F472396

General Info

Members Datasets Scaffolds Average Seq Length
648 433 514 283

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0057877|Ga0495592_0057877_624_1622
Length 332
Sequence VLATANASIKKLRRNIMPVLPRPHYAIAETWGAAVGAVNPSTPREEGGMRSVVITGTSTGIGWGAAKVLIANSFRVFGSVRKRADADRLKAEFGQSYVPLLFDVTDAGAVKEAAAEVRAALAGETLAGLVNNAGVAVAGPLLELPVEEFRRQIEINLVGVVIVTQAFAPLLGTDRGLKGNPGRIVNISSVGGRIGNPFLAPYVASKFALEGLSESLRRELLPFGIDVIVIAPGAVATPIWAKAEQVDVSLYRNTPYAAPLDRLRNYMLMLGKQGLPPERIGEAVRHALTAAKPKVRYTVTPTPVQNWLATNLPKRVVDRMVGSRLGLLPKKG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
10 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
14 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
15 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
16 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
17 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
18 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
19 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
20 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
21 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
22 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
23 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
24 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
25 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
26 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
27 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
28 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
29 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
30 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
31 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
32 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
33 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
34 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
35 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
36 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
37 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
38 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
39 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
40 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
41 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
42 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
43 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
44 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
45 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
46 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
47 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
48 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
49 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
50 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
51 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
52 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
53 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
54 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
55 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
56 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
57 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
58 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
59 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
60 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
61 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
62 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
63 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
64 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
65 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
66 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
67 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
68 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
69 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
70 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
71 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
72 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
73 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
74 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
75 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
76 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
77 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
78 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
79 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
80 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
81 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
82 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
83 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
84 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
85 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
86 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
87 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
88 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
89 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
90 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
91 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
92 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
93 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
94 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
95 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
96 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
97 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
98 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
99 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
100 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
101 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
102 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
103 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
104 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
105 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
106 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
107 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
108 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
111 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
112 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
113 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
114 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
115 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
116 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
117 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
118 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
121 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
122 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
123 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
124 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
130 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
131 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
235 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
243 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
362 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
368 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
369 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
370 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
371 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
372 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
373 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
374 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
375 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
379 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
380 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
391 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
396 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
397 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
398 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
401 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
402 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
403 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
408 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
409 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
410 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
411 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
412 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
413 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
414 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
415 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
416 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
417 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
418 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
419 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
420 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
421 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
422 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
423 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
424 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
425 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
426 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
427 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
428 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
429 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
430 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
431 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
432 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
433 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.44
Metatranscriptomes 0
Isolates 20.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.2
Nodule 16.2
Rhizoplane 6.48
Rhizosphere 50.77
Stem 0
Stem Tuber 0
Unclassified 12.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006309 3300003215 Bacteria 6036
2 Ga0065712_10207674 3300005290 Bacteria 1084
3 Ga0070670_100250598 3300005331 Bacteria 1543
4 Ga0070680_100000939 3300005336 Bacteria 20604
5 Ga0070680_100083477 3300005336 Bacteria 2638
6 Ga0070675_100454428 3300005354 Bacteria 1149
7 Ga0070688_100046964 3300005365 Bacteria 2676
8 Ga0070709_10000582 3300005434 Bacteria 21380
9 Ga0070709_10247026 3300005434 Bacteria 1284
10 Ga0070714_100001277 3300005435 Bacteria 18205
11 Ga0070713_100020001 3300005436 Bacteria 5124
12 Ga0070710_10013427 3300005437 Bacteria 4103
13 Ga0070711_100010842 3300005439 Bacteria 5650
14 Ga0070711_100020239 3300005439 Bacteria 4284
15 Ga0070700_100035249 3300005441 Bacteria 3027
16 Ga0070663_100148551 3300005455 Bacteria 1795
17 Ga0070681_10000068 3300005458 Bacteria 75693
18 Ga0070685_10003349 3300005466 Bacteria 8155
19 Ga0070679_100000301 3300005530 Bacteria 42204
20 Ga0070697_100132291 3300005536 Bacteria 2093
21 Ga0070695_100006254 3300005545 Bacteria 7034
22 Ga0070665_100131553 3300005548 Bacteria 2504
23 Ga0068855_100000024 3300005563 Bacteria 184241
24 Ga0068852_100046750 3300005616 Bacteria 3689
25 Ga0068862_100230192 3300005844 Bacteria 1681
26 Ga0081540_1016641 3300005983 Bacteria 4590
27 Ga0081540_1096976 3300005983 Bacteria 1281
28 Ga0081539_10074196 3300005985 Bacteria 1812
29 Ga0070717_10170129 3300006028 Bacteria 1894
30 Ga0075364_10025047 3300006051 Bacteria 3795
31 Ga0070715_10001014 3300006163 Bacteria 7909
32 Ga0070712_100007497 3300006175 Bacteria 6815
33 Ga0070712_100016816 3300006175 Bacteria 4730
34 Ga0075429_100372016 3300006880 Bacteria 1251
