 299 | 3300048913 | Ga0496110_0002477 | Ga0496110_0002477_9949_11229 | 417 |
| 300 | 3300048914 | Ga0496111_0000619 | Ga0496111_0000619_10360_11640 | 417 |
| 301 | 3300048917 | Ga0496114_0015268 | Ga0496114_0015268_4774_6054 | 417 |
| 302 | 3300053084 | Ga0495595_0000888 | Ga0495595_0000888_39_1307 | 417 |
| 303 | 3300053085 | Ga0495619_0131937 | Ga0495619_0131937_419_1687 | 417 |
| 304 | 3300003323 | rootH1_10109173 | rootH1_101091734 | 418 |
| 305 | 3300009098 | Ga0105245_10122021 | Ga0105245_101220213 | 418 |
| 306 | 3300009148 | Ga0105243_10063838 | Ga0105243_100638383 | 418 |
| 307 | 3300009176 | Ga0105242_10016460 | Ga0105242_100164603 | 418 |
| 308 | 3300009177 | Ga0105248_10305140 | Ga0105248_103051402 | 418 |
| 309 | 3300013297 | Ga0157378_10002879 | Ga0157378_1000287912 | 418 |
| 310 | 3300025224 | Ga0209784_100315 | Ga0209784_1003157 | 418 |
| 311 | 3300025937 | Ga0207669_10046608 | Ga0207669_100466082 | 418 |
| 312 | 3300025981 | Ga0207640_10121230 | Ga0207640_101212301 | 418 |
| 313 | 3300026089 | Ga0207648_10004402 | Ga0207648_1000440216 | 418 |
| 314 | 3300026121 | Ga0207683_10129343 | Ga0207683_101293432 | 418 |
| 315 | 3300048904 | Ga0496101_0025618 | Ga0496101_0025618_882_2141 | 418 |
| 316 | 3300048910 | Ga0496107_0018294 | Ga0496107_0018294_1035_2294 | 418 |
| 317 | 3300048913 | Ga0496110_0033092 | Ga0496110_0033092_3093_4352 | 418 |
| 318 | iso_pu_bacteria | 8003870546 | 8003875888 | 418 |
| 319 | 3300005578 | Ga0068854_100266146 | Ga0068854_1002661461 | 419 |
| 320 | 3300006914 | Ga0075436_100041614 | Ga0075436_1000416144 | 419 |
| 321 | 3300009147 | Ga0114129_10012826 | Ga0114129_1001282610 | 419 |
| 322 | 3300050507 | nmdc:mga05p37_9965_c1 | nmdc:mga05p37_9965_c1_8296_9573 | 419 |
| 323 | 3300050515 | nmdc:mga0a205_47266_c1 | nmdc:mga0a205_47266_c1_2228_3505 | 419 |
| 324 | 3300005578 | Ga0068854_100183734 | Ga0068854_1001837342 | 420 |
| 325 | 3300025910 | Ga0207684_10001098 | Ga0207684_100010981 | 420 |
| 326 | 3300025981 | Ga0207640_10167721 | Ga0207640_101677212 | 420 |
| 327 | 3300037068 | Ga0373925_0051500 | Ga0373925_0051500_365_1642 | 420 |
| 328 | 3300044719 | Ga0466971_0019854 | Ga0466971_0019854_1024_2286 | 420 |
| 329 | 3300045049 | Ga0466959_0005261 | Ga0466959_0005261_6088_7350 | 420 |
| 330 | 3300045836 | Ga0466958_0025139 | Ga0466958_0025139_1098_2360 | 420 |
| 331 | 3300048905 | Ga0496102_0116973 | Ga0496102_0116973_1021_2310 | 420 |
| 332 | 3300048917 | Ga0496114_0208544 | Ga0496114_0208544_394_1683 | 420 |
| 333 | 3300061719 | Ga0466962_0003157 | Ga0466962_0003157_220_1482 | 420 |
| 334 | iso_pu_bacteria | 2912757875 | 2912763989 | 420 |
| 335 | 3300025909 | Ga0207705_10006268 | Ga0207705_100062682 | 421 |
| 336 | 3300042014 | Ga0439457_015518 | Ga0439457_015518_49_1332 | 421 |
| 337 | 3300031995 | Ga0307409_100090698 | Ga0307409_1000906983 | 422 |
| 338 | 3300046459 | Ga0495629_0058827 | Ga0495629_0058827_752_2047 | 422 |
| 339 | 3300046473 | Ga0495582_0070445 | Ga0495582_0070445_561_1856 | 422 |
| 340 | 3300047315 | Ga0495581_0035270 | Ga0495581_0035270_204_1499 | 422 |
| 341 | 3300048917 | Ga0496114_0030971 | Ga0496114_0030971_1477_2772 | 422 |
| 342 | 3300013105 | Ga0157369_10139471 | Ga0157369_101394712 | 423 |
| 343 | iso_pu_bacteria | 2858902515 | 2858907664 | 423 |
| 344 | iso_pu_bacteria | 8055412473 | 8055415063 | 424 |
| 345 | 3300003316 | rootH1_10002347 | rootH1_1000234719 | 425 |