35 Ga0105240_10000132 3300009093 Bacteria 152512
36 Ga0105240_10069221 3300009093 Bacteria 4369
37 Ga0105248_10000009 3300009177 Bacteria 403549
38 Ga0105237_10206974 3300009545 Bacteria 1962
39 Ga0105238_10039972 3300009551 Bacteria 4754
40 Ga0105249_10142541 3300009553 Bacteria 2299
41 Ga0105239_10034199 3300010375 Bacteria 5580
42 Ga0105239_10094357 3300010375 Bacteria 3305
43 Ga0105239_10254765 3300010375 Bacteria 1971
44 Ga0157369_10018044 3300013105 Bacteria 7916
45 Ga0157369_10024585 3300013105 Bacteria 6697
46 Ga0157378_10020349 3300013297 Bacteria 5837
47 Ga0163163_10169564 3300014325 Bacteria 2229
48 Ga0163161_10072003 3300017792 Bacteria 2530
49 Ga0163161_10232639 3300017792 Bacteria 1431
50 Ga0213873_10024394 3300021358 Bacteria 1451
51 Ga0213876_10006865 3300021384 Bacteria 6204
52 Ga0228598_1015024 3300024227 Bacteria 1529
53 Ga0209563_104990 3300025230 Bacteria 2464
54 Ga0209677_108255 3300025253 Bacteria 2048
55 Ga0209673_1013333 3300025273 Bacteria 3250
56 Ga0209564_1009906 3300025295 Bacteria 4462
57 Ga0209564_1020411 3300025295 Bacteria 2427
58 Ga0209758_1000141 3300025297 Bacteria 172481
59 Ga0209758_1000324 3300025297 Bacteria 91475
60 Ga0209758_1001709 3300025297 Bacteria 24609
61 Ga0209758_1006410 3300025297 Bacteria 8472
62 Ga0209758_1027369 3300025297 Bacteria 2437
63 Ga0209256_1005331 3300025299 Bacteria 7476
64 Ga0207426_1001139 3300025302 Bacteria 24022
65 Ga0207426_1035434 3300025302 Bacteria 1592
66 Ga0207426_1053796 3300025302 Bacteria 1187
67 Ga0209051_1035927 3300025303 Bacteria 1837
68 Ga0209257_1009854 3300025304 Bacteria 4992
69 Ga0207692_10000606 3300025898 Bacteria 12643
70 Ga0207692_10003679 3300025898 Bacteria 6009
71 Ga0207642_10078312 3300025899 Bacteria 1597
72 Ga0207710_10053579 3300025900 Bacteria 1815
73 Ga0207710_10077240 3300025900 Bacteria 1538
74 Ga0207688_10014229 3300025901 Bacteria 4329
75 Ga0207647_10006314 3300025904 Bacteria 8627
76 Ga0207647_10023450 3300025904 Bacteria 4080
77 Ga0207685_10062551 3300025905 Bacteria 1479
78 Ga0207699_10005515 3300025906 Bacteria 6063
79 Ga0207645_10132605 3300025907 Bacteria 1622
80 Ga0207645_10150594 3300025907 Bacteria 1518
81 Ga0207643_10053352 3300025908 Bacteria 2297
82 Ga0207684_10096387 3300025910 Bacteria 2525
83 Ga0207654_10036625 3300025911 Bacteria 2742
84 Ga0207707_10000002 3300025912 Bacteria 1142054
85 Ga0207695_10000003 3300025913 Bacteria 1368691
86 Ga0207695_10000062 3300025913 Bacteria 351979
87 Ga0207695_10103092 3300025913 Bacteria 2845
88 Ga0207695_10150935 3300025913 Bacteria 2263
89 Ga0207671_10001897 3300025914 Bacteria 23245
90 Ga0207671_10137170 3300025914 Bacteria 1882
91 Ga0207671_10159721 3300025914 Bacteria 1745
92 Ga0207671_10196418 3300025914 Bacteria 1574
93 Ga0207671_10415543 3300025914 Bacteria 1070
94 Ga0207671_10448385 3300025914 Bacteria 1028
95 Ga0207693_10002265 3300025915 Bacteria 16743
96 Ga0207693_10005103 3300025915 Bacteria 11007
97 Ga0207693_10043784 3300025915 Bacteria 3520
98 Ga0207663_10011783 3300025916 Bacteria 4708
99 Ga0207663_10054529 3300025916 Bacteria 2504
100 Ga0207660_10001975 3300025917 Bacteria 13667
101 Ga0207657_10199384 3300025919 Bacteria 1611
102 Ga0207649_10010910 3300025920 Bacteria 4996
103 Ga0207652_10000240 3300025921 Bacteria 57130
104 Ga0207681_10509575 3300025923 Bacteria 986
105 Ga0207694_10000016 3300025924 Bacteria 349087
106 Ga0207694_10069915 3300025924 Bacteria 2743
107 Ga0207694_10355109 3300025924 Bacteria 1214
108 Ga0207650_10359863 3300025925 Bacteria 1199
109 Ga0207687_10010179 3300025927 Bacteria 6144
110 Ga0207700_10053214 3300025928 Bacteria 3032
111 Ga0207664_10006176 3300025929 Bacteria 8218
112 Ga0207664_10055506 3300025929 Bacteria 3143
113 Ga0207706_10381257 3300025933 Bacteria 1223
114 Ga0207686_10246828 3300025934 Bacteria 1302
115 Ga0207709_10239466 3300025935 Bacteria 1319
116 Ga0207670_10028423 3300025936 Bacteria 3550
117 Ga0207704_10024331 3300025938 Bacteria 3282
118 Ga0207704_10230908 3300025938 Bacteria 1376
119 Ga0207665_10000580 3300025939 Bacteria 24626
120 Ga0207691_10041318 3300025940 Bacteria 4258
121 Ga0207711_10000003 3300025941 Bacteria 1042791
122 Ga0207711_10000005 3300025941 Bacteria 822972
123 Ga0207711_10000015 3300025941 Bacteria 494097
124 Ga0207711_10091611 3300025941 Bacteria 2674
125 Ga0207711_10133474 3300025941 Bacteria 2228
126 Ga0207661_10036034 3300025944 Bacteria 3860
127 Ga0207679_10143273 3300025945 Bacteria 1934
128 Ga0207667_10000021 3300025949 Bacteria 370524
129 Ga0207651_10241270 3300025960 Bacteria 1473
130 Ga0207640_10327865 3300025981 Bacteria 1221
131 Ga0207658_10131268 3300025986 Bacteria 2013
132 Ga0207658_10280888 3300025986 Bacteria 1427
133 Ga0207703_10014806 3300026035 Bacteria 6085
134 Ga0207703_10124822 3300026035 Bacteria 2215
135 Ga0207703_10181246 3300026035 Bacteria 1859
136 Ga0207703_10428425 3300026035 Bacteria 1232
137 Ga0207678_10019793 3300026067 Bacteria 5920
138 Ga0207678_10050648 3300026067 Bacteria 3587
139 Ga0207678_10117343 3300026067 Bacteria 2271
140 Ga0207708_10086197 3300026075 Bacteria 2417
141 Ga0207702_10004815 3300026078 Bacteria 11900
142 Ga0207641_10094672 3300026088 Bacteria 2620
143 Ga0207641_10715725 3300026088 Bacteria 987
144 Ga0207648_10076107 3300026089 Bacteria 2925
145 Ga0207648_10088048 3300026089 Bacteria 2711
146 Ga0207676_10063603 3300026095 Bacteria 2931
147 Ga0207675_100032581 3300026118 Bacteria 4855
148 Ga0207675_100060167 3300026118 Bacteria 3546
149 Ga0207675_100094377 3300026118 Bacteria 2814
150 Ga0207683_10018490 3300026121 Bacteria 5947
151 Ga0207683_10035485 3300026121 Bacteria 4338
152 Ga0207683_10075529 3300026121 Bacteria 2983
153 Ga0207683_10200987 3300026121 Bacteria 1812
154 Ga0207698_10032091 3300026142 Bacteria 3801
155 Ga0207698_10060819 3300026142 Bacteria 2939
156 Ga0207698_10081745 3300026142 Bacteria 2609
157 Ga0207698_10262888 3300026142 Bacteria 1586
158 Ga0207698_10265272 3300026142 Bacteria 1580
159 Ga0209389_1000004 3300027296 Bacteria 263759
160 Ga0209489_100777 3300027361 Bacteria 63061
161 Ga0209700_100013 3300027363 Bacteria 341906
162 Ga0268266_10011051 3300028379 Bacteria 7861
163 Ga0268266_10081674 3300028379 Bacteria 2819
164 Ga0268266_10285848 3300028379 Bacteria 1535
165 Ga0268265_10053336 3300028380 Bacteria 3063
166 Ga0268265_10397802 3300028380 Bacteria 1272
167 Ga0268264_10000038 3300028381 Bacteria 383623
168 Ga0268264_10243430 3300028381 Bacteria 1667
169 Ga0307517_10000085 3300028786 Bacteria 131200
170 Ga0265338_10000007 3300028800 Bacteria 498229
171 Ga0265338_10032423 3300028800 Bacteria 5096
172 Ga0265338_10155753 3300028800 Unclassified 1770
173 Ga0265338_10246173 3300028800 Bacteria 1321
174 Ga0265324_10042482 3300029957 Unclassified 1571
175 Ga0307511_10052126 3300030521 Bacteria 3266
176 Ga0265330_10099923 3300031235 Bacteria 1242
177 Ga0265332_10107704 3300031238 Bacteria 1175
178 Ga0265320_10000413 3300031240 Bacteria 33867
179 Ga0265320_10025585 3300031240 Bacteria 3101
180 Ga0265325_10000001 3300031241 Bacteria 726814
181 Ga0265325_10000221 3300031241 Bacteria 40256
182 Ga0265325_10022794 3300031241 Bacteria 3425
183 Ga0265325_10111208 3300031241 Bacteria 1331
184 Ga0265340_10115308 3300031247 Bacteria 1239
185 Ga0265339_10002071 3300031249 Bacteria 14692
186 Ga0265339_10010002 3300031249 Bacteria 5919
187 Ga0265339_10056013 3300031249 Bacteria 2136
188 Ga0265331_10003286 3300031250 Bacteria 10512
189 Ga0265316_10073166 3300031344 Bacteria 2640
190 Ga0265316_10126120 3300031344 Bacteria 1930
191 Ga0307509_10055212 3300031507 Bacteria 4223
192 Ga0307509_10095762 3300031507 Bacteria 3022
193 Ga0265313_10000929 3300031595 Bacteria 29179
194 Ga0265313_10002900 3300031595 Bacteria 14338
195 Ga0307508_10000034 3300031616 Bacteria 160115
196 Ga0307508_10299411 3300031616 Bacteria 1201
197 Ga0316575_10066884 3300031665 Bacteria 1440
198 Ga0265314_10003279 3300031711 Bacteria 15816
199 Ga0265314_10011420 3300031711 Bacteria 7334
200 Ga0265314_10043034 3300031711 Bacteria 3215
201 Ga0265314_10056346 3300031711 Bacteria 2706
202 Ga0265314_10065061 3300031711 Bacteria 2465
203 Ga0265314_10145643 3300031711 Bacteria 1459
204 Ga0265342_10027066 3300031712 Bacteria 3589
205 Ga0265342_10036503 3300031712 Bacteria 3002
206 Ga0316576_10003264 3300031727 Bacteria 9465
207 Ga0307516_10012055 3300031730 Bacteria 9343
208 Ga0307516_10147279 3300031730 Bacteria 2119
209 Ga0307516_10222631 3300031730 Bacteria 1595
210 Ga0316580_10065881 3300032139 Bacteria 1111
211 Ga0307507_10072118 3300033179 Bacteria 3115
212 Ga0307510_10003336 3300033180 Bacteria 18711
213 Ga0307510_10129708 3300033180 Bacteria 2199
214 Ga0307510_10134712 3300033180 Bacteria 2132
215 Ga0373930_0017130 3300034816 Bacteria 1378
216 Ga0373951_0013454 3300035091 Bacteria 1840
217 Ga0373932_0039539 3300035112 Bacteria 1353
218 Ga0373939_0020564 3300035114 Bacteria 1795
219 Ga0373956_0169285 3300035119 Bacteria 1031
220 Ga0373962_0013703 3300035242 Bacteria 2056
221 Ga0373962_0040622 3300035242 Bacteria 1309
222 Ga0316574_0160494 3300035398 Bacteria 1448
223 Ga0373931_0017054 3300035691 Bacteria 3583
224 Ga0373931_0115566 3300035691 Bacteria 1527
225 Ga0373935_0017908 3300035692 Bacteria 4303
226 Ga0373927_0010098 3300035695 Bacteria 6318
227 Ga0373927_0291332 3300035695 Bacteria 1074
228 Ga0373933_0002876 3300035724 Bacteria 9623
229 Ga0373947_0019804 3300035725 Bacteria 3883
230 Ga0373947_0423588 3300035725 Bacteria 900
231 Ga0373937_0003575 3300036401 Bacteria 13104
232 Ga0373937_0517638 3300036401 Bacteria 1134
233 Ga0316584_0260862 3300036712 Bacteria 1264
234 Ga0373925_0068046 3300037068 Bacteria 2687
235 Ga0373925_0108119 3300037068 Bacteria 2146
236 Ga0373925_0351276 3300037068 Bacteria 1197
237 Ga0395905_0008003 3300037471 Bacteria 10445
238 Ga0395905_0178275 3300037471 Bacteria 1995
239 Ga0395905_0389908 3300037471 Bacteria 1287
240 Ga0395901_0321760 3300038443 Bacteria 1600
241 Ga0436365_0211858 3300039437 Bacteria 4276
242 Ga0436365_1017537 3300039437 Bacteria 4131
243 Ga0436365_1692740 3300039437 Bacteria 1555
244 Ga0436360_1321389 3300039438 Bacteria 1480
245 Ga0436361_0818803 3300039447 Bacteria 2336
246 Ga0436363_0020937 3300039450 Bacteria 2529
247 Ga0436363_1486701 3300039450 Bacteria 1420
248 Ga0436362_0128483 3300039453 Bacteria 4975
249 Ga0436362_1240820 3300039453 Bacteria 6215
250 Ga0453683_0014438 3300044673 Bacteria 5127
251 Ga0466966_0000419 3300044684 Bacteria 27305
252 Ga0466961_0000020 3300044693 Bacteria 107610
253 Ga0466959_0023409 3300045049 Bacteria 4570
254 Ga0451576_0000242 3300045051 Bacteria 133680
255 Ga0451576_0353520 3300045051 Bacteria 1538
256 Ga0495592_0014283 3300046454 Bacteria 6031
257 Ga0495592_0057877 3300046454 Bacteria 2860
258 Ga0495603_0004299 3300046455 Bacteria 8492
259 Ga0495629_0101341 3300046459 Bacteria 2009
260 Ga0495629_0101425 3300046459 Bacteria 2008
261 Ga0495638_0020663 3300046460 Bacteria 4347
262 Ga0495638_0032262 3300046460 Bacteria 3359
263 Ga0495638_0042046 3300046460 Bacteria 2888
264 Ga0495651_0002943 3300046462 Bacteria 13173
265 Ga0495651_0025932 3300046462 Bacteria 4564
266 Ga0495651_0085487 3300046462 Bacteria 2375
267 Ga0495651_0217327 3300046462 Bacteria 1325
268 Ga0495651_0248930 3300046462 Bacteria 1215
269 Ga0495605_0046795 3300046474 Bacteria 2125
270 Ga0495664_0230356 3300046477 Bacteria 1121
271 Ga0495606_0023769 3300046507 Bacteria 4432
272 Ga0495606_0048670 3300046507 Bacteria 2786
273 Ga0495606_0176022 3300046507 Bacteria 1237
274 Ga0495608_0025823 3300046511 Bacteria 4009
275 Ga0495608_0168866 3300046511 Bacteria 1388
276 Ga0495616_0057330 3300046513 Bacteria 1921
277 Ga0495618_0043410 3300046514 Bacteria 2837
278 Ga0495618_0269510 3300046514 Bacteria 1064
279 Ga0495628_0055958 3300046516 Bacteria 3106
280 Ga0495630_0151444 3300046517 Bacteria 1765
281 Ga0495643_0048901 3300046522 Bacteria 2283
282 Ga0495643_0053422 3300046522 Bacteria 2166
283 Ga0495643_0073092 3300046522 Bacteria 1797
284 Ga0495643_0141688 3300046522 Bacteria 1198
285 Ga0495644_0120921 3300046523 Bacteria 996
286 Ga0495652_0020012 3300046529 Bacteria 5952
287 Ga0495640_0029617 3300046533 Bacteria 3928
288 Ga0495587_0115593 3300046536 Bacteria 1539
289 Ga0495587_0116821 3300046536 Bacteria 1530
290 Ga0495622_0037345 3300046557 Bacteria 2263
291 Ga0495622_0060902 3300046557 Bacteria 1748
292 Ga0495667_0235608 3300046559 Bacteria 1166
293 Ga0495656_0013292 3300046615 Bacteria 3059
294 Ga0495656_0017604 3300046615 Bacteria 2729
295 Ga0495634_0111264 3300046642 Bacteria 1761
296 Ga0495611_0009307 3300046648 Bacteria 4149
297 Ga0495625_0097509 3300046660 Bacteria 2023
298 Ga0495625_0116234 3300046660 Bacteria 1825
299 Ga0495625_0173233 3300046660 Bacteria 1440
300 Ga0495635_0106465 3300046663 Bacteria 1915
301 Ga0495635_0260853 3300046663 Bacteria 1167
302 Ga0495659_0030718 3300046664 Bacteria 1871
303 Ga0495659_0034014 3300046664 Bacteria 1790
304 Ga0495588_0033223 3300046674 Bacteria 2604
305 Ga0495588_0173464 3300046674 Bacteria 1140
306 Ga0495657_0022214 3300046675 Bacteria 4548
307 Ga0495657_0095210 3300046675 Bacteria 1903
308 Ga0495599_0111102 3300046678 Bacteria 1707
309 Ga0495623_0020931 3300046679 Bacteria 4226
310 Ga0495623_0046161 3300046679 Bacteria 2766
311 Ga0495646_0023266 3300046680 Bacteria 3902
312 Ga0495669_0002200 3300046684 Bacteria 8005
313 Ga0495613_0295144 3300046689 Bacteria 1123
314 Ga0495624_0097946 3300046690 Bacteria 1807
315 Ga0495649_0014534 3300046694 Bacteria 4509
316 Ga0495649_0033655 3300046694 Bacteria 2820
317 Ga0495600_0003794 3300046809 Bacteria 8948
318 Ga0495600_0050620 3300046809 Bacteria 2711
319 Ga0495604_0024585 3300047317 Bacteria 4805
320 Ga0495604_0034404 3300047317 Bacteria 4008
321 Ga0495604_0038058 3300047317 Bacteria 3785
322 Ga0495636_0085627 3300047318 Bacteria 1362
323 Ga0495636_0123217 3300047318 Bacteria 1148
324 Ga0495674_0507609 3300047319 Bacteria 964
325 Ga0495672_0014045 3300047320 Bacteria 5500
326 Ga0495672_0042911 3300047320 Bacteria 2723
327 Ga0495676_0365702 3300047321 Bacteria 962
328 Ga0495680_0190465 3300047322 Bacteria 1476
329 Ga0495677_0032747 3300047445 Bacteria 1893
330 Ga0495684_0117067 3300047471 Bacteria 2009
331 Ga0495684_0131539 3300047471 Bacteria 1879
332 Ga0495686_0059676 3300047472 Bacteria 2373
333 Ga0495686_0061185 3300047472 Bacteria 2339
334 Ga0495686_0242226 3300047472 Bacteria 1016
335 Ga0495602_0023281 3300048088 Bacteria 6039
336 Ga0495602_0107207 3300048088 Bacteria 2278
337 Ga0496100_0053153 3300048903 Bacteria 2637
338 Ga0496101_0004586 3300048904 Bacteria 8729
339 Ga0496102_0007305 3300048905 Bacteria 9429
340 Ga0496102_0052186 3300048905 Bacteria 3725
341 Ga0496103_0010719 3300048906 Bacteria 5423
342 Ga0496103_0041718 3300048906 Bacteria 2821
343 Ga0496103_0194998 3300048906 Bacteria 1302
344 Ga0496104_0027060 3300048907 Bacteria 5303
345 Ga0496104_0054323 3300048907 Bacteria 3785
346 Ga0496104_0099919 3300048907 Bacteria 2777
347 Ga0496105_0077493 3300048908 Bacteria 2745
348 Ga0496105_0084786 3300048908 Bacteria 2617
349 Ga0496105_0182208 3300048908 Bacteria 1719
350 Ga0496105_0223467 3300048908 Bacteria 1532
351 Ga0496106_0005619 3300048909 Bacteria 9280
352 Ga0496106_0017753 3300048909 Bacteria 5262
353 Ga0496106_0066022 3300048909 Bacteria 2755
354 Ga0496106_0135990 3300048909 Bacteria 1930
355 Ga0496107_0000808 3300048910 Bacteria 18176
356 Ga0496107_0034118 3300048910 Bacteria 3643
357 Ga0496108_0018943 3300048911 Bacteria 5644
358 Ga0496108_0044389 3300048911 Bacteria 3711
359 Ga0496108_0445066 3300048911 Bacteria 1132
360 Ga0496109_0078121 3300048912 Bacteria 3047
361 Ga0496109_0427324 3300048912 Bacteria 1251
362 Ga0496110_0297108 3300048913 Bacteria 1471
363 Ga0496110_0371834 3300048913 Bacteria 1302
364 Ga0496111_0016617 3300048914 Bacteria 5074
365 Ga0496111_0225778 3300048914 Bacteria 1391
366 Ga0496112_0000008 3300048915 Bacteria 310323
367 Ga0496112_0019731 3300048915 Bacteria 6372
368 Ga0496112_0058241 3300048915 Bacteria 3804
369 Ga0496112_0064765 3300048915 Bacteria 3607
370 Ga0496112_0119981 3300048915 Bacteria 2600
371 Ga0496113_0009715 3300048916 Bacteria 6321
372 Ga0496113_0043860 3300048916 Bacteria 3311
373 Ga0496114_0026566 3300048917 Bacteria 4740
374 Ga0496114_0042858 3300048917 Bacteria 3751
375 Ga0496114_0044410 3300048917 Bacteria 3687
376 Ga0496115_0041375 3300048918 Bacteria 3667
377 Ga0496115_0186259 3300048918 Bacteria 1715
378 Ga0496116_0004266 3300048919 Bacteria 13712
379 Ga0496116_0060416 3300048919 Bacteria 2459
380 Ga0496118_0064136 3300048921 Bacteria 2698
381 Ga0496118_0132685 3300048921 Bacteria 1596
382 Ga0496118_0157147 3300048921 Bacteria 1412
383 Ga0496118_0254340 3300048921 Bacteria 996
384 Ga0496119_0012771 3300048922 Bacteria 6778
385 Ga0496119_0031235 3300048922 Bacteria 3577
386 Ga0496119_0052000 3300048922 Bacteria 2513
387 Ga0496119_0126030 3300048922 Bacteria 1401
388 Ga0496120_0048159 3300048923 Bacteria 2454
389 Ga0496120_0076050 3300048923 Bacteria 1831
390 Ga0496121_0000099 3300048924 Bacteria 200160
391 Ga0496121_0000178 3300048924 Bacteria 141429
392 Ga0496121_0142291 3300048924 Bacteria 1777
393 Ga0496121_0179020 3300048924 Bacteria 1532
394 Ga0496121_0202130 3300048924 Bacteria 1415
395 Ga0496122_0217945 3300048925 Bacteria 1098
396 Ga0496124_0008073 3300048927 Bacteria 11067
397 Ga0496124_0053777 3300048927 Bacteria 3411
398 Ga0496124_0401555 3300048927 Bacteria 951
399 Ga0496125_0018440 3300048928 Bacteria 6627
400 Ga0496125_0051098 3300048928 Bacteria 3413
401 Ga0496126_0025411 3300048929 Bacteria 5698
402 Ga0496126_0064343 3300048929 Bacteria 3286
403 Ga0496126_0122538 3300048929 Bacteria 2253
404 Ga0496126_0143836 3300048929 Bacteria 2050
405 Ga0496126_0243471 3300048929 Bacteria 1501
406 Ga0496126_0361982 3300048929 Bacteria 1184
407 Ga0496126_0393619 3300048929 Bacteria 1125
408 Ga0496126_0535256 3300048929 Bacteria 932
409 Ga0495682_0005043 3300049460 Bacteria 5546
410 Ga0495682_0011847 3300049460 Bacteria 3351
411 Ga0501034_0021712 3300049571 Bacteria 6541
412 Ga0501034_0253069 3300049571 Bacteria 1705
413 Ga0501034_0253582 3300049571 Bacteria 1703
414 Ga0501037_0220515 3300049573 Bacteria 1335
415 Ga0501047_0016854 3300049581 Bacteria 6982
416 Ga0501047_0266391 3300049581 Bacteria 1560
417 Ga0501067_0003070 3300049583 Bacteria 9211
418 Ga0501069_0003810 3300049585 Bacteria 7759
419 Ga0501069_0080351 3300049585 Bacteria 1836
420 Ga0501070_0020931 3300049586 Bacteria 5487
421 Ga0501070_0021099 3300049586 Bacteria 5465
422 Ga0501070_0141316 3300049586 Bacteria 1988
423 Ga0501072_0060304 3300049588 Bacteria 2991
424 Ga0501074_0061029 3300049590 Bacteria 2716
425 Ga0501079_0001956 3300049741 Bacteria 14759
426 Ga0501035_0002651 3300049822 Bacteria 17407
427 Ga0501044_0142405 3300049823 Bacteria 2386
428 Ga0501044_0145560 3300049823 Bacteria 2355
429 nmdc:mga03683_83186_c1 3300050489 Bacteria 1385
430 nmdc:mga00v17_219998_c1 3300050491 Bacteria 1229
431 nmdc:mga00v17_31325_c1 3300050491 Bacteria 3136
432 nmdc:mga0yw44_101657_c1 3300050492 Bacteria 1832
433 nmdc:mga0yw44_44260_c1 3300050492 Bacteria 2662
434 nmdc:mga0k408_125943_c1 3300050493 Bacteria 1519
435 nmdc:mga06z11_127663_c1 3300050494 Bacteria 1425
436 nmdc:mga06z11_4441_c1 3300050494 Bacteria 5518
437 nmdc:mga07m45_237815_c1 3300050496 Bacteria 1060
438 nmdc:mga05p37_69657_c1 3300050507 Bacteria 4326
439 nmdc:mga08y16_190300_c1 3300050511 Bacteria 2128
440 nmdc:mga08y16_220898_c1 3300050511 Bacteria 1962
441 nmdc:mga0sz30_15258_c1 3300050516 Bacteria 3034
442 Ga0495601_0136919 3300053077 Bacteria 1596
443 Ga0500635_0001453 3300053080 Bacteria 5701
444 Ga0495595_0089780 3300053084 Bacteria 1473
445 Ga0495595_0138699 3300053084 Bacteria 1192
446 Ga0495619_0097184 3300053085 Bacteria 2000
447 Ga0500578_0170974 3300053086 Bacteria 1344
448 Ga0500643_000018 3300053087 Bacteria 296505
449 Ga0500647_0018541 3300053091 Bacteria 3224
450 Ga0500647_0052730 3300053091 Bacteria 1957
451 Ga0500651_0005607 3300053093 Bacteria 7187
452 Ga0500566_0000008 3300053094 Bacteria 143641
453 Ga0500566_0005804 3300053094 Bacteria 7337
454 Ga0500566_0011048 3300053094 Bacteria 5320
455 Ga0500640_127704 3300053095 Bacteria 1008
456 Ga0500641_0013157 3300053096 Bacteria 3037
457 Ga0500641_0054600 3300053096 Bacteria 1652
458 Ga0500650_0000650 3300053098 Bacteria 9175
459 Ga0500650_0110326 3300053098 Bacteria 1284
460 Ga0500554_006967 3300053102 Bacteria 2573
461 Ga0500555_004973 3300053103 Bacteria 3772
462 Ga0500556_0067726 3300053104 Bacteria 1328
463 Ga0500556_0120649 3300053104 Bacteria 1022
464 Ga0500557_000008 3300053105 Bacteria 127284
465 Ga0500562_010666 3300053108 Bacteria 2330
466 Ga0500569_050354 3300053109 Bacteria 1255
467 Ga0500572_000613 3300053111 Bacteria 12000
468 Ga0500591_017145 3300053115 Bacteria 3498
469 Ga0500595_007004 3300053119 Bacteria 4725
470 Ga0500595_007694 3300053119 Bacteria 4455
471 Ga0500595_015175 3300053119 Bacteria 2895
472 Ga0500595_026858 3300053119 Bacteria 1978
473 Ga0500595_040960 3300053119 Bacteria 1491
474 Ga0500608_011051 3300053122 Bacteria 3904
475 Ga0500608_088447 3300053122 Bacteria 1451
476 Ga0500614_003090 3300053123 Bacteria 3618
477 Ga0500621_071249 3300053126 Bacteria 1401
478 Ga0500626_060325 3300053128 Bacteria 1697
479 Ga0500655_027284 3300053133 Bacteria 1089
480 Ga0500559_0022048 3300053136 Bacteria 2701
481 Ga0500559_0111278 3300053136 Bacteria 1269
482 Ga0500564_044060 3300053138 Bacteria 2050
483 Ga0500568_0000833 3300053139 Bacteria 21699
484 Ga0500568_0003231 3300053139 Bacteria 9217
485 Ga0500573_0060874 3300053140 Bacteria 2162
486 Ga0500590_062006 3300053148 Bacteria 1876
487 Ga0500590_122857 3300053148 Bacteria 1214
488 Ga0500603_000033 3300053150 Bacteria 33766
489 Ga0500604_0001087 3300053151 Bacteria 7568
490 Ga0500616_0036946 3300053153 Bacteria 2647
491 Ga0500619_002479 3300053154 Bacteria 3564
492 Ga0500622_0033063 3300053156 Bacteria 2711
493 Ga0500627_0069343 3300053158 Bacteria 1560
494 Ga0500630_002640 3300053159 Bacteria 8624
495 Ga0500638_017996 3300053162 Bacteria 3290
496 Ga0500638_081928 3300053162 Bacteria 1531
497 Ga0500639_000010 3300053163 Bacteria 136747
498 Ga0500636_0000550 3300053177 Bacteria 20404
499 Ga0500637_0004089 3300053178 Bacteria 6863
500 Ga0500637_0171913 3300053178 Bacteria 1245
501 Ga0500625_012573 3300053729 Bacteria 3872
502 Ga0500645_018713 3300053730 Bacteria 2161
503 Ga0500609_007874 3300053731 Bacteria 1437
504 Ga0500596_003343 3300053735 Bacteria 3065
505 Ga0500596_005085 3300053735 Bacteria 2350
506 Ga0500599_003627 3300053736 Bacteria 1890
507 Ga0500601_002579 3300053737 Bacteria 1941
508 Ga0501084_0012218 3300054114 Bacteria 7107
509 Ga0501084_0137570 3300054114 Bacteria 2056
510 Ga0500661_004505 3300055283 Bacteria 2607
511 Ga0500661_004963 3300055283 Bacteria 2494
512 Ga0501082_0149417 3300060353 Bacteria 2029
513 Ga0501082_0326254 3300060353 Bacteria 1338
514 Ga0501082_0398686 3300060353 Bacteria 1201