| 346 | 3300003322 | rootL2_10093281 | rootL2_100932817 | 425 |
| 347 | 3300003354 | JGI25160J50197_1001139 | JGI25160J50197_100113910 | 425 |
| 348 | 3300003841 | Ga0055541_1002280 | Ga0055541_10022803 | 425 |
| 349 | 3300014969 | Ga0157376_10031040 | Ga0157376_100310405 | 425 |
| 350 | 3300025225 | Ga0209566_100160 | Ga0209566_10016022 | 425 |
| 351 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002266 | 425 |
| 352 | 3300050496 | nmdc:mga07m45_145102_c1 | nmdc:mga07m45_145102_c1_44_1327 | 425 |
| 353 | 3300053139 | Ga0500568_0002907 | Ga0500568_0002907_3615_4898 | 425 |
| 354 | 3300005328 | Ga0070676_10006110 | Ga0070676_100061104 | 426 |
| 355 | 3300026067 | Ga0207678_10017456 | Ga0207678_100174566 | 426 |
| 356 | iso_pu_bacteria | 8005258706 | 8005260357 | 426 |
| 357 | 3300005530 | Ga0070679_100158139 | Ga0070679_1001581391 | 427 |
| 358 | 3300025921 | Ga0207652_10056866 | Ga0207652_100568662 | 427 |
| 359 | 3300025932 | Ga0207690_10096893 | Ga0207690_100968931 | 427 |
| 360 | 3300025949 | Ga0207667_10044710 | Ga0207667_100447102 | 427 |
| 361 | 3300046460 | Ga0495638_0105317 | Ga0495638_0105317_160_1572 | 427 |
| 362 | 3300046473 | Ga0495582_0047595 | Ga0495582_0047595_817_2163 | 429 |
| 363 | 3300046558 | Ga0495633_0000015 | Ga0495633_0000015_153243_154625 | 430 |
| 364 | iso_pu_bacteria | 2599185184 | 2599477160 | 430 |
| 365 | 3300005366 | Ga0070659_100019639 | Ga0070659_1000196394 | 431 |
| 366 | 3300025919 | Ga0207657_10011825 | Ga0207657_100118253 | 431 |
| 367 | 3300025981 | Ga0207640_10042170 | Ga0207640_100421702 | 431 |
| 368 | 3300031852 | Ga0307410_10114124 | Ga0307410_101141242 | 431 |
| 369 | 3300005539 | Ga0068853_100046898 | Ga0068853_1000468981 | 432 |
| 370 | 3300005563 | Ga0068855_100010601 | Ga0068855_1000106015 | 432 |
| 371 | 3300006358 | Ga0068871_100105153 | Ga0068871_1001051532 | 432 |
| 372 | 3300013308 | Ga0157375_10102767 | Ga0157375_101027672 | 432 |
| 373 | 3300014969 | Ga0157376_10261567 | Ga0157376_102615671 | 432 |
| 374 | 3300025911 | Ga0207654_10167190 | Ga0207654_101671902 | 432 |
| 375 | 3300025914 | Ga0207671_10017817 | Ga0207671_100178175 | 432 |
| 376 | 3300025949 | Ga0207667_10119828 | Ga0207667_101198282 | 432 |
| 377 | 3300033180 | Ga0307510_10003612 | Ga0307510_1000361212 | 432 |
| 378 | 3300046511 | Ga0495608_0047673 | Ga0495608_0047673_1517_2827 | 432 |
| 379 | 3300002737 | JGI25162J39368_1000011 | JGI25162J39368_100001150 | 433 |
| 380 | 3300005327 | Ga0070658_10000047 | Ga0070658_10000047100 | 433 |
| 381 | 3300005339 | Ga0070660_100009617 | Ga0070660_1000096172 | 433 |
| 382 | 3300005539 | Ga0068853_100022176 | Ga0068853_1000221762 | 433 |
| 383 | 3300005563 | Ga0068855_100000387 | Ga0068855_10000038716 | 433 |
| 384 | 3300005614 | Ga0068856_100107858 | Ga0068856_1001078582 | 433 |
| 385 | 3300025233 | Ga0209437_100017 | Ga0209437_100017213 | 433 |
| 386 | 3300025272 | Ga0209455_1003623 | Ga0209455_10036233 | 433 |
| 387 | 3300025909 | Ga0207705_10000052 | Ga0207705_10000052101 | 433 |
| 388 | 3300025914 | Ga0207671_10030572 | Ga0207671_100305721 | 433 |
| 389 | 3300025914 | Ga0207671_10041005 | Ga0207671_100410053 | 433 |
| 390 | 3300025919 | Ga0207657_10027110 | Ga0207657_100271104 | 433 |
| 391 | 3300025949 | Ga0207667_10001788 | Ga0207667_1000178814 | 433 |
| 392 | 3300028786 | Ga0307517_10010105 | Ga0307517_100101051 | 433 |
| 393 | 3300046518 | Ga0495631_0002317 | Ga0495631_0002317_9166_10470 | 433 |
| 394 | 3300046660 | Ga0495625_0029015 | Ga0495625_0029015_2661_3965 | 433 |
| 395 | 3300053122 | Ga0500608_000639 | Ga0500608_000639_8033_9337 | 433 |
| 396 | 3300001989 | JGI24739J22299_10008425 | JGI24739J22299_100084251 | 434 |
| 397 | 3300001990 | JGI24737J22298_10000955 | JGI24737J22298_100009557 | 434 |
| 398 | 3300002067 | JGI24735J21928_10000001 | JGI24735J21928_10000001470 | 434 |
| 399 | 3300005341 | Ga0070691_10027901 | Ga0070691_100279012 | 434 |
| 400 | 3300005547 | Ga0070693_100011560 | Ga0070693_1000115603 | 434 |
| 401 | 3300005563 | Ga0068855_100074648 | Ga0068855_1000746483 | 434 |
| 402 | 3300005614 | Ga0068856_100012578 | Ga0068856_1000125782 | 434 |
| 403 | 3300025911 | Ga0207654_10061419 | Ga0207654_100614193 | 434 |
| 404 | 3300025912 | Ga0207707_10001640 | Ga0207707_1000164018 | 434 |
| 405 | 3300025913 | Ga0207695_10085411 | Ga0207695_100854112 | 434 |
| 406 | 3300025921 | Ga0207652_10012140 | Ga0207652_100121403 | 434 |
| 407 | 3300025949 | Ga0207667_10061022 | Ga0207667_100610223 | 434 |
| 408 | 3300026078 | Ga0207702_10042042 | Ga0207702_100420423 | 434 |
| 409 | 3300003320 | rootH2_10002741 | rootH2_1000274122 | 435 |
| 410 | 3300009553 | Ga0105249_10031409 | Ga0105249_100314094 | 435 |
| 411 | 3300020082 | Ga0206353_11269176 | Ga0206353_112691762 | 435 |
| 412 | 3300025924 | Ga0207694_10058881 | Ga0207694_100588813 | 435 |
| 413 | 3300003320 | rootH2_10038272 | rootH2_1003827214 | 436 |
| 414 | 3300005614 | Ga0068856_100048542 | Ga0068856_1000485422 | 436 |
| 415 | 3300013307 | Ga0157372_10010851 | Ga0157372_100108513 | 436 |
| 416 | 3300026078 | Ga0207702_10039591 | Ga0207702_100395912 | 436 |
| 417 | 3300053153 | Ga0500616_0000206 | Ga0500616_0000206_43549_44868 | 437 |
| 418 | 3300003316 | rootH1_10017736 | rootH1_100177362 | 438 |
| 419 | 3300053103 | Ga0500555_000250 | Ga0500555_000250_18995_20317 | 438 |
| 420 | 3300053730 | Ga0500645_000427 | Ga0500645_000427_8082_9404 | 438 |
| 421 | 3300005288 | Ga0065714_10010493 | Ga0065714_100104932 | 439 |
| 422 | 3300025904 | Ga0207647_10057991 | Ga0207647_100579913 | 439 |
| 423 | 3300039437 | Ga0436365_0477741 | Ga0436365_0477741_7739_9088 | 440 |
| 424 | 3300005338 | Ga0068868_100036359 | Ga0068868_1000363593 | 443 |
| 425 | 3300005617 | Ga0068859_100174595 | Ga0068859_1001745953 | 443 |
| 426 | 3300006931 | Ga0097620_100174576 | Ga0097620_1001745763 | 443 |
| 427 | 3300013297 | Ga0157378_10088068 | Ga0157378_100880682 | 443 |
| 428 | 3300025907 | Ga0207645_10016572 | Ga0207645_100165726 | 443 |
| 429 | 3300025933 | Ga0207706_10040297 | Ga0207706_100402974 | 443 |
| 430 | iso_pu_bacteria | 2919437846 | 2919440847 | 443 |
| 431 | iso_pu_bacteria | 2928078545 | 2928079074 | 443 |
| 432 | iso_pu_bacteria | 2928147474 | 2928148556 | 443 |
| 433 | iso_pu_bacteria | 2932082852 | 2932085850 | 443 |
| 434 | 3300005344 | Ga0070661_100002750 | Ga0070661_10000275012 | 444 |
| 435 | 3300005366 | Ga0070659_100030542 | Ga0070659_1000305423 | 444 |
| 436 | 3300005535 | Ga0070684_100035133 | Ga0070684_1000351333 | 444 |
| 437 | 3300005539 | Ga0068853_100035432 | Ga0068853_1000354323 | 444 |
| 438 | 3300005545 | Ga0070695_100141681 | Ga0070695_1001416811 | 444 |
| 439 | 3300005564 | Ga0070664_100010434 | Ga0070664_1000104345 | 444 |
| 440 | 3300005577 | Ga0068857_100001667 | Ga0068857_1000016673 | 444 |