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10013427 Ga0070710_100134275 263
2 3300005439 Ga0070711_100010842 Ga0070711_1000108424 263
3 3300005548 Ga0070665_100131553 Ga0070665_1001315534 266
4 3300005985 Ga0081539_10074196 Ga0081539_100741963 270
5 3300048915 Ga0496112_0019731 Ga0496112_0019731_5339_6199 271
6 3300031711 Ga0265314_10145643 Ga0265314_101456432 273
7 3300009545 Ga0105237_10206974 Ga0105237_102069741 278
8 3300025904 Ga0207647_10023450 Ga0207647_100234503 278
9 3300025914 Ga0207671_10415543 Ga0207671_104155431 278
10 3300026088 Ga0207641_10715725 Ga0207641_107157251 278
11 3300028379 Ga0268266_10081674 Ga0268266_100816742 278
12 3300046522 Ga0495643_0141688 Ga0495643_0141688_54_914 278
13 3300046694 Ga0495649_0014534 Ga0495649_0014534_250_1110 278
14 iso_pu_bacteria 2507262055 2507510904 278
15 iso_pu_bacteria 2508501009 2508544717 278
16 iso_pu_bacteria 2508501042 2508697055 278
17 iso_pu_bacteria 2511231028 2511394407 278
18 iso_pu_bacteria 2513237094 2513637584 278
19 iso_pu_bacteria 2513237095 2513649570 278
20 iso_pu_bacteria 2513237101 2513697344 278
21 iso_pu_bacteria 2513237139 2513874554 278
22 iso_pu_bacteria 2513237161 2514015542 278
23 iso_pu_bacteria 2517093001 2517100484 278
24 iso_pu_bacteria 2602042107 2603861239 278
25 iso_pu_bacteria 2617270735 2617350662 278
26 iso_pu_bacteria 2721755755 2723843161 278
27 iso_pu_bacteria 2791355196 2793066070 278
28 iso_pu_bacteria 2791355199 2793083135 278
29 iso_pu_bacteria 2802429603 2805916549 278
30 iso_pu_bacteria 2816332527 2818238040 278
31 iso_pu_bacteria 2824600985 2824606136 278
32 iso_pu_bacteria 2824609381 2824616036 278
33 iso_pu_bacteria 2824653114 2824657334 278
34 iso_pu_bacteria 2824671348 2824675555 278
35 iso_pu_bacteria 2824687955 2824692221 278
36 iso_pu_bacteria 2824696289 2824698712 278
37 iso_pu_bacteria 2824704595 2824706515 278
38 iso_pu_bacteria 2824753945 2824756937 278
39 iso_pu_bacteria 2824763712 2824769733 278
40 iso_pu_bacteria 2824773399 2824778475 278
41 iso_pu_bacteria 2838122688 2838127794 278
42 iso_pu_bacteria 2841941048 2841943087 278
43 iso_pu_bacteria 2841949485 2841956108 278
44 iso_pu_bacteria 2841957949 2841960320 278
45 iso_pu_bacteria 2841966195 2841968271 278
46 iso_pu_bacteria 2841974524 2841976515 278
47 iso_pu_bacteria 2841983080 2841987891 278
48 iso_pu_bacteria 2842038055 2842042806 278
49 iso_pu_bacteria 2847930680 2847938466 278
50 iso_pu_bacteria 2847939898 2847944336 278
51 iso_pu_bacteria 2849076700 2849081427 278
52 iso_pu_bacteria 2857509624 2857512086 278
53 iso_pu_bacteria 2874604998 2874612507 278
54 iso_pu_bacteria 2874612657 2874615711 278
55 iso_pu_bacteria 2874620515 2874623531 278
56 iso_pu_bacteria 2876808645 2876810339 278
57 iso_pu_bacteria 2879083081 2879088705 278
58 iso_pu_bacteria 2879110137 2879117953 278
59 iso_pu_bacteria 2879127579 2879132463 278
60 iso_pu_bacteria 2879142872 2879145963 278
61 iso_pu_bacteria 2888388044 2888388989 278
62 iso_pu_bacteria 2888419890 2888422039 278
63 iso_pu_bacteria 2889033259 2889033540 278
64 iso_pu_bacteria 2904666416 2904667665 278
65 iso_pu_bacteria 2904711408 2904719099 278
66 iso_pu_bacteria 2906626472 2906633007 278
67 iso_pu_bacteria 2906643746 2906648256 278
68 iso_pu_bacteria 2922361189 2922362679 278
69 iso_pu_bacteria 2922386360 2922390308 278
70 iso_pu_bacteria 2929615660 2929619691 278
71 iso_pu_bacteria 2929624759 2929627838 278
72 iso_pu_bacteria 2932784394 2932786023 278
73 iso_pu_bacteria 2932794094 2932798205 278
74 iso_pu_bacteria 2932801729 2932803998 278
75 iso_pu_bacteria 2932828146 2932831067 278
76 iso_pu_bacteria 2933577622 2933581610 278
77 iso_pu_bacteria 2935608549 2935612878 278
78 iso_pu_bacteria 2935616580 2935624146 278
79 iso_pu_bacteria 2935648319 2935655004 278
80 iso_pu_bacteria 2935656913 2935663884 278
81 iso_pu_bacteria 2935684952 2935690085 278
82 iso_pu_bacteria 2935694250 2935699833 278
83 iso_pu_bacteria 2935713505 2935722203 278
84 iso_pu_bacteria 2935722832 2935731512 278
85 iso_pu_bacteria 2935732158 2935735400 278
86 iso_pu_bacteria 2935741537 2935745329 278
87 iso_pu_bacteria 2935750917 2935755096 278
88 iso_pu_bacteria 2935769743 2935775424 278
89 iso_pu_bacteria 2935777560 2935780326 278
90 iso_pu_bacteria 2935785616 2935790673 278
91 iso_pu_bacteria 2935793552 2935799144 278
92 iso_pu_bacteria 2935819856 2935824366 278
93 iso_pu_bacteria 2935837841 2935842977 278
94 iso_pu_bacteria 2935847175 2935852489 278
95 iso_pu_bacteria 2935855204 2935862354 278
96 iso_pu_bacteria 2935864058 2935870489 278
97 iso_pu_bacteria 2935873716 2935881071 278
98 iso_pu_bacteria 2935883170 2935884196 278
99 iso_pu_bacteria 2935908558 2935912356 278
100 iso_pu_bacteria 2935916978 2935923970 278
101 iso_pu_bacteria 2935926038 2935929385 278
102 iso_pu_bacteria 2935934488 2935936016 278
103 iso_pu_bacteria 2935942939 2935949916 278
104 iso_pu_bacteria 2935951376 2935957318 278
105 iso_pu_bacteria 2935967501 2935968349 278
106 iso_pu_bacteria 2935984226 2935988020 278
107 iso_pu_bacteria 2936011229 2936018047 278
108 iso_pu_bacteria 2936019824 2936026543 278
109 iso_pu_bacteria 2936028420 2936035286 278
110 iso_pu_bacteria 2936046547 2936053442 278
111 iso_pu_bacteria 2936055302 2936059423 278
112 iso_pu_bacteria 2940556831 2940561624 278
113 iso_pu_bacteria 2941531003 2941533802 278
114 iso_pu_bacteria 2941538514 2941544201 278
115 iso_pu_bacteria 3005506211 3005507226 278
116 iso_pu_bacteria 3005718088 3005719787 278
117 iso_pu_bacteria 8006926726 8006933156 278
118 iso_pu_bacteria 8006964411 8006971322 278
119 iso_pu_bacteria 8006984368 8006989276 278
120 iso_pu_bacteria 8006994254 8006997750 278
121 iso_pu_bacteria 8016511872 8016516313 278
122 iso_pu_bacteria 8016522445 8016523710 278
123 iso_pu_bacteria 8016539877 8016541495 278
124 iso_pu_bacteria 8016548790 8016551758 278
125 iso_pu_bacteria 8016557553 8016560147 278
126 iso_pu_bacteria 8016566248 8016566887 278
127 iso_pu_bacteria 8016575299 8016579617 278
128 iso_pu_bacteria 8016595262 8016598067 278
129 iso_pu_bacteria 8016603502 8016604206 278
130 iso_pu_bacteria 8016613128 8016620787 278
131 iso_pu_bacteria 8016622563 8016629200 278
132 iso_pu_bacteria 8016630954 8016633719 278
133 iso_pu_bacteria 8017057580 8017060220 278
134 iso_pu_bacteria 8019538911 8019542606 278
135 iso_pu_bacteria 8019547302 8019548132 278
136 iso_pu_bacteria 8019576017 8019579742 278
137 iso_pu_bacteria 8019586578 8019587451 278
138 iso_pu_bacteria 8019597564 8019603892 278
139 iso_pu_bacteria 8019608314 8019614647 278
140 iso_pu_bacteria 8019648815 8019649896 278
141 iso_pu_bacteria 8019687851 8019693987 278
142 iso_pu_bacteria 8055742211 8055749053 278
143 iso_pu_bacteria 8056673599 8056674790 278
144 3300005331 Ga0070670_100250598 Ga0070670_1002505983 279
145 3300005455 Ga0070663_100148551 Ga0070663_1001485511 279
146 3300014325 Ga0163163_10169564 Ga0163163_101695642 279
147 3300025904 Ga0207647_10006314 Ga0207647_100063144 279
148 3300025981 Ga0207640_10327865 Ga0207640_103278652 279
149 3300048911 Ga0496108_0445066 Ga0496108_0445066_240_1082 279
150 3300048912 Ga0496109_0078121 Ga0496109_0078121_1165_2007 279
151 3300049586 Ga0501070_0020931 Ga0501070_0020931_3220_4080 279
152 3300005336 Ga0070680_100083477 Ga0070680_1000834772 280
153 3300013297 Ga0157378_10020349 Ga0157378_100203492 280
154 3300039437 Ga0436365_1692740 Ga0436365_1692740_396_1241 280
155 3300048088 Ga0495602_0023281 Ga0495602_0023281_2968_3816 280
156 3300048929 Ga0496126_0535256 Ga0496126_0535256_20_865 280
157 3300053094 Ga0500566_0011048 Ga0500566_0011048_3719_4564 280
158 3300053102 Ga0500554_006967 Ga0500554_006967_413_1258 280
159 3300053136 Ga0500559_0111278 Ga0500559_0111278_229_1074 280
160 3300053148 Ga0500590_122857 Ga0500590_122857_152_997 280
161 3300053162 Ga0500638_017996 Ga0500638_017996_1902_2747 280
162 3300053178 Ga0500637_0004089 Ga0500637_0004089_557_1402 280