| 441 | 3300013100 | Ga0157373_10011815 | Ga0157373_100118153 | 444 |
| 442 | 3300025920 | Ga0207649_10009213 | Ga0207649_100092133 | 444 |
| 443 | 3300025944 | Ga0207661_10001552 | Ga0207661_100015523 | 444 |
| 444 | 3300025945 | Ga0207679_10000698 | Ga0207679_100006983 | 444 |
| 445 | 3300026041 | Ga0207639_10002131 | Ga0207639_100021313 | 444 |
| 446 | 3300026116 | Ga0207674_10004034 | Ga0207674_1000403415 | 444 |
| 447 | 3300005328 | Ga0070676_10000144 | Ga0070676_1000014418 | 445 |
| 448 | 3300005338 | Ga0068868_100128119 | Ga0068868_1001281192 | 445 |
| 449 | 3300005364 | Ga0070673_100001562 | Ga0070673_1000015629 | 445 |
| 450 | 3300005459 | Ga0068867_100010471 | Ga0068867_1000104715 | 445 |
| 451 | 3300005459 | Ga0068867_100076784 | Ga0068867_1000767842 | 445 |
| 452 | 3300005548 | Ga0070665_100000267 | Ga0070665_10000026764 | 445 |
| 453 | 3300005616 | Ga0068852_100004913 | Ga0068852_1000049132 | 445 |
| 454 | 3300006237 | Ga0097621_100000259 | Ga0097621_10000025933 | 445 |
| 455 | 3300006237 | Ga0097621_100053048 | Ga0097621_1000530483 | 445 |
| 456 | 3300006358 | Ga0068871_100000824 | Ga0068871_10000082412 | 445 |
| 457 | 3300006358 | Ga0068871_100013546 | Ga0068871_1000135463 | 445 |
| 458 | 3300006881 | Ga0068865_100000492 | Ga0068865_10000049211 | 445 |
| 459 | 3300009093 | Ga0105240_10004820 | Ga0105240_1000482011 | 445 |
| 460 | 3300009093 | Ga0105240_10247714 | Ga0105240_102477141 | 445 |
| 461 | 3300009148 | Ga0105243_10027581 | Ga0105243_100275812 | 445 |
| 462 | 3300009174 | Ga0105241_10007925 | Ga0105241_100079255 | 445 |
| 463 | 3300009545 | Ga0105237_10000168 | Ga0105237_100001688 | 445 |
| 464 | 3300009545 | Ga0105237_10001170 | Ga0105237_1000117016 | 445 |
| 465 | 3300009551 | Ga0105238_10003025 | Ga0105238_100030257 | 445 |
| 466 | 3300010375 | Ga0105239_10023559 | Ga0105239_100235593 | 445 |
| 467 | 3300010375 | Ga0105239_10060910 | Ga0105239_100609102 | 445 |
| 468 | 3300013296 | Ga0157374_10001437 | Ga0157374_1000143710 | 445 |
| 469 | 3300013297 | Ga0157378_10054570 | Ga0157378_100545703 | 445 |
| 470 | 3300013297 | Ga0157378_10075294 | Ga0157378_100752942 | 445 |
| 471 | 3300013306 | Ga0163162_10000074 | Ga0163162_100000749 | 445 |
| 472 | 3300014968 | Ga0157379_10035219 | Ga0157379_100352192 | 445 |
| 473 | 3300025907 | Ga0207645_10000185 | Ga0207645_1000018533 | 445 |
| 474 | 3300025908 | Ga0207643_10041849 | Ga0207643_100418491 | 445 |
| 475 | 3300025913 | Ga0207695_10007354 | Ga0207695_100073545 | 445 |
| 476 | 3300025938 | Ga0207704_10000055 | Ga0207704_1000005510 | 445 |
| 477 | 3300026023 | Ga0207677_10003225 | Ga0207677_100032253 | 445 |
| 478 | 3300026041 | Ga0207639_10041146 | Ga0207639_100411462 | 445 |
| 479 | 3300026089 | Ga0207648_10000775 | Ga0207648_100007752 | 445 |
| 480 | 3300026089 | Ga0207648_10073349 | Ga0207648_100733492 | 445 |
| 481 | 3300026121 | Ga0207683_10033313 | Ga0207683_100333133 | 445 |
| 482 | 3300026142 | Ga0207698_10007539 | Ga0207698_100075395 | 445 |
| 483 | 3300028379 | Ga0268266_10000018 | Ga0268266_10000018469 | 445 |
| 484 | 3300035695 | Ga0373927_0046299 | Ga0373927_0046299_89_1435 | 445 |
| 485 | 3300046454 | Ga0495592_0132110 | Ga0495592_0132110_133_1482 | 445 |
| 486 | 3300047471 | Ga0495684_0148941 | Ga0495684_0148941_55_1404 | 445 |
| 487 | 3300003320 | rootH2_10004991 | rootH2_1000499124 | 446 |
| 488 | 3300005457 | Ga0070662_100000083 | Ga0070662_10000008341 | 446 |
| 489 | 3300005563 | Ga0068855_100035988 | Ga0068855_1000359887 | 446 |
| 490 | 3300005614 | Ga0068856_100024372 | Ga0068856_1000243722 | 446 |
| 491 | 3300005842 | Ga0068858_100115785 | Ga0068858_1001157852 | 446 |
| 492 | 3300005937 | Ga0081455_10007021 | Ga0081455_100070218 | 446 |
| 493 | 3300006178 | Ga0075367_10003541 | Ga0075367_100035412 | 446 |
| 494 | 3300006195 | Ga0075366_10002535 | Ga0075366_100025356 | 446 |
| 495 | 3300006847 | Ga0075431_100050550 | Ga0075431_1000505503 | 446 |
| 496 | 3300006847 | Ga0075431_100093275 | Ga0075431_1000932753 | 446 |
| 497 | 3300009093 | Ga0105240_10333699 | Ga0105240_103336992 | 446 |
| 498 | 3300009174 | Ga0105241_10002347 | Ga0105241_100023473 | 446 |
| 499 | 3300009545 | Ga0105237_10007518 | Ga0105237_100075187 | 446 |
| 500 | 3300009545 | Ga0105237_10009320 | Ga0105237_100093207 | 446 |
| 501 | 3300009545 | Ga0105237_10018980 | Ga0105237_100189806 | 446 |
| 502 | 3300009553 | Ga0105249_10034065 | Ga0105249_100340653 | 446 |
| 503 | 3300010375 | Ga0105239_10000691 | Ga0105239_100006916 | 446 |
| 504 | 3300010375 | Ga0105239_10001174 | Ga0105239_1000117426 | 446 |
| 505 | 3300010375 | Ga0105239_10040793 | Ga0105239_100407934 | 446 |
| 506 | 3300010375 | Ga0105239_10071808 | Ga0105239_100718082 | 446 |
| 507 | 3300011119 | Ga0105246_10136194 | Ga0105246_101361942 | 446 |
| 508 | 3300013100 | Ga0157373_10063604 | Ga0157373_100636042 | 446 |
| 509 | 3300013296 | Ga0157374_10001231 | Ga0157374_1000123110 | 446 |
| 510 | 3300013296 | Ga0157374_10004828 | Ga0157374_100048284 | 446 |
| 511 | 3300013308 | Ga0157375_10029531 | Ga0157375_100295314 | 446 |
| 512 | 3300017792 | Ga0163161_10010871 | Ga0163161_100108713 | 446 |
| 513 | 3300025904 | Ga0207647_10000098 | Ga0207647_1000009836 | 446 |
| 514 | 3300025911 | Ga0207654_10007450 | Ga0207654_100074504 | 446 |
| 515 | 3300025933 | Ga0207706_10000176 | Ga0207706_1000017639 | 446 |
| 516 | 3300025933 | Ga0207706_10057545 | Ga0207706_100575452 | 446 |
| 517 | 3300025949 | Ga0207667_10028130 | Ga0207667_100281302 | 446 |
| 518 | 3300026078 | Ga0207702_10027939 | Ga0207702_100279394 | 446 |
| 519 | 3300027907 | Ga0207428_10003584 | Ga0207428_100035842 | 446 |
| 520 | 3300028794 | Ga0307515_10004345 | Ga0307515_1000434524 | 446 |
| 521 | 3300028794 | Ga0307515_10020770 | Ga0307515_100207706 | 446 |
| 522 | 3300028800 | Ga0265338_10161769 | Ga0265338_101617691 | 446 |
| 523 | 3300030521 | Ga0307511_10000263 | Ga0307511_1000026322 | 446 |
| 524 | 3300033179 | Ga0307507_10000309 | Ga0307507_1000030977 | 446 |
| 525 | 3300037312 | Ga0395899_0001160 | Ga0395899_0001160_16504_17883 | 446 |
| 526 | 3300037312 | Ga0395899_0005413 | Ga0395899_0005413_2192_3544 | 446 |
| 527 | 3300037418 | Ga0395900_0001002 | Ga0395900_0001002_24951_26291 | 446 |
| 528 | 3300037418 | Ga0395900_0001549 | Ga0395900_0001549_2072_3451 | 446 |
| 529 | 3300037418 | Ga0395900_0034028 | Ga0395900_0034028_634_1986 | 446 |
| 530 | 3300037466 | Ga0395898_0027333 | Ga0395898_0027333_3093_4472 | 446 |
| 531 | 3300037471 | Ga0395905_0000520 | Ga0395905_0000520_16596_17948 | 446 |
| 532 | 3300037471 | Ga0395905_0003309 | Ga0395905_0003309_13882_15261 | 446 |
| 533 | 3300038443 | Ga0395901_0003411 | Ga0395901_0003411_10182_11561 | 446 |
| 534 | 3300038443 | Ga0395901_0003486 | Ga0395901_0003486_13314_14666 | 446 |
| 535 | 3300046524 | Ga0495648_0040209 | Ga0495648_0040209_1512_2891 | 446 |