163 3300055283 Ga0500661_004505 Ga0500661_004505_1069_1914 280
164 iso_pu_bacteria 2739367866 2740034003 280
165 iso_pu_bacteria 2888378607 2888381643 280
166 iso_pu_bacteria 3005594810 3005596660 280
167 iso_pu_bacteria 3005710791 3005712736 280
168 3300005290 Ga0065712_10207674 Ga0065712_102076741 281
169 3300005354 Ga0070675_100454428 Ga0070675_1004544282 281
170 3300005365 Ga0070688_100046964 Ga0070688_1000469642 281
171 3300005434 Ga0070709_10247026 Ga0070709_102470261 281
172 3300005439 Ga0070711_100020239 Ga0070711_1000202393 281
173 3300005441 Ga0070700_100035249 Ga0070700_1000352492 281
174 3300005466 Ga0070685_10003349 Ga0070685_100033495 281
175 3300005545 Ga0070695_100006254 Ga0070695_1000062546 281
176 3300005844 Ga0068862_100230192 Ga0068862_1002301922 281
177 3300005983 Ga0081540_1096976 Ga0081540_10969761 281
178 3300006175 Ga0070712_100007497 Ga0070712_1000074973 281
179 3300006880 Ga0075429_100372016 Ga0075429_1003720161 281
180 3300009553 Ga0105249_10142541 Ga0105249_101425412 281
181 3300010375 Ga0105239_10034199 Ga0105239_100341992 281
182 3300013105 Ga0157369_10018044 Ga0157369_100180444 281
183 3300013105 Ga0157369_10024585 Ga0157369_100245855 281
184 3300025915 Ga0207693_10002265 Ga0207693_100022656 281
185 3300025916 Ga0207663_10011783 Ga0207663_100117832 281
186 3300025920 Ga0207649_10010910 Ga0207649_100109105 281
187 3300025923 Ga0207681_10509575 Ga0207681_105095751 281
188 3300026075 Ga0207708_10086197 Ga0207708_100861971 281
189 3300026118 Ga0207675_100094377 Ga0207675_1000943772 281
190 3300026142 Ga0207698_10081745 Ga0207698_100817454 281
191 3300028800 Ga0265338_10032423 Ga0265338_100324235 281
192 3300028800 Ga0265338_10246173 Ga0265338_102461732 281
193 3300031238 Ga0265332_10107704 Ga0265332_101077042 281
194 3300031240 Ga0265320_10000413 Ga0265320_1000041314 281
195 3300031241 Ga0265325_10000221 Ga0265325_100002217 281
196 3300031241 Ga0265325_10111208 Ga0265325_101112082 281
197 3300031247 Ga0265340_10115308 Ga0265340_101153081 281
198 3300031249 Ga0265339_10010002 Ga0265339_100100022 281
199 3300031249 Ga0265339_10056013 Ga0265339_100560131 281
200 3300031595 Ga0265313_10000929 Ga0265313_1000092917 281
201 3300031711 Ga0265314_10011420 Ga0265314_100114204 281
202 3300035695 Ga0373927_0291332 Ga0373927_0291332_207_1058 281
203 3300036401 Ga0373937_0003575 Ga0373937_0003575_10066_10917 281
204 3300037068 Ga0373925_0068046 Ga0373925_0068046_242_1093 281
205 3300047472 Ga0495686_0059676 Ga0495686_0059676_848_1699 281
206 3300049460 Ga0495682_0005043 Ga0495682_0005043_4495_5343 281
207 3300049571 Ga0501034_0253069 Ga0501034_0253069_304_1155 281
208 3300049571 Ga0501034_0253582 Ga0501034_0253582_302_1153 281
209 3300053133 Ga0500655_027284 Ga0500655_027284_63_911 281
210 3300060353 Ga0501082_0326254 Ga0501082_0326254_218_1072 281
211 3300003215 JGI25153J46596_10006309 JGI25153J46596_100063095 282
212 3300005336 Ga0070680_100000939 Ga0070680_1000009392 282
213 3300005434 Ga0070709_10000582 Ga0070709_1000058216 282
214 3300005435 Ga0070714_100001277 Ga0070714_10000127720 282
215 3300005436 Ga0070713_100020001 Ga0070713_1000200014 282
216 3300005458 Ga0070681_10000068 Ga0070681_1000006833 282
217 3300005530 Ga0070679_100000301 Ga0070679_10000030131 282
218 3300005536 Ga0070697_100132291 Ga0070697_1001322911 282
219 3300005563 Ga0068855_100000024 Ga0068855_100000024170 282
220 3300005616 Ga0068852_100046750 Ga0068852_1000467503 282
221 3300005983 Ga0081540_1016641 Ga0081540_10166412 282
222 3300006028 Ga0070717_10170129 Ga0070717_101701291 282
223 3300006051 Ga0075364_10025047 Ga0075364_100250473 282
224 3300006163 Ga0070715_10001014 Ga0070715_100010145 282
225 3300006175 Ga0070712_100016816 Ga0070712_1000168163 282
226 3300009093 Ga0105240_10000132 Ga0105240_10000132137 282
227 3300009093 Ga0105240_10069221 Ga0105240_100692212 282
228 3300009177 Ga0105248_10000009 Ga0105248_10000009148 282
229 3300009551 Ga0105238_10039972 Ga0105238_100399724 282
230 3300010375 Ga0105239_10094357 Ga0105239_100943574 282
231 3300010375 Ga0105239_10254765 Ga0105239_102547652 282
232 3300017792 Ga0163161_10072003 Ga0163161_100720031 282
233 3300017792 Ga0163161_10232639 Ga0163161_102326392 282
234 3300021358 Ga0213873_10024394 Ga0213873_100243943 282
235 3300021384 Ga0213876_10006865 Ga0213876_100068655 282
236 3300024227 Ga0228598_1015024 Ga0228598_10150242 282
237 3300025230 Ga0209563_104990 Ga0209563_1049902 282
238 3300025253 Ga0209677_108255 Ga0209677_1082552 282
239 3300025273 Ga0209673_1013333 Ga0209673_10133333 282
240 3300025295 Ga0209564_1009906 Ga0209564_10099064 282
241 3300025295 Ga0209564_1020411 Ga0209564_10204112 282
242 3300025297 Ga0209758_1000141 Ga0209758_100014152 282
243 3300025297 Ga0209758_1000324 Ga0209758_100032439 282
244 3300025297 Ga0209758_1001709 Ga0209758_100170913 282
245 3300025297 Ga0209758_1006410 Ga0209758_10064103 282
246 3300025297 Ga0209758_1027369 Ga0209758_10273693 282
247 3300025299 Ga0209256_1005331 Ga0209256_10053317 282
248 3300025302 Ga0207426_1001139 Ga0207426_100113922 282
249 3300025302 Ga0207426_1035434 Ga0207426_10354342 282
250 3300025302 Ga0207426_1053796 Ga0207426_10537962 282
251 3300025303 Ga0209051_1035927 Ga0209051_10359272 282
252 3300025304 Ga0209257_1009854 Ga0209257_10098542 282
253 3300025898 Ga0207692_10000606 Ga0207692_100006063 282
254 3300025898 Ga0207692_10003679 Ga0207692_100036793 282
255 3300025899 Ga0207642_10078312 Ga0207642_100783122 282
256 3300025900 Ga0207710_10053579 Ga0207710_100535793 282
257 3300025900 Ga0207710_10077240 Ga0207710_100772402 282
258 3300025901 Ga0207688_10014229 Ga0207688_100142295 282
259 3300025905 Ga0207685_10062551 Ga0207685_100625513 282
260 3300025906 Ga0207699_10005515 Ga0207699_100055155 282
261 3300025907 Ga0207645_10132605 Ga0207645_101326052 282
262 3300025907 Ga0207645_10150594 Ga0207645_101505941 282
263 3300025908 Ga0207643_10053352 Ga0207643_100533523 282
264 3300025910 Ga0207684_10096387 Ga0207684_100963873 282
265 3300025911 Ga0207654_10036625 Ga0207654_100366252 282
266 3300025912 Ga0207707_10000002 Ga0207707_100000021121 282
267 3300025913 Ga0207695_10000003 Ga0207695_10000003291 282
268 3300025913 Ga0207695_10000062 Ga0207695_10000062167 282
269 3300025913 Ga0207695_10103092 Ga0207695_101030923 282
270 3300025913 Ga0207695_10150935 Ga0207695_101509352 282
271 3300025914 Ga0207671_10001897 Ga0207671_100018972 282
272 3300025914 Ga0207671_10137170 Ga0207671_101371703 282
273 3300025914 Ga0207671_10159721 Ga0207671_101597212 282
274 3300025914 Ga0207671_10196418 Ga0207671_101964182 282
275 3300025914 Ga0207671_10448385 Ga0207671_104483852 282
276 3300025915 Ga0207693_10005103 Ga0207693_1000510311 282
277 3300025915 Ga0207693_10043784 Ga0207693_100437843 282
278 3300025916 Ga0207663_10054529 Ga0207663_100545293 282
279 3300025917 Ga0207660_10001975 Ga0207660_100019753 282
280 3300025919 Ga0207657_10199384 Ga0207657_101993841 282
281 3300025921 Ga0207652_10000240 Ga0207652_1000024016 282
282 3300025924 Ga0207694_10000016 Ga0207694_10000016263 282
283 3300025924 Ga0207694_10069915 Ga0207694_100699153 282
284 3300025924 Ga0207694_10355109 Ga0207694_103551092 282
285 3300025925 Ga0207650_10359863 Ga0207650_103598632 282
286 3300025927 Ga0207687_10010179 Ga0207687_100101795 282
287 3300025928 Ga0207700_10053214 Ga0207700_100532143 282
288 3300025929 Ga0207664_10006176 Ga0207664_100061763 282
289 3300025929 Ga0207664_10055506 Ga0207664_100555064 282
290 3300025933 Ga0207706_10381257 Ga0207706_103812571 282
291 3300025934 Ga0207686_10246828 Ga0207686_102468283 282
292 3300025935 Ga0207709_10239466 Ga0207709_102394663 282
293 3300025936 Ga0207670_10028423 Ga0207670_100284233 282
294 3300025938 Ga0207704_10024331 Ga0207704_100243315 282
295 3300025938 Ga0207704_10230908 Ga0207704_102309082 282
296 3300025939 Ga0207665_10000580 Ga0207665_1000058026 282
297 3300025940 Ga0207691_10041318 Ga0207691_100413182 282
298 3300025941 Ga0207711_10000003 Ga0207711_10000003475 282
299 3300025941 Ga0207711_10000005 Ga0207711_10000005660 282
300 3300025941 Ga0207711_10000015 Ga0207711_10000015228 282
301 3300025941 Ga0207711_10091611 Ga0207711_100916112 282
302 3300025941 Ga0207711_10133474 Ga0207711_101334742 282
303 3300025944 Ga0207661_10036034 Ga0207661_100360344 282
304 3300025945 Ga0207679_10143273 Ga0207679_101432732 282
305 3300025949 Ga0207667_10000021 Ga0207667_1000002184 282
306 3300025960 Ga0207651_10241270 Ga0207651_102412701 282
307 3300025986 Ga0207658_10131268 Ga0207658_101312681 282
308 3300025986 Ga0207658_10280888 Ga0207658_102808881 282
309 3300026035 Ga0207703_10014806 Ga0207703_100148066 282
310 3300026035 Ga0207703_10124822 Ga0207703_101248224 282
311 3300026035 Ga0207703_10181246 Ga0207703_101812464 282
312 3300026035 Ga0207703_10428425 Ga0207703_104284252 282
313 3300026067 Ga0207678_10019793 Ga0207678_100197934 282
314 3300026067 Ga0207678_10050648 Ga0207678_100506484 282
315 3300026067 Ga0207678_10117343 Ga0207678_101173432 282
316 3300026078 Ga0207702_10004815 Ga0207702_100048153 282
317 3300026088 Ga0207641_10094672 Ga0207641_100946725 282
318 3300026089 Ga0207648_10076107 Ga0207648_100761075 282
319 3300026089 Ga0207648_10088048 Ga0207648_100880483 282
320 3300026095 Ga0207676_10063603 Ga0207676_100636033 282
321 3300026118 Ga0207675_100032581 Ga0207675_1000325816 282
322 3300026118 Ga0207675_100060167 Ga0207675_1000601673 282
323 3300026121 Ga0207683_10018490 Ga0207683_100184904 282
324 3300026121 Ga0207683_10035485 Ga0207683_100354852 282
325 3300026121 Ga0207683_10075529 Ga0207683_100755292 282
326 3300026121 Ga0207683_10200987 Ga0207683_102009872 282
327 3300026142 Ga0207698_10032091 Ga0207698_100320914 282
328 3300026142 Ga0207698_10060819 Ga0207698_100608194 282
329 3300026142 Ga0207698_10262888 Ga0207698_102628881 282
330 3300026142 Ga0207698_10265272 Ga0207698_102652722 282
331 3300027296 Ga0209389_1000004 Ga0209389_1000004100 282
332 3300027361 Ga0209489_100777 Ga0209489_10077754 282
333 3300027363 Ga0209700_100013 Ga0209700_100013186 282
334 3300028379 Ga0268266_10011051 Ga0268266_100110514 282
335 3300028379 Ga0268266_10285848 Ga0268266_102858482 282
336 3300028380 Ga0268265_10053336 Ga0268265_100533365 282
337 3300028380 Ga0268265_10397802 Ga0268265_103978022 282
338 3300028381 Ga0268264_10000038 Ga0268264_1000003811 282
339 3300028381 Ga0268264_10243430 Ga0268264_102434301 282
340 3300028786 Ga0307517_10000085 Ga0307517_1000008520 282
341 3300028800 Ga0265338_10000007 Ga0265338_10000007443 282
342 3300028800 Ga0265338_10155753 Ga0265338_101557531 282
343 3300029957 Ga0265324_10042482 Ga0265324_100424822 282
344 3300030521 Ga0307511_10052126 Ga0307511_100521262 282
345 3300031235 Ga0265330_10099923 Ga0265330_100999232 282
346 3300031240 Ga0265320_10025585 Ga0265320_100255852 282
347 3300031241 Ga0265325_10000001 Ga0265325_10000001343 282
348 3300031241 Ga0265325_10022794 Ga0265325_100227942 282
349 3300031249 Ga0265339_10002071 Ga0265339_100020719 282
350 3300031250 Ga0265331_10003286 Ga0265331_100032868 282
351 3300031344 Ga0265316_10073166 Ga0265316_100731663 282
352 3300031344 Ga0265316_10126120 Ga0265316_101261202 282
353 3300031507 Ga0307509_10055212 Ga0307509_100552124 282
354 3300031507 Ga0307509_10095762 Ga0307509_100957623 282
355 3300031595 Ga0265313_10002900 Ga0265313_1000290010 282
356 3300031616 Ga0307508_10000034 Ga0307508_1000003429 282
357 3300031616 Ga0307508_10299411 Ga0307508_102994112 282
358 3300031665 Ga0316575_10066884 Ga0316575_100668842 282
359 3300031711 Ga0265314_10003279 Ga0265314_100032794 282
360 3300031711 Ga0265314_10043034 Ga0265314_100430342 282
361 3300031711 Ga0265314_10056346 Ga0265314_100563462 282
362 3300031711 Ga0265314_10065061 Ga0265314_100650612 282
363 3300031712 Ga0265342_10027066 Ga0265342_100270663 282
364 3300031712 Ga0265342_10036503 Ga0265342_100365031 282
365 3300031727 Ga0316576_10003264 Ga0316576_100032647 282
366 3300031730 Ga0307516_10012055 Ga0307516_100120553 282
367 3300031730 Ga0307516_10147279 Ga0307516_101472792 282
368 3300031730 Ga0307516_10222631 Ga0307516_102226313 282
369 3300032139 Ga0316580_10065881 Ga0316580_100658811 282
370 3300033179 Ga0307507_10072118 Ga0307507_100721184 282
371 3300033180 Ga0307510_10003336 Ga0307510_100033369 282
372 3300033180 Ga0307510_10129708 Ga0307510_101297082 282
373 3300033180 Ga0307510_10134712 Ga0307510_101347123 282
374 3300034816 Ga0373930_0017130 Ga0373930_0017130_310_1161 282
375 3300035091 Ga0373951_0013454 Ga0373951_0013454_263_1114 282
376 3300035112 Ga0373932_0039539 Ga0373932_0039539_417_1307 282
377 3300035114 Ga0373939_0020564 Ga0373939_0020564_854_1744 282
378 3300035119 Ga0373956_0169285 Ga0373956_0169285_82_936 282
379 3300035242 Ga0373962_0013703 Ga0373962_0013703_224_1114 282
380 3300035242 Ga0373962_0040622 Ga0373962_0040622_96_947 282
381 3300035398 Ga0316574_0160494 Ga0316574_0160494_26_877 282
382 3300035691 Ga0373931_0017054 Ga0373931_0017054_848_1699 282
383 3300035691 Ga0373931_0115566 Ga0373931_0115566_88_978 282
384 3300035692 Ga0373935_0017908 Ga0373935_0017908_560_1411 282
385 3300035695 Ga0373927_0010098 Ga0373927_0010098_4055_4906 282
386 3300035724 Ga0373933_0002876 Ga0373933_0002876_1156_2004 282
387 3300035725 Ga0373947_0019804 Ga0373947_0019804_1774_2625 282
388 3300035725 Ga0373947_0423588 Ga0373947_0423588_22_876 282
389 3300036401 Ga0373937_0517638 Ga0373937_0517638_188_1039 282
390 3300036712 Ga0316584_0260862 Ga0316584_0260862_92_943 282
391 3300037068 Ga0373925_0108119 Ga0373925_0108119_276_1127 282
392 3300037068 Ga0373925_0351276 Ga0373925_0351276_225_1076 282
393 3300037471 Ga0395905_0008003 Ga0395905_0008003_346_1194 282
394 3300037471 Ga0395905_0178275 Ga0395905_0178275_758_1609 282
395 3300037471 Ga0395905_0389908 Ga0395905_0389908_338_1189 282
396 3300038443 Ga0395901_0321760 Ga0395901_0321760_252_1100 282
397 3300039437 Ga0436365_0211858 Ga0436365_0211858_2804_3655 282
398 3300039437 Ga0436365_1017537 Ga0436365_1017537_2618_3472 282
399 3300039438 Ga0436360_1321389 Ga0436360_1321389_128_979 282
400 3300039447 Ga0436361_0818803 Ga0436361_0818803_1314_2165 282
401 3300039450 Ga0436363_0020937 Ga0436363_0020937_18_869 282
402 3300039450 Ga0436363_1486701 Ga0436363_1486701_471_1322 282
403 3300039453 Ga0436362_0128483 Ga0436362_0128483_3691_4542 282
404 3300039453 Ga0436362_1240820 Ga0436362_1240820_2487_3338 282
405 3300044673 Ga0453683_0014438 Ga0453683_0014438_4187_5044 282
406 3300044684 Ga0466966_0000419 Ga0466966_0000419_18785_19636 282
407 3300044693 Ga0466961_0000020 Ga0466961_0000020_64979_65830 282
408 3300045049 Ga0466959_0023409 Ga0466959_0023409_385_1236 282
409 3300045051 Ga0451576_0000242 Ga0451576_0000242_77037_77894 282
410 3300045051 Ga0451576_0353520 Ga0451576_0353520_176_1027 282
411 3300046454 Ga0495592_0014283 Ga0495592_0014283_1081_1932 282
412 3300046454 Ga0495592_0057877 Ga0495592_0057877_624_1622 282
413 3300046455 Ga0495603_0004299 Ga0495603_0004299_3858_4709 282
414 3300046459 Ga0495629_0101341 Ga0495629_0101341_397_1248 282
415 3300046459 Ga0495629_0101425 Ga0495629_0101425_1017_1868 282
416 3300046460 Ga0495638_0020663 Ga0495638_0020663_1864_2712 282
417 3300046460 Ga0495638_0032262 Ga0495638_0032262_1664_2515 282
418 3300046460 Ga0495638_0042046 Ga0495638_0042046_1212_2063 282
419 3300046462 Ga0495651_0002943 Ga0495651_0002943_9937_10788 282
420 3300046462 Ga0495651_0025932 Ga0495651_0025932_1358_2209 282
421 3300046462 Ga0495651_0085487 Ga0495651_0085487_520_1371 282
422 3300046462 Ga0495651_0217327 Ga0495651_0217327_390_1244 282
423 3300046462 Ga0495651_0248930 Ga0495651_0248930_71_922 282
424 3300046474 Ga0495605_0046795 Ga0495605_0046795_1048_1899 282
425 3300046477 Ga0495664_0230356 Ga0495664_0230356_96_947 282
426 3300046507 Ga0495606_0023769 Ga0495606_0023769_3289_4140 282
427 3300046507 Ga0495606_0048670 Ga0495606_0048670_1198_2049 282
428 3300046507 Ga0495606_0176022 Ga0495606_0176022_266_1117 282
429 3300046511 Ga0495608_0025823 Ga0495608_0025823_2832_3683 282
430 3300046511 Ga0495608_0168866 Ga0495608_0168866_97_1026 282
431 3300046513 Ga0495616_0057330 Ga0495616_0057330_712_1563 282
432 3300046514 Ga0495618_0043410 Ga0495618_0043410_903_1754 282
433 3300046514 Ga0495618_0269510 Ga0495618_0269510_97_1005 282
434 3300046516 Ga0495628_0055958 Ga0495628_0055958_578_1576 282
435 3300046517 Ga0495630_0151444 Ga0495630_0151444_191_1042 282
436 3300046522 Ga0495643_0048901 Ga0495643_0048901_341_1189 282
437 3300046522 Ga0495643_0053422 Ga0495643_0053422_208_1059 282
438 3300046522 Ga0495643_0073092 Ga0495643_0073092_608_1459 282
439 3300046523 Ga0495644_0120921 Ga0495644_0120921_20_871 282
440 3300046529 Ga0495652_0020012 Ga0495652_0020012_16_867 282
441 3300046533 Ga0495640_0029617 Ga0495640_0029617_83_934 282
442 3300046536 Ga0495587_0115593 Ga0495587_0115593_336_1190 282
443 3300046536 Ga0495587_0116821 Ga0495587_0116821_598_1449 282
444 3300046557 Ga0495622_0037345 Ga0495622_0037345_789_1640 282
445 3300046557 Ga0495622_0060902 Ga0495622_0060902_852_1703 282
446 3300046559 Ga0495667_0235608 Ga0495667_0235608_259_1110 282
447 3300046615 Ga0495656_0013292 Ga0495656_0013292_393_1244 282
448 3300046615 Ga0495656_0017604 Ga0495656_0017604_1396_2247 282
449 3300046642 Ga0495634_0111264 Ga0495634_0111264_701_1552 282
450 3300046648 Ga0495611_0009307 Ga0495611_0009307_1594_2445 282
451 3300046660 Ga0495625_0097509 Ga0495625_0097509_99_947 282
452 3300046660 Ga0495625_0116234 Ga0495625_0116234_75_926 282
453 3300046660 Ga0495625_0173233 Ga0495625_0173233_228_1079 282
454 3300046663 Ga0495635_0106465 Ga0495635_0106465_937_1788 282
455 3300046663 Ga0495635_0260853 Ga0495635_0260853_85_936 282
456 3300046664 Ga0495659_0030718 Ga0495659_0030718_847_1698 282
457 3300046664 Ga0495659_0034014 Ga0495659_0034014_736_1587 282
458 3300046674 Ga0495588_0033223 Ga0495588_0033223_508_1359 282
459 3300046674 Ga0495588_0173464 Ga0495588_0173464_219_1070 282
460 3300046675 Ga0495657_0022214 Ga0495657_0022214_881_1732 282
461 3300046675 Ga0495657_0095210 Ga0495657_0095210_14_865 282
462 3300046678 Ga0495599_0111102 Ga0495599_0111102_538_1392 282
463 3300046679 Ga0495623_0020931 Ga0495623_0020931_1385_2383 282
464 3300046679 Ga0495623_0046161 Ga0495623_0046161_1033_1884 282
465 3300046680 Ga0495646_0023266 Ga0495646_0023266_2812_3663 282
466 3300046684 Ga0495669_0002200 Ga0495669_0002200_4262_5113 282
467 3300046689 Ga0495613_0295144 Ga0495613_0295144_11_865 282
468 3300046690 Ga0495624_0097946 Ga0495624_0097946_286_1137 282
469 3300046694 Ga0495649_0033655 Ga0495649_0033655_180_1031 282
470 3300046809 Ga0495600_0003794 Ga0495600_0003794_1748_2599 282
471 3300046809 Ga0495600_0050620 Ga0495600_0050620_1006_1857 282
472 3300047317 Ga0495604_0024585 Ga0495604_0024585_3350_4201 282
473 3300047317 Ga0495604_0034404 Ga0495604_0034404_1453_2304 282
474 3300047317 Ga0495604_0038058 Ga0495604_0038058_486_1484 282
475 3300047318 Ga0495636_0085627 Ga0495636_0085627_115_966 282
476 3300047318 Ga0495636_0123217 Ga0495636_0123217_135_986 282
477 3300047319 Ga0495674_0507609 Ga0495674_0507609_85_936 282
478 3300047320 Ga0495672_0014045 Ga0495672_0014045_394_1245 282
479 3300047320 Ga0495672_0042911 Ga0495672_0042911_368_1219 282
480 3300047321 Ga0495676_0365702 Ga0495676_0365702_48_899 282
481 3300047322 Ga0495680_0190465 Ga0495680_0190465_347_1198 282
482 3300047445 Ga0495677_0032747 Ga0495677_0032747_806_1657 282
483 3300047471 Ga0495684_0117067 Ga0495684_0117067_853_1704 282
484 3300047471 Ga0495684_0131539 Ga0495684_0131539_19_870 282
485 3300047472 Ga0495686_0061185 Ga0495686_0061185_270_1121 282
486 3300047472 Ga0495686_0242226 Ga0495686_0242226_19_870 282
487 3300048088 Ga0495602_0107207 Ga0495602_0107207_674_1525 282
488 3300048903 Ga0496100_0053153 Ga0496100_0053153_128_979 282
489 3300048904 Ga0496101_0004586 Ga0496101_0004586_7767_8618 282
490 3300048905 Ga0496102_0007305 Ga0496102_0007305_3746_4597 282
491 3300048905 Ga0496102_0052186 Ga0496102_0052186_2829_3680 282
492 3300048906 Ga0496103_0010719 Ga0496103_0010719_1043_1894 282
493 3300048906 Ga0496103_0041718 Ga0496103_0041718_296_1147 282
494 3300048906 Ga0496103_0194998 Ga0496103_0194998_289_1140 282
495 3300048907 Ga0496104_0027060 Ga0496104_0027060_1835_2686 282
496 3300048907 Ga0496104_0054323 Ga0496104_0054323_2736_3587 282
497 3300048907 Ga0496104_0099919 Ga0496104_0099919_307_1158 282
498 3300048908 Ga0496105_0077493 Ga0496105_0077493_666_1517 282
499 3300048908 Ga0496105_0084786 Ga0496105_0084786_903_1754 282
500 3300048908 Ga0496105_0182208 Ga0496105_0182208_663_1514 282
501 3300048908 Ga0496105_0223467 Ga0496105_0223467_588_1439 282
502 3300048909 Ga0496106_0005619 Ga0496106_0005619_3502_4353 282
503 3300048909 Ga0496106_0017753 Ga0496106_0017753_2088_2939 282
504 3300048909 Ga0496106_0066022 Ga0496106_0066022_643_1494 282
505 3300048909 Ga0496106_0135990 Ga0496106_0135990_162_1013 282
506 3300048910 Ga0496107_0000808 Ga0496107_0000808_7753_8604 282
507 3300048910 Ga0496107_0034118 Ga0496107_0034118_1650_2501 282
508 3300048911 Ga0496108_0018943 Ga0496108_0018943_214_1065 282
509 3300048911 Ga0496108_0044389 Ga0496108_0044389_115_966 282
510 3300048912 Ga0496109_0427324 Ga0496109_0427324_277_1128 282
511 3300048913 Ga0496110_0297108 Ga0496110_0297108_303_1154 282
512 3300048913 Ga0496110_0371834 Ga0496110_0371834_245_1096 282
513 3300048914 Ga0496111_0016617 Ga0496111_0016617_842_1693 282
514 3300048914 Ga0496111_0225778 Ga0496111_0225778_433_1284 282
515 3300048915 Ga0496112_0000008 Ga0496112_0000008_79740_80591 282
516 3300048915 Ga0496112_0058241 Ga0496112_0058241_42_893 282
517 3300048915 Ga0496112_0064765 Ga0496112_0064765_1810_2661 282
518 3300048915 Ga0496112_0119981 Ga0496112_0119981_1114_1965 282
519 3300048916 Ga0496113_0009715 Ga0496113_0009715_326_1177 282
520 3300048916 Ga0496113_0043860 Ga0496113_0043860_1001_1852 282
521 3300048917 Ga0496114_0026566 Ga0496114_0026566_902_1753 282
522 3300048917 Ga0496114_0042858 Ga0496114_0042858_1620_2471 282
523 3300048917 Ga0496114_0044410 Ga0496114_0044410_1836_2687 282
524 3300048918 Ga0496115_0041375 Ga0496115_0041375_2067_2918 282
525 3300048918 Ga0496115_0186259 Ga0496115_0186259_378_1229 282
526 3300048919 Ga0496116_0004266 Ga0496116_0004266_7423_8280 282
527 3300048919 Ga0496116_0060416 Ga0496116_0060416_530_1381 282
528 3300048921 Ga0496118_0064136 Ga0496118_0064136_899_1750 282
529 3300048921 Ga0496118_0132685 Ga0496118_0132685_153_1004 282
530 3300048921 Ga0496118_0157147 Ga0496118_0157147_130_987 282
531 3300048921 Ga0496118_0254340 Ga0496118_0254340_113_964 282
532 3300048922 Ga0496119_0012771 Ga0496119_0012771_4361_5212 282
533 3300048922 Ga0496119_0031235 Ga0496119_0031235_636_1487 282
534 3300048922 Ga0496119_0052000 Ga0496119_0052000_1278_2129 282
535 3300048922 Ga0496119_0126030 Ga0496119_0126030_219_1070 282
536 3300048923 Ga0496120_0048159 Ga0496120_0048159_846_1703 282
537 3300048923 Ga0496120_0076050 Ga0496120_0076050_180_1028 282
538 3300048924 Ga0496121_0000099 Ga0496121_0000099_3976_4827 282
539 3300048924 Ga0496121_0000178 Ga0496121_0000178_23514_24365 282
540 3300048924 Ga0496121_0142291 Ga0496121_0142291_489_1340 282
541 3300048924 Ga0496121_0179020 Ga0496121_0179020_639_1490 282
542 3300048924 Ga0496121_0202130 Ga0496121_0202130_501_1352 282
543 3300048925 Ga0496122_0217945 Ga0496122_0217945_147_998 282
544 3300048927 Ga0496124_0008073 Ga0496124_0008073_6949_7800 282
545 3300048927 Ga0496124_0053777 Ga0496124_0053777_2316_3167 282
546 3300048927 Ga0496124_0401555 Ga0496124_0401555_60_911 282
547 3300048928 Ga0496125_0018440 Ga0496125_0018440_1838_2695 282
548 3300048928 Ga0496125_0051098 Ga0496125_0051098_164_1015 282
549 3300048929 Ga0496126_0025411 Ga0496126_0025411_3507_4358 282
550 3300048929 Ga0496126_0064343 Ga0496126_0064343_2079_2930 282
551 3300048929 Ga0496126_0122538 Ga0496126_0122538_775_1626 282
552 3300048929 Ga0496126_0143836 Ga0496126_0143836_1098_1946 282
553 3300048929 Ga0496126_0243471 Ga0496126_0243471_443_1294 282
554 3300048929 Ga0496126_0361982 Ga0496126_0361982_247_1098 282
555 3300048929 Ga0496126_0393619 Ga0496126_0393619_230_1081 282
556 3300049460 Ga0495682_0011847 Ga0495682_0011847_1971_2822 282
557 3300049571 Ga0501034_0021712 Ga0501034_0021712_490_1371 282
558 3300049573 Ga0501037_0220515 Ga0501037_0220515_234_1115 282
559 3300049581 Ga0501047_0016854 Ga0501047_0016854_328_1209 282
560 3300049581 Ga0501047_0266391 Ga0501047_0266391_608_1459 282
561 3300049583 Ga0501067_0003070 Ga0501067_0003070_4594_5475 282
562 3300049585 Ga0501069_0003810 Ga0501069_0003810_4376_5257 282
563 3300049585 Ga0501069_0080351 Ga0501069_0080351_971_1822 282
564 3300049586 Ga0501070_0021099 Ga0501070_0021099_603_1484 282
565 3300049586 Ga0501070_0141316 Ga0501070_0141316_499_1350 282
566 3300049588 Ga0501072_0060304 Ga0501072_0060304_1044_1895 282
567 3300049590 Ga0501074_0061029 Ga0501074_0061029_1562_2443 282
568 3300049741 Ga0501079_0001956 Ga0501079_0001956_13881_14732 282
569 3300049822 Ga0501035_0002651 Ga0501035_0002651_3217_4098 282
570 3300049823 Ga0501044_0142405 Ga0501044_0142405_609_1460 282
571 3300049823 Ga0501044_0145560 Ga0501044_0145560_754_1635 282
572 3300050489 nmdc:mga03683_83186_c1 nmdc:mga03683_83186_c1_439_1290 282
573 3300050491 nmdc:mga00v17_219998_c1 nmdc:mga00v17_219998_c1_341_1192 282
574 3300050491 nmdc:mga00v17_31325_c1 nmdc:mga00v17_31325_c1_989_1846 282
575 3300050492 nmdc:mga0yw44_101657_c1 nmdc:mga0yw44_101657_c1_328_1179 282
576 3300050492 nmdc:mga0yw44_44260_c1 nmdc:mga0yw44_44260_c1_878_1729 282
577 3300050493 nmdc:mga0k408_125943_c1 nmdc:mga0k408_125943_c1_367_1215 282
578 3300050494 nmdc:mga06z11_127663_c1 nmdc:mga06z11_127663_c1_76_927 282
579 3300050494 nmdc:mga06z11_4441_c1 nmdc:mga06z11_4441_c1_1688_2539 282
580 3300050496 nmdc:mga07m45_237815_c1 nmdc:mga07m45_237815_c1_140_991 282
581 3300050507 nmdc:mga05p37_69657_c1 nmdc:mga05p37_69657_c1_1063_1914 282
582 3300050511 nmdc:mga08y16_190300_c1 nmdc:mga08y16_190300_c1_981_1832 282
583 3300050511 nmdc:mga08y16_220898_c1 nmdc:mga08y16_220898_c1_480_1331 282
584 3300050516 nmdc:mga0sz30_15258_c1 nmdc:mga0sz30_15258_c1_329_1180 282
585 3300053077 Ga0495601_0136919 Ga0495601_0136919_252_1106 282
586 3300053080 Ga0500635_0001453 Ga0500635_0001453_1641_2492 282
587 3300053084 Ga0495595_0089780 Ga0495595_0089780_575_1426 282
588 3300053084 Ga0495595_0138699 Ga0495595_0138699_305_1156 282
589 3300053085 Ga0495619_0097184 Ga0495619_0097184_705_1556 282
590 3300053086 Ga0500578_0170974 Ga0500578_0170974_263_1114 282
591 3300053087 Ga0500643_000018 Ga0500643_000018_282920_283771 282
592 3300053091 Ga0500647_0018541 Ga0500647_0018541_914_1765 282
593 3300053091 Ga0500647_0052730 Ga0500647_0052730_844_1695 282
594 3300053093 Ga0500651_0005607 Ga0500651_0005607_5703_6554 282
595 3300053094 Ga0500566_0000008 Ga0500566_0000008_69677_70528 282
596 3300053094 Ga0500566_0005804 Ga0500566_0005804_5642_6493 282
597 3300053095 Ga0500640_127704 Ga0500640_127704_37_888 282
598 3300053096 Ga0500641_0013157 Ga0500641_0013157_1530_2378 282
599 3300053096 Ga0500641_0054600 Ga0500641_0054600_605_1456 282
600 3300053098 Ga0500650_0000650 Ga0500650_0000650_1961_2809 282
601 3300053098 Ga0500650_0110326 Ga0500650_0110326_414_1265 282
602 3300053103 Ga0500555_004973 Ga0500555_004973_844_1695 282
603 3300053104 Ga0500556_0067726 Ga0500556_0067726_75_926 282
604 3300053104 Ga0500556_0120649 Ga0500556_0120649_112_963 282
605 3300053105 Ga0500557_000008 Ga0500557_000008_101353_102204 282
606 3300053108 Ga0500562_010666 Ga0500562_010666_291_1142 282
607 3300053109 Ga0500569_050354 Ga0500569_050354_61_912 282
608 3300053111 Ga0500572_000613 Ga0500572_000613_2441_3292 282
609 3300053115 Ga0500591_017145 Ga0500591_017145_154_1005 282
610 3300053119 Ga0500595_007004 Ga0500595_007004_940_1791 282
611 3300053119 Ga0500595_007694 Ga0500595_007694_3043_3894 282
612 3300053119 Ga0500595_015175 Ga0500595_015175_870_1721 282
613 3300053119 Ga0500595_026858 Ga0500595_026858_946_1797 282
614 3300053119 Ga0500595_040960 Ga0500595_040960_583_1434 282
615 3300053122 Ga0500608_011051 Ga0500608_011051_962_1813 282
616 3300053122 Ga0500608_088447 Ga0500608_088447_177_1028 282
617 3300053123 Ga0500614_003090 Ga0500614_003090_473_1324 282
618 3300053126 Ga0500621_071249 Ga0500621_071249_484_1335 282
619 3300053128 Ga0500626_060325 Ga0500626_060325_128_979 282
620 3300053136 Ga0500559_0022048 Ga0500559_0022048_1225_2076 282
621 3300053138 Ga0500564_044060 Ga0500564_044060_1045_1896 282
622 3300053139 Ga0500568_0000833 Ga0500568_0000833_9878_10726 282
623 3300053139 Ga0500568_0003231 Ga0500568_0003231_3822_4673 282
624 3300053140 Ga0500573_0060874 Ga0500573_0060874_911_1762 282
625 3300053148 Ga0500590_062006 Ga0500590_062006_887_1738 282
626 3300053150 Ga0500603_000033 Ga0500603_000033_30258_31109 282
627 3300053151 Ga0500604_0001087 Ga0500604_0001087_5871_6719 282
628 3300053153 Ga0500616_0036946 Ga0500616_0036946_1410_2261 282
629 3300053154 Ga0500619_002479 Ga0500619_002479_2550_3398 282
630 3300053156 Ga0500622_0033063 Ga0500622_0033063_526_1377 282
631 3300053158 Ga0500627_0069343 Ga0500627_0069343_62_913 282
632 3300053159 Ga0500630_002640 Ga0500630_002640_5824_6675 282
633 3300053162 Ga0500638_081928 Ga0500638_081928_354_1205 282
634 3300053163 Ga0500639_000010 Ga0500639_000010_96389_97240 282
635 3300053177 Ga0500636_0000550 Ga0500636_0000550_5594_6445 282
636 3300053178 Ga0500637_0171913 Ga0500637_0171913_11_862 282
637 3300053729 Ga0500625_012573 Ga0500625_012573_1363_2214 282
638 3300053730 Ga0500645_018713 Ga0500645_018713_240_1088 282
639 3300053731 Ga0500609_007874 Ga0500609_007874_555_1406 282
640 3300053735 Ga0500596_003343 Ga0500596_003343_1395_2246 282
641 3300053735 Ga0500596_005085 Ga0500596_005085_1001_1852 282
642 3300053736 Ga0500599_003627 Ga0500599_003627_993_1844 282
643 3300053737 Ga0500601_002579 Ga0500601_002579_358_1209 282
644 3300054114 Ga0501084_0012218 Ga0501084_0012218_1362_2243 282
645 3300054114 Ga0501084_0137570 Ga0501084_0137570_551_1402 282
646 3300055283 Ga0500661_004963 Ga0500661_004963_420_1271 282
647 3300060353 Ga0501082_0149417 Ga0501082_0149417_242_1123 282
648 3300060353 Ga0501082_0398686 Ga0501082_0398686_253_1104 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

50

247

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

56

266

0.92

PF08659

KR

KR domain

50

237

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9334 1 253
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9278 2 253
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9203 2 256
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9169 1 253
2nwq-assembly1.cif.gz_A short chain dehydrogenase from pseudomonas aeruginosa 0.9144 1 253
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9333 2 185 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9303 85 185 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9301 2 253 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9273 2 88 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9219 2 196 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3S0FLQ2-F1-model_v4 deleted 0.9999 1 192
AF-A0A2M8ZND5-F1-model_v4 deleted 0.9926 1 282
AF-A0A3C0M730-F1-model_v4 Oxidoreductase 0.9926 1 241 GO:0008202
GO:0016491
AF-A0A7C9BMA6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.99 2 186 GO:0016491
AF-A0A3S0FLQ2-F1-model_v4 deleted 0.9896 1 192

Feature Viewer

pLDDT pTM Quality
93.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map