| 536 | 3300046524 | Ga0495648_0045454 | Ga0495648_0045454_77_1417 | 446 |
| 537 | 3300046538 | Ga0495609_0024937 | Ga0495609_0024937_11_1390 | 446 |
| 538 | 3300046616 | Ga0495668_0000041 | Ga0495668_0000041_10042_11421 | 446 |
| 539 | 3300046660 | Ga0495625_0000941 | Ga0495625_0000941_25769_27148 | 446 |
| 540 | 3300046660 | Ga0495625_0001068 | Ga0495625_0001068_12032_13372 | 446 |
| 541 | 3300047443 | Ga0495687_002396 | Ga0495687_002396_13705_15048 | 446 |
| 542 | 3300047472 | Ga0495686_0000097 | Ga0495686_0000097_51590_52930 | 446 |
| 543 | 3300048089 | Ga0495614_0014816 | Ga0495614_0014816_683_2062 | 446 |
| 544 | 3300048912 | Ga0496109_0000029 | Ga0496109_0000029_40091_41467 | 446 |
| 545 | 3300050493 | nmdc:mga0k408_57_c1 | nmdc:mga0k408_57_c1_52032_53411 | 446 |
| 546 | 3300050495 | nmdc:mga04h51_11484_c1 | nmdc:mga04h51_11484_c1_315_1721 | 446 |
| 547 | 3300050507 | nmdc:mga05p37_4264_c2 | nmdc:mga05p37_4264_c2_267_1643 | 446 |
| 548 | 3300050508 | nmdc:mga09592_182559_c1 | nmdc:mga09592_182559_c1_157_1533 | 446 |
| 549 | 3300050510 | nmdc:mga06r32_122481_c1 | nmdc:mga06r32_122481_c1_163_1539 | 446 |
| 550 | 3300050510 | nmdc:mga06r32_29327_c1 | nmdc:mga06r32_29327_c1_2145_3500 | 446 |
| 551 | 3300050510 | nmdc:mga06r32_79114_c1 | nmdc:mga06r32_79114_c1_1073_2449 | 446 |
| 552 | 3300050511 | nmdc:mga08y16_14258_c1 | nmdc:mga08y16_14258_c1_5329_6705 | 446 |
| 553 | 3300050512 | nmdc:mga0n895_84023_c1 | nmdc:mga0n895_84023_c1_305_1681 | 446 |
| 554 | 3300053125 | Ga0500618_000013 | Ga0500618_000013_37632_38972 | 446 |
| 555 | 3300054114 | Ga0501084_0099331 | Ga0501084_0099331_407_1837 | 446 |
| 556 | 3300003320 | rootH2_10143909 | rootH2_101439095 | 447 |
| 557 | 3300005327 | Ga0070658_10001322 | Ga0070658_100013227 | 447 |
| 558 | 3300005354 | Ga0070675_100017991 | Ga0070675_1000179914 | 447 |
| 559 | 3300005364 | Ga0070673_100012206 | Ga0070673_1000122062 | 447 |
| 560 | 3300005365 | Ga0070688_100065175 | Ga0070688_1000651752 | 447 |
| 561 | 3300005457 | Ga0070662_100015272 | Ga0070662_1000152722 | 447 |
| 562 | 3300005459 | Ga0068867_100043022 | Ga0068867_1000430221 | 447 |
| 563 | 3300005543 | Ga0070672_100031014 | Ga0070672_1000310142 | 447 |
| 564 | 3300005563 | Ga0068855_100000033 | Ga0068855_10000003312 | 447 |
| 565 | 3300005577 | Ga0068857_100021646 | Ga0068857_1000216462 | 447 |
| 566 | 3300005578 | Ga0068854_100104675 | Ga0068854_1001046751 | 447 |
| 567 | 3300005617 | Ga0068859_100037581 | Ga0068859_1000375812 | 447 |
| 568 | 3300005618 | Ga0068864_100039737 | Ga0068864_1000397373 | 447 |
| 569 | 3300005719 | Ga0068861_100036963 | Ga0068861_1000369632 | 447 |
| 570 | 3300005844 | Ga0068862_100016290 | Ga0068862_1000162902 | 447 |
| 571 | 3300006931 | Ga0097620_100037579 | Ga0097620_1000375792 | 447 |
| 572 | 3300009093 | Ga0105240_10021463 | Ga0105240_100214634 | 447 |
| 573 | 3300009094 | Ga0111539_10020817 | Ga0111539_100208173 | 447 |
| 574 | 3300009174 | Ga0105241_10000786 | Ga0105241_1000078610 | 447 |
| 575 | 3300013102 | Ga0157371_10051266 | Ga0157371_100512661 | 447 |
| 576 | 3300013104 | Ga0157370_10028181 | Ga0157370_100281812 | 447 |
| 577 | 3300013105 | Ga0157369_10245482 | Ga0157369_102454821 | 447 |
| 578 | 3300013306 | Ga0163162_10257129 | Ga0163162_102571292 | 447 |
| 579 | 3300013307 | Ga0157372_10001527 | Ga0157372_100015276 | 447 |
| 580 | 3300013307 | Ga0157372_10143908 | Ga0157372_101439083 | 447 |
| 581 | 3300013308 | Ga0157375_10168871 | Ga0157375_101688712 | 447 |
| 582 | 3300014326 | Ga0157380_10001405 | Ga0157380_100014051 | 447 |
| 583 | 3300014745 | Ga0157377_10013191 | Ga0157377_100131912 | 447 |
| 584 | 3300025933 | Ga0207706_10033783 | Ga0207706_100337832 | 447 |
| 585 | 3300025940 | Ga0207691_10021434 | Ga0207691_100214343 | 447 |
| 586 | 3300025949 | Ga0207667_10000046 | Ga0207667_1000004691 | 447 |
| 587 | 3300025961 | Ga0207712_10049816 | Ga0207712_100498162 | 447 |
| 588 | 3300026089 | Ga0207648_10053372 | Ga0207648_100533722 | 447 |
| 589 | 3300026116 | Ga0207674_10002306 | Ga0207674_100023062 | 447 |
| 590 | 3300026118 | Ga0207675_100001143 | Ga0207675_1000011433 | 447 |
| 591 | 3300027907 | Ga0207428_10011294 | Ga0207428_100112943 | 447 |
| 592 | 3300028380 | Ga0268265_10003622 | Ga0268265_100036222 | 447 |
| 593 | 3300037471 | Ga0395905_0145154 | Ga0395905_0145154_129_1472 | 447 |
| 594 | 3300046471 | Ga0495650_0000273 | Ga0495650_0000273_69959_71302 | 447 |
| 595 | 3300046492 | Ga0495585_0000132 | Ga0495585_0000132_53736_55079 | 447 |
| 596 | 3300046507 | Ga0495606_0000130 | Ga0495606_0000130_71647_72990 | 447 |
| 597 | 3300046512 | Ga0495610_0002154 | Ga0495610_0002154_9345_10688 | 447 |
| 598 | 3300046513 | Ga0495616_0017037 | Ga0495616_0017037_317_1660 | 447 |
| 599 | 3300046513 | Ga0495616_0026948 | Ga0495616_0026948_207_1550 | 447 |
| 600 | 3300046660 | Ga0495625_0001013 | Ga0495625_0001013_27152_28495 | 447 |
| 601 | 3300046660 | Ga0495625_0007876 | Ga0495625_0007876_2639_3982 | 447 |
| 602 | 3300046660 | Ga0495625_0029343 | Ga0495625_0029343_1065_2408 | 447 |
| 603 | 3300046660 | Ga0495625_0136554 | Ga0495625_0136554_148_1491 | 447 |
| 604 | 3300046665 | Ga0495661_0001637 | Ga0495661_0001637_16592_17935 | 447 |
| 605 | 3300046665 | Ga0495661_0032357 | Ga0495661_0032357_546_1892 | 447 |
| 606 | 3300046694 | Ga0495649_0000419 | Ga0495649_0000419_8467_9810 | 447 |
| 607 | 3300047443 | Ga0495687_000413 | Ga0495687_000413_19972_21315 | 447 |
| 608 | 3300047443 | Ga0495687_019158 | Ga0495687_019158_1307_2650 | 447 |
| 609 | 3300047472 | Ga0495686_0000039 | Ga0495686_0000039_256890_258233 | 447 |
| 610 | 3300049459 | Ga0495678_011761 | Ga0495678_011761_408_1751 | 447 |
| 611 | 3300049573 | Ga0501037_0012541 | Ga0501037_0012541_2389_3792 | 447 |
| 612 | 3300050511 | nmdc:mga08y16_18743_c1 | nmdc:mga08y16_18743_c1_5585_6937 | 447 |
| 613 | 3300053157 | Ga0500624_000735 | Ga0500624_000735_2242_3735 | 447 |
| 614 | 3300001989 | JGI24739J22299_10000858 | JGI24739J22299_100008582 | 448 |
| 615 | 3300003790 | Ga0055528_1000122 | Ga0055528_100012219 | 448 |
| 616 | 3300003791 | Ga0055530_10000192 | Ga0055530_1000019231 | 448 |
| 617 | 3300003794 | Ga0055531_10019370 | Ga0055531_100193702 | 448 |
| 618 | 3300005262 | Ga0065165_1003174 | Ga0065165_10031748 | 448 |
| 619 | 3300005331 | Ga0070670_100265759 | Ga0070670_1002657591 | 448 |
| 620 | 3300005366 | Ga0070659_100147535 | Ga0070659_1001475352 | 448 |
| 621 | 3300005617 | Ga0068859_100023128 | Ga0068859_1000231285 | 448 |
| 622 | 3300005843 | Ga0068860_100008334 | Ga0068860_1000083347 | 448 |
| 623 | 3300005844 | Ga0068862_100078361 | Ga0068862_1000783614 | 448 |
| 624 | 3300006844 | Ga0075428_100160792 | Ga0075428_1001607922 | 448 |
| 625 | 3300006931 | Ga0097620_100023128 | Ga0097620_1000231285 | 448 |
| 626 | 3300009093 | Ga0105240_10161539 | Ga0105240_101615393 | 448 |
| 627 | 3300009101 | Ga0105247_10005689 | Ga0105247_100056894 | 448 |
| 628 | 3300009177 | Ga0105248_10041383 | Ga0105248_100413833 | 448 |
| 629 | 3300009553 | Ga0105249_10006878 | Ga0105249_100068785 | 448 |
| 630 | 3300009553 | Ga0105249_10161194 | Ga0105249_101611942 | 448 |
| 631 | 3300010375 | Ga0105239_10000046 | Ga0105239_10000046104 | 448 |
| 632 | 3300013297 | Ga0157378_10000186 | Ga0157378_1000018625 | 448 |
| 633 | 3300013306 | Ga0163162_10003517 | Ga0163162_1000351715 | 448 |
| 634 | 3300014968 | Ga0157379_10013019 | Ga0157379_100130196 | 448 |
| 635 | 3300025273 | Ga0209673_1021143 | Ga0209673_10211432 | 448 |
| 636 | 3300025295 | Ga0209564_1004107 | Ga0209564_10041077 | 448 |
| 637 | 3300025297 | Ga0209758_1005889 | Ga0209758_10058897 | 448 |
| 638 | 3300025900 | Ga0207710_10024392 | Ga0207710_100243924 | 448 |
| 639 | 3300025961 | Ga0207712_10032767 | Ga0207712_100327673 | 448 |
| 640 | 3300025961 | Ga0207712_10045262 | Ga0207712_100452622 | 448 |
| 641 | 3300025961 | Ga0207712_10185611 | Ga0207712_101856112 | 448 |
| 642 | 3300026095 | Ga0207676_10058400 | Ga0207676_100584003 | 448 |
| 643 | 3300026116 | Ga0207674_10168020 | Ga0207674_101680203 | 448 |
| 644 | 3300028381 | Ga0268264_10007604 | Ga0268264_100076045 | 448 |
| 645 | 3300036401 | Ga0373937_0194698 | Ga0373937_0194698_18_1364 | 448 |
| 646 | 3300048905 | Ga0496102_0015429 | Ga0496102_0015429_1165_2511 | 448 |
| 647 | 3300048909 | Ga0496106_0056901 | Ga0496106_0056901_1103_2449 | 448 |
| 648 | 3300050510 | nmdc:mga06r32_94697_c1 | nmdc:mga06r32_94697_c1_273_1619 | 448 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vfs-assembly1.cif.gz_A | alditol oxidase from streptomyces coelicolor a3(2): complex with xylitol | 0.9674 | 31 | 445 |
| 2vfs-assembly1.cif.gz_A | alditol oxidase from streptomyces coelicolor a3(2): complex with xylitol | 0.9582 | 31 | 445 |
| 6hfw-assembly2.cif.gz_B | mycobacterium tuberculosis dpre1 in complex with cmp1 | 0.8045 | 29 | 444 |
| 3js8-assembly1.cif.gz_A | solvent-stable cholesterol oxidase | 0.8015 | 32 | 445 |
| 6hf3-assembly2.cif.gz_B | m tuberculosis dpre1 in complex with a covalently bound nitrobenzothiazinone | 0.7983 | 29 | 444 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vfrA04 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9937 | 316 | 408 | 3.30.70.2520 |
| 2vfrA04 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9729 | 316 | 408 | 3.30.70.2520 |
| af_P9WIT3_70_193_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9698 | 92 | 203 | 3.30.465.10 |
| af_A4HXL3_75_196_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9688 | 92 | 203 | 3.30.465.10 |
| 2vfuA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9685 | 92 | 203 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S4HS62-F1-model_v4 | D-arabinono-1,4-lactone oxidase C-terminal domain-containing protein | 0.9866 | 325 | 448 |
GO:0003885
GO:0016020 GO:0080049 |
| AF-A0A441XLM3-F1-model_v4 | FAD-binding protein | 0.9836 | 89 | 205 |
GO:0016899
GO:0071949 |
| AF-A0A4Q7TJC3-F1-model_v4 | Xylitol oxidase | 0.981 | 32 | 444 |
GO:0003885
GO:0016020 GO:0071949 GO:0080049 |
| AF-A0A2E9GEE2-F1-model_v4 | deleted | 0.9806 | 121 | 446 |
|
| AF-A0A358D6V9-F1-model_v4 | FAD-binding protein | 0.9787 | 272 | 444 |
GO:0003885
GO:0016020 GO:0080049 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar