F472396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 648 | 433 | 514 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0057877|Ga0495592_0057877_624_1622 |
| Length | 332 |
| Sequence | VLATANASIKKLRRNIMPVLPRPHYAIAETWGAAVGAVNPSTPREEGGMRSVVITGTSTGIGWGAAKVLIANSFRVFGSVRKRADADRLKAEFGQSYVPLLFDVTDAGAVKEAAAEVRAALAGETLAGLVNNAGVAVAGPLLELPVEEFRRQIEINLVGVVIVTQAFAPLLGTDRGLKGNPGRIVNISSVGGRIGNPFLAPYVASKFALEGLSESLRRELLPFGIDVIVIAPGAVATPIWAKAEQVDVSLYRNTPYAAPLDRLRNYMLMLGKQGLPPERIGEAVRHALTAAKPKVRYTVTPTPVQNWLATNLPKRVVDRMVGSRLGLLPKKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 9 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 10 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 14 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 15 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 16 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 17 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 18 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 19 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 20 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 21 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 22 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 23 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 24 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 25 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 26 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 27 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 28 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 29 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 30 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 31 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 32 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 33 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 34 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 35 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 36 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 37 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 38 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 39 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 40 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 41 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 42 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 43 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 44 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 45 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 46 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 47 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 48 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 49 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 50 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 51 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 52 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 53 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 54 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 55 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 56 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 57 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 58 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 59 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 60 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 61 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 62 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 63 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 64 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 65 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 66 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 67 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 68 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 69 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 70 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 71 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 72 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 73 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 74 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 75 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 76 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 77 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 78 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 79 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 80 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 81 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 82 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 83 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 84 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 85 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 86 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 87 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 88 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 89 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 90 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 91 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 92 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 93 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 94 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 95 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 96 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 97 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 98 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 99 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 100 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 101 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 102 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 103 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 104 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 105 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 106 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 107 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 108 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 109 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 121 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 127 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 128 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 129 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 130 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 131 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 133 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 235 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 236 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 237 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 243 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 358 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 361 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 363 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 364 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 369 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 372 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 373 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 374 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 376 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 378 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 379 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 380 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 386 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 392 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 394 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 398 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 406 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 408 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 409 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 410 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 411 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 412 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 413 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 414 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 415 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 416 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 417 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 418 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 419 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 420 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 421 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 422 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 423 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 424 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 425 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 426 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 427 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 428 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 429 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 430 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 431 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 432 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 433 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.44 |
| Metatranscriptomes | 0 |
| Isolates | 20.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.2 |
| Nodule | 16.2 |
| Rhizoplane | 6.48 |
| Rhizosphere | 50.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10006309 | 3300003215 | Bacteria | 6036 |
| 2 | Ga0065712_10207674 | 3300005290 | Bacteria | 1084 |
| 3 | Ga0070670_100250598 | 3300005331 | Bacteria | 1543 |
| 4 | Ga0070680_100000939 | 3300005336 | Bacteria | 20604 |
| 5 | Ga0070680_100083477 | 3300005336 | Bacteria | 2638 |
| 6 | Ga0070675_100454428 | 3300005354 | Bacteria | 1149 |
| 7 | Ga0070688_100046964 | 3300005365 | Bacteria | 2676 |
| 8 | Ga0070709_10000582 | 3300005434 | Bacteria | 21380 |
| 9 | Ga0070709_10247026 | 3300005434 | Bacteria | 1284 |
| 10 | Ga0070714_100001277 | 3300005435 | Bacteria | 18205 |
| 11 | Ga0070713_100020001 | 3300005436 | Bacteria | 5124 |
| 12 | Ga0070710_10013427 | 3300005437 | Bacteria | 4103 |
| 13 | Ga0070711_100010842 | 3300005439 | Bacteria | 5650 |
| 14 | Ga0070711_100020239 | 3300005439 | Bacteria | 4284 |
| 15 | Ga0070700_100035249 | 3300005441 | Bacteria | 3027 |
| 16 | Ga0070663_100148551 | 3300005455 | Bacteria | 1795 |
| 17 | Ga0070681_10000068 | 3300005458 | Bacteria | 75693 |
| 18 | Ga0070685_10003349 | 3300005466 | Bacteria | 8155 |
| 19 | Ga0070679_100000301 | 3300005530 | Bacteria | 42204 |
| 20 | Ga0070697_100132291 | 3300005536 | Bacteria | 2093 |
| 21 | Ga0070695_100006254 | 3300005545 | Bacteria | 7034 |
| 22 | Ga0070665_100131553 | 3300005548 | Bacteria | 2504 |
| 23 | Ga0068855_100000024 | 3300005563 | Bacteria | 184241 |
| 24 | Ga0068852_100046750 | 3300005616 | Bacteria | 3689 |
| 25 | Ga0068862_100230192 | 3300005844 | Bacteria | 1681 |
| 26 | Ga0081540_1016641 | 3300005983 | Bacteria | 4590 |
| 27 | Ga0081540_1096976 | 3300005983 | Bacteria | 1281 |
| 28 | Ga0081539_10074196 | 3300005985 | Bacteria | 1812 |
| 29 | Ga0070717_10170129 | 3300006028 | Bacteria | 1894 |
| 30 | Ga0075364_10025047 | 3300006051 | Bacteria | 3795 |
| 31 | Ga0070715_10001014 | 3300006163 | Bacteria | 7909 |
| 32 | Ga0070712_100007497 | 3300006175 | Bacteria | 6815 |
| 33 | Ga0070712_100016816 | 3300006175 | Bacteria | 4730 |
| 34 | Ga0075429_100372016 | 3300006880 | Bacteria | 1251 |
| 35 | Ga0105240_10000132 | 3300009093 | Bacteria | 152512 |
| 36 | Ga0105240_10069221 | 3300009093 | Bacteria | 4369 |
| 37 | Ga0105248_10000009 | 3300009177 | Bacteria | 403549 |
| 38 | Ga0105237_10206974 | 3300009545 | Bacteria | 1962 |
| 39 | Ga0105238_10039972 | 3300009551 | Bacteria | 4754 |
| 40 | Ga0105249_10142541 | 3300009553 | Bacteria | 2299 |
| 41 | Ga0105239_10034199 | 3300010375 | Bacteria | 5580 |
| 42 | Ga0105239_10094357 | 3300010375 | Bacteria | 3305 |
| 43 | Ga0105239_10254765 | 3300010375 | Bacteria | 1971 |
| 44 | Ga0157369_10018044 | 3300013105 | Bacteria | 7916 |
| 45 | Ga0157369_10024585 | 3300013105 | Bacteria | 6697 |
| 46 | Ga0157378_10020349 | 3300013297 | Bacteria | 5837 |
| 47 | Ga0163163_10169564 | 3300014325 | Bacteria | 2229 |
| 48 | Ga0163161_10072003 | 3300017792 | Bacteria | 2530 |
| 49 | Ga0163161_10232639 | 3300017792 | Bacteria | 1431 |
| 50 | Ga0213873_10024394 | 3300021358 | Bacteria | 1451 |
| 51 | Ga0213876_10006865 | 3300021384 | Bacteria | 6204 |
| 52 | Ga0228598_1015024 | 3300024227 | Bacteria | 1529 |
| 53 | Ga0209563_104990 | 3300025230 | Bacteria | 2464 |
| 54 | Ga0209677_108255 | 3300025253 | Bacteria | 2048 |
| 55 | Ga0209673_1013333 | 3300025273 | Bacteria | 3250 |
| 56 | Ga0209564_1009906 | 3300025295 | Bacteria | 4462 |
| 57 | Ga0209564_1020411 | 3300025295 | Bacteria | 2427 |
| 58 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 59 | Ga0209758_1000324 | 3300025297 | Bacteria | 91475 |
| 60 | Ga0209758_1001709 | 3300025297 | Bacteria | 24609 |
| 61 | Ga0209758_1006410 | 3300025297 | Bacteria | 8472 |
| 62 | Ga0209758_1027369 | 3300025297 | Bacteria | 2437 |
| 63 | Ga0209256_1005331 | 3300025299 | Bacteria | 7476 |
| 64 | Ga0207426_1001139 | 3300025302 | Bacteria | 24022 |
| 65 | Ga0207426_1035434 | 3300025302 | Bacteria | 1592 |
| 66 | Ga0207426_1053796 | 3300025302 | Bacteria | 1187 |
| 67 | Ga0209051_1035927 | 3300025303 | Bacteria | 1837 |
| 68 | Ga0209257_1009854 | 3300025304 | Bacteria | 4992 |
| 69 | Ga0207692_10000606 | 3300025898 | Bacteria | 12643 |
| 70 | Ga0207692_10003679 | 3300025898 | Bacteria | 6009 |
| 71 | Ga0207642_10078312 | 3300025899 | Bacteria | 1597 |
| 72 | Ga0207710_10053579 | 3300025900 | Bacteria | 1815 |
| 73 | Ga0207710_10077240 | 3300025900 | Bacteria | 1538 |
| 74 | Ga0207688_10014229 | 3300025901 | Bacteria | 4329 |
| 75 | Ga0207647_10006314 | 3300025904 | Bacteria | 8627 |
| 76 | Ga0207647_10023450 | 3300025904 | Bacteria | 4080 |
| 77 | Ga0207685_10062551 | 3300025905 | Bacteria | 1479 |
| 78 | Ga0207699_10005515 | 3300025906 | Bacteria | 6063 |
| 79 | Ga0207645_10132605 | 3300025907 | Bacteria | 1622 |
| 80 | Ga0207645_10150594 | 3300025907 | Bacteria | 1518 |
| 81 | Ga0207643_10053352 | 3300025908 | Bacteria | 2297 |
| 82 | Ga0207684_10096387 | 3300025910 | Bacteria | 2525 |
| 83 | Ga0207654_10036625 | 3300025911 | Bacteria | 2742 |
| 84 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 85 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 86 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 87 | Ga0207695_10103092 | 3300025913 | Bacteria | 2845 |
| 88 | Ga0207695_10150935 | 3300025913 | Bacteria | 2263 |
| 89 | Ga0207671_10001897 | 3300025914 | Bacteria | 23245 |
| 90 | Ga0207671_10137170 | 3300025914 | Bacteria | 1882 |
| 91 | Ga0207671_10159721 | 3300025914 | Bacteria | 1745 |
| 92 | Ga0207671_10196418 | 3300025914 | Bacteria | 1574 |
| 93 | Ga0207671_10415543 | 3300025914 | Bacteria | 1070 |
| 94 | Ga0207671_10448385 | 3300025914 | Bacteria | 1028 |
| 95 | Ga0207693_10002265 | 3300025915 | Bacteria | 16743 |
| 96 | Ga0207693_10005103 | 3300025915 | Bacteria | 11007 |
| 97 | Ga0207693_10043784 | 3300025915 | Bacteria | 3520 |
| 98 | Ga0207663_10011783 | 3300025916 | Bacteria | 4708 |
| 99 | Ga0207663_10054529 | 3300025916 | Bacteria | 2504 |
| 100 | Ga0207660_10001975 | 3300025917 | Bacteria | 13667 |
| 101 | Ga0207657_10199384 | 3300025919 | Bacteria | 1611 |
| 102 | Ga0207649_10010910 | 3300025920 | Bacteria | 4996 |
| 103 | Ga0207652_10000240 | 3300025921 | Bacteria | 57130 |
| 104 | Ga0207681_10509575 | 3300025923 | Bacteria | 986 |
| 105 | Ga0207694_10000016 | 3300025924 | Bacteria | 349087 |
| 106 | Ga0207694_10069915 | 3300025924 | Bacteria | 2743 |
| 107 | Ga0207694_10355109 | 3300025924 | Bacteria | 1214 |
| 108 | Ga0207650_10359863 | 3300025925 | Bacteria | 1199 |
| 109 | Ga0207687_10010179 | 3300025927 | Bacteria | 6144 |
| 110 | Ga0207700_10053214 | 3300025928 | Bacteria | 3032 |
| 111 | Ga0207664_10006176 | 3300025929 | Bacteria | 8218 |
| 112 | Ga0207664_10055506 | 3300025929 | Bacteria | 3143 |
| 113 | Ga0207706_10381257 | 3300025933 | Bacteria | 1223 |
| 114 | Ga0207686_10246828 | 3300025934 | Bacteria | 1302 |
| 115 | Ga0207709_10239466 | 3300025935 | Bacteria | 1319 |
| 116 | Ga0207670_10028423 | 3300025936 | Bacteria | 3550 |
| 117 | Ga0207704_10024331 | 3300025938 | Bacteria | 3282 |
| 118 | Ga0207704_10230908 | 3300025938 | Bacteria | 1376 |
| 119 | Ga0207665_10000580 | 3300025939 | Bacteria | 24626 |
| 120 | Ga0207691_10041318 | 3300025940 | Bacteria | 4258 |
| 121 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 122 | Ga0207711_10000005 | 3300025941 | Bacteria | 822972 |
| 123 | Ga0207711_10000015 | 3300025941 | Bacteria | 494097 |
| 124 | Ga0207711_10091611 | 3300025941 | Bacteria | 2674 |
| 125 | Ga0207711_10133474 | 3300025941 | Bacteria | 2228 |
| 126 | Ga0207661_10036034 | 3300025944 | Bacteria | 3860 |
| 127 | Ga0207679_10143273 | 3300025945 | Bacteria | 1934 |
| 128 | Ga0207667_10000021 | 3300025949 | Bacteria | 370524 |
| 129 | Ga0207651_10241270 | 3300025960 | Bacteria | 1473 |
| 130 | Ga0207640_10327865 | 3300025981 | Bacteria | 1221 |
| 131 | Ga0207658_10131268 | 3300025986 | Bacteria | 2013 |
| 132 | Ga0207658_10280888 | 3300025986 | Bacteria | 1427 |
| 133 | Ga0207703_10014806 | 3300026035 | Bacteria | 6085 |
| 134 | Ga0207703_10124822 | 3300026035 | Bacteria | 2215 |
| 135 | Ga0207703_10181246 | 3300026035 | Bacteria | 1859 |
| 136 | Ga0207703_10428425 | 3300026035 | Bacteria | 1232 |
| 137 | Ga0207678_10019793 | 3300026067 | Bacteria | 5920 |
| 138 | Ga0207678_10050648 | 3300026067 | Bacteria | 3587 |
| 139 | Ga0207678_10117343 | 3300026067 | Bacteria | 2271 |
| 140 | Ga0207708_10086197 | 3300026075 | Bacteria | 2417 |
| 141 | Ga0207702_10004815 | 3300026078 | Bacteria | 11900 |
| 142 | Ga0207641_10094672 | 3300026088 | Bacteria | 2620 |
| 143 | Ga0207641_10715725 | 3300026088 | Bacteria | 987 |
| 144 | Ga0207648_10076107 | 3300026089 | Bacteria | 2925 |
| 145 | Ga0207648_10088048 | 3300026089 | Bacteria | 2711 |
| 146 | Ga0207676_10063603 | 3300026095 | Bacteria | 2931 |
| 147 | Ga0207675_100032581 | 3300026118 | Bacteria | 4855 |
| 148 | Ga0207675_100060167 | 3300026118 | Bacteria | 3546 |
| 149 | Ga0207675_100094377 | 3300026118 | Bacteria | 2814 |
| 150 | Ga0207683_10018490 | 3300026121 | Bacteria | 5947 |
| 151 | Ga0207683_10035485 | 3300026121 | Bacteria | 4338 |
| 152 | Ga0207683_10075529 | 3300026121 | Bacteria | 2983 |
| 153 | Ga0207683_10200987 | 3300026121 | Bacteria | 1812 |
| 154 | Ga0207698_10032091 | 3300026142 | Bacteria | 3801 |
| 155 | Ga0207698_10060819 | 3300026142 | Bacteria | 2939 |
| 156 | Ga0207698_10081745 | 3300026142 | Bacteria | 2609 |
| 157 | Ga0207698_10262888 | 3300026142 | Bacteria | 1586 |
| 158 | Ga0207698_10265272 | 3300026142 | Bacteria | 1580 |
| 159 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 160 | Ga0209489_100777 | 3300027361 | Bacteria | 63061 |
| 161 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 162 | Ga0268266_10011051 | 3300028379 | Bacteria | 7861 |
| 163 | Ga0268266_10081674 | 3300028379 | Bacteria | 2819 |
| 164 | Ga0268266_10285848 | 3300028379 | Bacteria | 1535 |
| 165 | Ga0268265_10053336 | 3300028380 | Bacteria | 3063 |
| 166 | Ga0268265_10397802 | 3300028380 | Bacteria | 1272 |
| 167 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 168 | Ga0268264_10243430 | 3300028381 | Bacteria | 1667 |
| 169 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 170 | Ga0265338_10000007 | 3300028800 | Bacteria | 498229 |
| 171 | Ga0265338_10032423 | 3300028800 | Bacteria | 5096 |
| 172 | Ga0265338_10155753 | 3300028800 | Unclassified | 1770 |
| 173 | Ga0265338_10246173 | 3300028800 | Bacteria | 1321 |
| 174 | Ga0265324_10042482 | 3300029957 | Unclassified | 1571 |
| 175 | Ga0307511_10052126 | 3300030521 | Bacteria | 3266 |
| 176 | Ga0265330_10099923 | 3300031235 | Bacteria | 1242 |
| 177 | Ga0265332_10107704 | 3300031238 | Bacteria | 1175 |
| 178 | Ga0265320_10000413 | 3300031240 | Bacteria | 33867 |
| 179 | Ga0265320_10025585 | 3300031240 | Bacteria | 3101 |
| 180 | Ga0265325_10000001 | 3300031241 | Bacteria | 726814 |
| 181 | Ga0265325_10000221 | 3300031241 | Bacteria | 40256 |
| 182 | Ga0265325_10022794 | 3300031241 | Bacteria | 3425 |
| 183 | Ga0265325_10111208 | 3300031241 | Bacteria | 1331 |
| 184 | Ga0265340_10115308 | 3300031247 | Bacteria | 1239 |
| 185 | Ga0265339_10002071 | 3300031249 | Bacteria | 14692 |
| 186 | Ga0265339_10010002 | 3300031249 | Bacteria | 5919 |
| 187 | Ga0265339_10056013 | 3300031249 | Bacteria | 2136 |
| 188 | Ga0265331_10003286 | 3300031250 | Bacteria | 10512 |
| 189 | Ga0265316_10073166 | 3300031344 | Bacteria | 2640 |
| 190 | Ga0265316_10126120 | 3300031344 | Bacteria | 1930 |
| 191 | Ga0307509_10055212 | 3300031507 | Bacteria | 4223 |
| 192 | Ga0307509_10095762 | 3300031507 | Bacteria | 3022 |
| 193 | Ga0265313_10000929 | 3300031595 | Bacteria | 29179 |
| 194 | Ga0265313_10002900 | 3300031595 | Bacteria | 14338 |
| 195 | Ga0307508_10000034 | 3300031616 | Bacteria | 160115 |
| 196 | Ga0307508_10299411 | 3300031616 | Bacteria | 1201 |
| 197 | Ga0316575_10066884 | 3300031665 | Bacteria | 1440 |
| 198 | Ga0265314_10003279 | 3300031711 | Bacteria | 15816 |
| 199 | Ga0265314_10011420 | 3300031711 | Bacteria | 7334 |
| 200 | Ga0265314_10043034 | 3300031711 | Bacteria | 3215 |
| 201 | Ga0265314_10056346 | 3300031711 | Bacteria | 2706 |
| 202 | Ga0265314_10065061 | 3300031711 | Bacteria | 2465 |
| 203 | Ga0265314_10145643 | 3300031711 | Bacteria | 1459 |
| 204 | Ga0265342_10027066 | 3300031712 | Bacteria | 3589 |
| 205 | Ga0265342_10036503 | 3300031712 | Bacteria | 3002 |
| 206 | Ga0316576_10003264 | 3300031727 | Bacteria | 9465 |
| 207 | Ga0307516_10012055 | 3300031730 | Bacteria | 9343 |
| 208 | Ga0307516_10147279 | 3300031730 | Bacteria | 2119 |
| 209 | Ga0307516_10222631 | 3300031730 | Bacteria | 1595 |
| 210 | Ga0316580_10065881 | 3300032139 | Bacteria | 1111 |
| 211 | Ga0307507_10072118 | 3300033179 | Bacteria | 3115 |
| 212 | Ga0307510_10003336 | 3300033180 | Bacteria | 18711 |
| 213 | Ga0307510_10129708 | 3300033180 | Bacteria | 2199 |
| 214 | Ga0307510_10134712 | 3300033180 | Bacteria | 2132 |
| 215 | Ga0373930_0017130 | 3300034816 | Bacteria | 1378 |
| 216 | Ga0373951_0013454 | 3300035091 | Bacteria | 1840 |
| 217 | Ga0373932_0039539 | 3300035112 | Bacteria | 1353 |
| 218 | Ga0373939_0020564 | 3300035114 | Bacteria | 1795 |
| 219 | Ga0373956_0169285 | 3300035119 | Bacteria | 1031 |
| 220 | Ga0373962_0013703 | 3300035242 | Bacteria | 2056 |
| 221 | Ga0373962_0040622 | 3300035242 | Bacteria | 1309 |
| 222 | Ga0316574_0160494 | 3300035398 | Bacteria | 1448 |
| 223 | Ga0373931_0017054 | 3300035691 | Bacteria | 3583 |
| 224 | Ga0373931_0115566 | 3300035691 | Bacteria | 1527 |
| 225 | Ga0373935_0017908 | 3300035692 | Bacteria | 4303 |
| 226 | Ga0373927_0010098 | 3300035695 | Bacteria | 6318 |
| 227 | Ga0373927_0291332 | 3300035695 | Bacteria | 1074 |
| 228 | Ga0373933_0002876 | 3300035724 | Bacteria | 9623 |
| 229 | Ga0373947_0019804 | 3300035725 | Bacteria | 3883 |
| 230 | Ga0373947_0423588 | 3300035725 | Bacteria | 900 |
| 231 | Ga0373937_0003575 | 3300036401 | Bacteria | 13104 |
| 232 | Ga0373937_0517638 | 3300036401 | Bacteria | 1134 |
| 233 | Ga0316584_0260862 | 3300036712 | Bacteria | 1264 |
| 234 | Ga0373925_0068046 | 3300037068 | Bacteria | 2687 |
| 235 | Ga0373925_0108119 | 3300037068 | Bacteria | 2146 |
| 236 | Ga0373925_0351276 | 3300037068 | Bacteria | 1197 |
| 237 | Ga0395905_0008003 | 3300037471 | Bacteria | 10445 |
| 238 | Ga0395905_0178275 | 3300037471 | Bacteria | 1995 |
| 239 | Ga0395905_0389908 | 3300037471 | Bacteria | 1287 |
| 240 | Ga0395901_0321760 | 3300038443 | Bacteria | 1600 |
| 241 | Ga0436365_0211858 | 3300039437 | Bacteria | 4276 |
| 242 | Ga0436365_1017537 | 3300039437 | Bacteria | 4131 |
| 243 | Ga0436365_1692740 | 3300039437 | Bacteria | 1555 |
| 244 | Ga0436360_1321389 | 3300039438 | Bacteria | 1480 |
| 245 | Ga0436361_0818803 | 3300039447 | Bacteria | 2336 |
| 246 | Ga0436363_0020937 | 3300039450 | Bacteria | 2529 |
| 247 | Ga0436363_1486701 | 3300039450 | Bacteria | 1420 |
| 248 | Ga0436362_0128483 | 3300039453 | Bacteria | 4975 |
| 249 | Ga0436362_1240820 | 3300039453 | Bacteria | 6215 |
| 250 | Ga0453683_0014438 | 3300044673 | Bacteria | 5127 |
| 251 | Ga0466966_0000419 | 3300044684 | Bacteria | 27305 |
| 252 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 253 | Ga0466959_0023409 | 3300045049 | Bacteria | 4570 |
| 254 | Ga0451576_0000242 | 3300045051 | Bacteria | 133680 |
| 255 | Ga0451576_0353520 | 3300045051 | Bacteria | 1538 |
| 256 | Ga0495592_0014283 | 3300046454 | Bacteria | 6031 |
| 257 | Ga0495592_0057877 | 3300046454 | Bacteria | 2860 |
| 258 | Ga0495603_0004299 | 3300046455 | Bacteria | 8492 |
| 259 | Ga0495629_0101341 | 3300046459 | Bacteria | 2009 |
| 260 | Ga0495629_0101425 | 3300046459 | Bacteria | 2008 |
| 261 | Ga0495638_0020663 | 3300046460 | Bacteria | 4347 |
| 262 | Ga0495638_0032262 | 3300046460 | Bacteria | 3359 |
| 263 | Ga0495638_0042046 | 3300046460 | Bacteria | 2888 |
| 264 | Ga0495651_0002943 | 3300046462 | Bacteria | 13173 |
| 265 | Ga0495651_0025932 | 3300046462 | Bacteria | 4564 |
| 266 | Ga0495651_0085487 | 3300046462 | Bacteria | 2375 |
| 267 | Ga0495651_0217327 | 3300046462 | Bacteria | 1325 |
| 268 | Ga0495651_0248930 | 3300046462 | Bacteria | 1215 |
| 269 | Ga0495605_0046795 | 3300046474 | Bacteria | 2125 |
| 270 | Ga0495664_0230356 | 3300046477 | Bacteria | 1121 |
| 271 | Ga0495606_0023769 | 3300046507 | Bacteria | 4432 |
| 272 | Ga0495606_0048670 | 3300046507 | Bacteria | 2786 |
| 273 | Ga0495606_0176022 | 3300046507 | Bacteria | 1237 |
| 274 | Ga0495608_0025823 | 3300046511 | Bacteria | 4009 |
| 275 | Ga0495608_0168866 | 3300046511 | Bacteria | 1388 |
| 276 | Ga0495616_0057330 | 3300046513 | Bacteria | 1921 |
| 277 | Ga0495618_0043410 | 3300046514 | Bacteria | 2837 |
| 278 | Ga0495618_0269510 | 3300046514 | Bacteria | 1064 |
| 279 | Ga0495628_0055958 | 3300046516 | Bacteria | 3106 |
| 280 | Ga0495630_0151444 | 3300046517 | Bacteria | 1765 |
| 281 | Ga0495643_0048901 | 3300046522 | Bacteria | 2283 |
| 282 | Ga0495643_0053422 | 3300046522 | Bacteria | 2166 |
| 283 | Ga0495643_0073092 | 3300046522 | Bacteria | 1797 |
| 284 | Ga0495643_0141688 | 3300046522 | Bacteria | 1198 |
| 285 | Ga0495644_0120921 | 3300046523 | Bacteria | 996 |
| 286 | Ga0495652_0020012 | 3300046529 | Bacteria | 5952 |
| 287 | Ga0495640_0029617 | 3300046533 | Bacteria | 3928 |
| 288 | Ga0495587_0115593 | 3300046536 | Bacteria | 1539 |
| 289 | Ga0495587_0116821 | 3300046536 | Bacteria | 1530 |
| 290 | Ga0495622_0037345 | 3300046557 | Bacteria | 2263 |
| 291 | Ga0495622_0060902 | 3300046557 | Bacteria | 1748 |
| 292 | Ga0495667_0235608 | 3300046559 | Bacteria | 1166 |
| 293 | Ga0495656_0013292 | 3300046615 | Bacteria | 3059 |
| 294 | Ga0495656_0017604 | 3300046615 | Bacteria | 2729 |
| 295 | Ga0495634_0111264 | 3300046642 | Bacteria | 1761 |
| 296 | Ga0495611_0009307 | 3300046648 | Bacteria | 4149 |
| 297 | Ga0495625_0097509 | 3300046660 | Bacteria | 2023 |
| 298 | Ga0495625_0116234 | 3300046660 | Bacteria | 1825 |
| 299 | Ga0495625_0173233 | 3300046660 | Bacteria | 1440 |
| 300 | Ga0495635_0106465 | 3300046663 | Bacteria | 1915 |
| 301 | Ga0495635_0260853 | 3300046663 | Bacteria | 1167 |
| 302 | Ga0495659_0030718 | 3300046664 | Bacteria | 1871 |
| 303 | Ga0495659_0034014 | 3300046664 | Bacteria | 1790 |
| 304 | Ga0495588_0033223 | 3300046674 | Bacteria | 2604 |
| 305 | Ga0495588_0173464 | 3300046674 | Bacteria | 1140 |
| 306 | Ga0495657_0022214 | 3300046675 | Bacteria | 4548 |
| 307 | Ga0495657_0095210 | 3300046675 | Bacteria | 1903 |
| 308 | Ga0495599_0111102 | 3300046678 | Bacteria | 1707 |
| 309 | Ga0495623_0020931 | 3300046679 | Bacteria | 4226 |
| 310 | Ga0495623_0046161 | 3300046679 | Bacteria | 2766 |
| 311 | Ga0495646_0023266 | 3300046680 | Bacteria | 3902 |
| 312 | Ga0495669_0002200 | 3300046684 | Bacteria | 8005 |
| 313 | Ga0495613_0295144 | 3300046689 | Bacteria | 1123 |
| 314 | Ga0495624_0097946 | 3300046690 | Bacteria | 1807 |
| 315 | Ga0495649_0014534 | 3300046694 | Bacteria | 4509 |
| 316 | Ga0495649_0033655 | 3300046694 | Bacteria | 2820 |
| 317 | Ga0495600_0003794 | 3300046809 | Bacteria | 8948 |
| 318 | Ga0495600_0050620 | 3300046809 | Bacteria | 2711 |
| 319 | Ga0495604_0024585 | 3300047317 | Bacteria | 4805 |
| 320 | Ga0495604_0034404 | 3300047317 | Bacteria | 4008 |
| 321 | Ga0495604_0038058 | 3300047317 | Bacteria | 3785 |
| 322 | Ga0495636_0085627 | 3300047318 | Bacteria | 1362 |
| 323 | Ga0495636_0123217 | 3300047318 | Bacteria | 1148 |
| 324 | Ga0495674_0507609 | 3300047319 | Bacteria | 964 |
| 325 | Ga0495672_0014045 | 3300047320 | Bacteria | 5500 |
| 326 | Ga0495672_0042911 | 3300047320 | Bacteria | 2723 |
| 327 | Ga0495676_0365702 | 3300047321 | Bacteria | 962 |
| 328 | Ga0495680_0190465 | 3300047322 | Bacteria | 1476 |
| 329 | Ga0495677_0032747 | 3300047445 | Bacteria | 1893 |
| 330 | Ga0495684_0117067 | 3300047471 | Bacteria | 2009 |
| 331 | Ga0495684_0131539 | 3300047471 | Bacteria | 1879 |
| 332 | Ga0495686_0059676 | 3300047472 | Bacteria | 2373 |
| 333 | Ga0495686_0061185 | 3300047472 | Bacteria | 2339 |
| 334 | Ga0495686_0242226 | 3300047472 | Bacteria | 1016 |
| 335 | Ga0495602_0023281 | 3300048088 | Bacteria | 6039 |
| 336 | Ga0495602_0107207 | 3300048088 | Bacteria | 2278 |
| 337 | Ga0496100_0053153 | 3300048903 | Bacteria | 2637 |
| 338 | Ga0496101_0004586 | 3300048904 | Bacteria | 8729 |
| 339 | Ga0496102_0007305 | 3300048905 | Bacteria | 9429 |
| 340 | Ga0496102_0052186 | 3300048905 | Bacteria | 3725 |
| 341 | Ga0496103_0010719 | 3300048906 | Bacteria | 5423 |
| 342 | Ga0496103_0041718 | 3300048906 | Bacteria | 2821 |
| 343 | Ga0496103_0194998 | 3300048906 | Bacteria | 1302 |
| 344 | Ga0496104_0027060 | 3300048907 | Bacteria | 5303 |
| 345 | Ga0496104_0054323 | 3300048907 | Bacteria | 3785 |
| 346 | Ga0496104_0099919 | 3300048907 | Bacteria | 2777 |
| 347 | Ga0496105_0077493 | 3300048908 | Bacteria | 2745 |
| 348 | Ga0496105_0084786 | 3300048908 | Bacteria | 2617 |
| 349 | Ga0496105_0182208 | 3300048908 | Bacteria | 1719 |
| 350 | Ga0496105_0223467 | 3300048908 | Bacteria | 1532 |
| 351 | Ga0496106_0005619 | 3300048909 | Bacteria | 9280 |
| 352 | Ga0496106_0017753 | 3300048909 | Bacteria | 5262 |
| 353 | Ga0496106_0066022 | 3300048909 | Bacteria | 2755 |
| 354 | Ga0496106_0135990 | 3300048909 | Bacteria | 1930 |
| 355 | Ga0496107_0000808 | 3300048910 | Bacteria | 18176 |
| 356 | Ga0496107_0034118 | 3300048910 | Bacteria | 3643 |
| 357 | Ga0496108_0018943 | 3300048911 | Bacteria | 5644 |
| 358 | Ga0496108_0044389 | 3300048911 | Bacteria | 3711 |
| 359 | Ga0496108_0445066 | 3300048911 | Bacteria | 1132 |
| 360 | Ga0496109_0078121 | 3300048912 | Bacteria | 3047 |
| 361 | Ga0496109_0427324 | 3300048912 | Bacteria | 1251 |
| 362 | Ga0496110_0297108 | 3300048913 | Bacteria | 1471 |
| 363 | Ga0496110_0371834 | 3300048913 | Bacteria | 1302 |
| 364 | Ga0496111_0016617 | 3300048914 | Bacteria | 5074 |
| 365 | Ga0496111_0225778 | 3300048914 | Bacteria | 1391 |
| 366 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 367 | Ga0496112_0019731 | 3300048915 | Bacteria | 6372 |
| 368 | Ga0496112_0058241 | 3300048915 | Bacteria | 3804 |
| 369 | Ga0496112_0064765 | 3300048915 | Bacteria | 3607 |
| 370 | Ga0496112_0119981 | 3300048915 | Bacteria | 2600 |
| 371 | Ga0496113_0009715 | 3300048916 | Bacteria | 6321 |
| 372 | Ga0496113_0043860 | 3300048916 | Bacteria | 3311 |
| 373 | Ga0496114_0026566 | 3300048917 | Bacteria | 4740 |
| 374 | Ga0496114_0042858 | 3300048917 | Bacteria | 3751 |
| 375 | Ga0496114_0044410 | 3300048917 | Bacteria | 3687 |
| 376 | Ga0496115_0041375 | 3300048918 | Bacteria | 3667 |
| 377 | Ga0496115_0186259 | 3300048918 | Bacteria | 1715 |
| 378 | Ga0496116_0004266 | 3300048919 | Bacteria | 13712 |
| 379 | Ga0496116_0060416 | 3300048919 | Bacteria | 2459 |
| 380 | Ga0496118_0064136 | 3300048921 | Bacteria | 2698 |
| 381 | Ga0496118_0132685 | 3300048921 | Bacteria | 1596 |
| 382 | Ga0496118_0157147 | 3300048921 | Bacteria | 1412 |
| 383 | Ga0496118_0254340 | 3300048921 | Bacteria | 996 |
| 384 | Ga0496119_0012771 | 3300048922 | Bacteria | 6778 |
| 385 | Ga0496119_0031235 | 3300048922 | Bacteria | 3577 |
| 386 | Ga0496119_0052000 | 3300048922 | Bacteria | 2513 |
| 387 | Ga0496119_0126030 | 3300048922 | Bacteria | 1401 |
| 388 | Ga0496120_0048159 | 3300048923 | Bacteria | 2454 |
| 389 | Ga0496120_0076050 | 3300048923 | Bacteria | 1831 |
| 390 | Ga0496121_0000099 | 3300048924 | Bacteria | 200160 |
| 391 | Ga0496121_0000178 | 3300048924 | Bacteria | 141429 |
| 392 | Ga0496121_0142291 | 3300048924 | Bacteria | 1777 |
| 393 | Ga0496121_0179020 | 3300048924 | Bacteria | 1532 |
| 394 | Ga0496121_0202130 | 3300048924 | Bacteria | 1415 |
| 395 | Ga0496122_0217945 | 3300048925 | Bacteria | 1098 |
| 396 | Ga0496124_0008073 | 3300048927 | Bacteria | 11067 |
| 397 | Ga0496124_0053777 | 3300048927 | Bacteria | 3411 |
| 398 | Ga0496124_0401555 | 3300048927 | Bacteria | 951 |
| 399 | Ga0496125_0018440 | 3300048928 | Bacteria | 6627 |
| 400 | Ga0496125_0051098 | 3300048928 | Bacteria | 3413 |
| 401 | Ga0496126_0025411 | 3300048929 | Bacteria | 5698 |
| 402 | Ga0496126_0064343 | 3300048929 | Bacteria | 3286 |
| 403 | Ga0496126_0122538 | 3300048929 | Bacteria | 2253 |
| 404 | Ga0496126_0143836 | 3300048929 | Bacteria | 2050 |
| 405 | Ga0496126_0243471 | 3300048929 | Bacteria | 1501 |
| 406 | Ga0496126_0361982 | 3300048929 | Bacteria | 1184 |
| 407 | Ga0496126_0393619 | 3300048929 | Bacteria | 1125 |
| 408 | Ga0496126_0535256 | 3300048929 | Bacteria | 932 |
| 409 | Ga0495682_0005043 | 3300049460 | Bacteria | 5546 |
| 410 | Ga0495682_0011847 | 3300049460 | Bacteria | 3351 |
| 411 | Ga0501034_0021712 | 3300049571 | Bacteria | 6541 |
| 412 | Ga0501034_0253069 | 3300049571 | Bacteria | 1705 |
| 413 | Ga0501034_0253582 | 3300049571 | Bacteria | 1703 |
| 414 | Ga0501037_0220515 | 3300049573 | Bacteria | 1335 |
| 415 | Ga0501047_0016854 | 3300049581 | Bacteria | 6982 |
| 416 | Ga0501047_0266391 | 3300049581 | Bacteria | 1560 |
| 417 | Ga0501067_0003070 | 3300049583 | Bacteria | 9211 |
| 418 | Ga0501069_0003810 | 3300049585 | Bacteria | 7759 |
| 419 | Ga0501069_0080351 | 3300049585 | Bacteria | 1836 |
| 420 | Ga0501070_0020931 | 3300049586 | Bacteria | 5487 |
| 421 | Ga0501070_0021099 | 3300049586 | Bacteria | 5465 |
| 422 | Ga0501070_0141316 | 3300049586 | Bacteria | 1988 |
| 423 | Ga0501072_0060304 | 3300049588 | Bacteria | 2991 |
| 424 | Ga0501074_0061029 | 3300049590 | Bacteria | 2716 |
| 425 | Ga0501079_0001956 | 3300049741 | Bacteria | 14759 |
| 426 | Ga0501035_0002651 | 3300049822 | Bacteria | 17407 |
| 427 | Ga0501044_0142405 | 3300049823 | Bacteria | 2386 |
| 428 | Ga0501044_0145560 | 3300049823 | Bacteria | 2355 |
| 429 | nmdc:mga03683_83186_c1 | 3300050489 | Bacteria | 1385 |
| 430 | nmdc:mga00v17_219998_c1 | 3300050491 | Bacteria | 1229 |
| 431 | nmdc:mga00v17_31325_c1 | 3300050491 | Bacteria | 3136 |
| 432 | nmdc:mga0yw44_101657_c1 | 3300050492 | Bacteria | 1832 |
| 433 | nmdc:mga0yw44_44260_c1 | 3300050492 | Bacteria | 2662 |
| 434 | nmdc:mga0k408_125943_c1 | 3300050493 | Bacteria | 1519 |
| 435 | nmdc:mga06z11_127663_c1 | 3300050494 | Bacteria | 1425 |
| 436 | nmdc:mga06z11_4441_c1 | 3300050494 | Bacteria | 5518 |
| 437 | nmdc:mga07m45_237815_c1 | 3300050496 | Bacteria | 1060 |
| 438 | nmdc:mga05p37_69657_c1 | 3300050507 | Bacteria | 4326 |
| 439 | nmdc:mga08y16_190300_c1 | 3300050511 | Bacteria | 2128 |
| 440 | nmdc:mga08y16_220898_c1 | 3300050511 | Bacteria | 1962 |
| 441 | nmdc:mga0sz30_15258_c1 | 3300050516 | Bacteria | 3034 |
| 442 | Ga0495601_0136919 | 3300053077 | Bacteria | 1596 |
| 443 | Ga0500635_0001453 | 3300053080 | Bacteria | 5701 |
| 444 | Ga0495595_0089780 | 3300053084 | Bacteria | 1473 |
| 445 | Ga0495595_0138699 | 3300053084 | Bacteria | 1192 |
| 446 | Ga0495619_0097184 | 3300053085 | Bacteria | 2000 |
| 447 | Ga0500578_0170974 | 3300053086 | Bacteria | 1344 |
| 448 | Ga0500643_000018 | 3300053087 | Bacteria | 296505 |
| 449 | Ga0500647_0018541 | 3300053091 | Bacteria | 3224 |
| 450 | Ga0500647_0052730 | 3300053091 | Bacteria | 1957 |
| 451 | Ga0500651_0005607 | 3300053093 | Bacteria | 7187 |
| 452 | Ga0500566_0000008 | 3300053094 | Bacteria | 143641 |
| 453 | Ga0500566_0005804 | 3300053094 | Bacteria | 7337 |
| 454 | Ga0500566_0011048 | 3300053094 | Bacteria | 5320 |
| 455 | Ga0500640_127704 | 3300053095 | Bacteria | 1008 |
| 456 | Ga0500641_0013157 | 3300053096 | Bacteria | 3037 |
| 457 | Ga0500641_0054600 | 3300053096 | Bacteria | 1652 |
| 458 | Ga0500650_0000650 | 3300053098 | Bacteria | 9175 |
| 459 | Ga0500650_0110326 | 3300053098 | Bacteria | 1284 |
| 460 | Ga0500554_006967 | 3300053102 | Bacteria | 2573 |
| 461 | Ga0500555_004973 | 3300053103 | Bacteria | 3772 |
| 462 | Ga0500556_0067726 | 3300053104 | Bacteria | 1328 |
| 463 | Ga0500556_0120649 | 3300053104 | Bacteria | 1022 |
| 464 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 465 | Ga0500562_010666 | 3300053108 | Bacteria | 2330 |
| 466 | Ga0500569_050354 | 3300053109 | Bacteria | 1255 |
| 467 | Ga0500572_000613 | 3300053111 | Bacteria | 12000 |
| 468 | Ga0500591_017145 | 3300053115 | Bacteria | 3498 |
| 469 | Ga0500595_007004 | 3300053119 | Bacteria | 4725 |
| 470 | Ga0500595_007694 | 3300053119 | Bacteria | 4455 |
| 471 | Ga0500595_015175 | 3300053119 | Bacteria | 2895 |
| 472 | Ga0500595_026858 | 3300053119 | Bacteria | 1978 |
| 473 | Ga0500595_040960 | 3300053119 | Bacteria | 1491 |
| 474 | Ga0500608_011051 | 3300053122 | Bacteria | 3904 |
| 475 | Ga0500608_088447 | 3300053122 | Bacteria | 1451 |
| 476 | Ga0500614_003090 | 3300053123 | Bacteria | 3618 |
| 477 | Ga0500621_071249 | 3300053126 | Bacteria | 1401 |
| 478 | Ga0500626_060325 | 3300053128 | Bacteria | 1697 |
| 479 | Ga0500655_027284 | 3300053133 | Bacteria | 1089 |
| 480 | Ga0500559_0022048 | 3300053136 | Bacteria | 2701 |
| 481 | Ga0500559_0111278 | 3300053136 | Bacteria | 1269 |
| 482 | Ga0500564_044060 | 3300053138 | Bacteria | 2050 |
| 483 | Ga0500568_0000833 | 3300053139 | Bacteria | 21699 |
| 484 | Ga0500568_0003231 | 3300053139 | Bacteria | 9217 |
| 485 | Ga0500573_0060874 | 3300053140 | Bacteria | 2162 |
| 486 | Ga0500590_062006 | 3300053148 | Bacteria | 1876 |
| 487 | Ga0500590_122857 | 3300053148 | Bacteria | 1214 |
| 488 | Ga0500603_000033 | 3300053150 | Bacteria | 33766 |
| 489 | Ga0500604_0001087 | 3300053151 | Bacteria | 7568 |
| 490 | Ga0500616_0036946 | 3300053153 | Bacteria | 2647 |
| 491 | Ga0500619_002479 | 3300053154 | Bacteria | 3564 |
| 492 | Ga0500622_0033063 | 3300053156 | Bacteria | 2711 |
| 493 | Ga0500627_0069343 | 3300053158 | Bacteria | 1560 |
| 494 | Ga0500630_002640 | 3300053159 | Bacteria | 8624 |
| 495 | Ga0500638_017996 | 3300053162 | Bacteria | 3290 |
| 496 | Ga0500638_081928 | 3300053162 | Bacteria | 1531 |
| 497 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 498 | Ga0500636_0000550 | 3300053177 | Bacteria | 20404 |
| 499 | Ga0500637_0004089 | 3300053178 | Bacteria | 6863 |
| 500 | Ga0500637_0171913 | 3300053178 | Bacteria | 1245 |
| 501 | Ga0500625_012573 | 3300053729 | Bacteria | 3872 |
| 502 | Ga0500645_018713 | 3300053730 | Bacteria | 2161 |
| 503 | Ga0500609_007874 | 3300053731 | Bacteria | 1437 |
| 504 | Ga0500596_003343 | 3300053735 | Bacteria | 3065 |
| 505 | Ga0500596_005085 | 3300053735 | Bacteria | 2350 |
| 506 | Ga0500599_003627 | 3300053736 | Bacteria | 1890 |
| 507 | Ga0500601_002579 | 3300053737 | Bacteria | 1941 |
| 508 | Ga0501084_0012218 | 3300054114 | Bacteria | 7107 |
| 509 | Ga0501084_0137570 | 3300054114 | Bacteria | 2056 |
| 510 | Ga0500661_004505 | 3300055283 | Bacteria | 2607 |
| 511 | Ga0500661_004963 | 3300055283 | Bacteria | 2494 |
| 512 | Ga0501082_0149417 | 3300060353 | Bacteria | 2029 |
| 513 | Ga0501082_0326254 | 3300060353 | Bacteria | 1338 |
| 514 | Ga0501082_0398686 | 3300060353 | Bacteria | 1201 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005437 | Ga0070710_10013427 | Ga0070710_100134275 | 263 |
| 2 | 3300005439 | Ga0070711_100010842 | Ga0070711_1000108424 | 263 |
| 3 | 3300005548 | Ga0070665_100131553 | Ga0070665_1001315534 | 266 |
| 4 | 3300005985 | Ga0081539_10074196 | Ga0081539_100741963 | 270 |
| 5 | 3300048915 | Ga0496112_0019731 | Ga0496112_0019731_5339_6199 | 271 |
| 6 | 3300031711 | Ga0265314_10145643 | Ga0265314_101456432 | 273 |
| 7 | 3300009545 | Ga0105237_10206974 | Ga0105237_102069741 | 278 |
| 8 | 3300025904 | Ga0207647_10023450 | Ga0207647_100234503 | 278 |
| 9 | 3300025914 | Ga0207671_10415543 | Ga0207671_104155431 | 278 |
| 10 | 3300026088 | Ga0207641_10715725 | Ga0207641_107157251 | 278 |
| 11 | 3300028379 | Ga0268266_10081674 | Ga0268266_100816742 | 278 |
| 12 | 3300046522 | Ga0495643_0141688 | Ga0495643_0141688_54_914 | 278 |
| 13 | 3300046694 | Ga0495649_0014534 | Ga0495649_0014534_250_1110 | 278 |
| 14 | iso_pu_bacteria | 2507262055 | 2507510904 | 278 |
| 15 | iso_pu_bacteria | 2508501009 | 2508544717 | 278 |
| 16 | iso_pu_bacteria | 2508501042 | 2508697055 | 278 |
| 17 | iso_pu_bacteria | 2511231028 | 2511394407 | 278 |
| 18 | iso_pu_bacteria | 2513237094 | 2513637584 | 278 |
| 19 | iso_pu_bacteria | 2513237095 | 2513649570 | 278 |
| 20 | iso_pu_bacteria | 2513237101 | 2513697344 | 278 |
| 21 | iso_pu_bacteria | 2513237139 | 2513874554 | 278 |
| 22 | iso_pu_bacteria | 2513237161 | 2514015542 | 278 |
| 23 | iso_pu_bacteria | 2517093001 | 2517100484 | 278 |
| 24 | iso_pu_bacteria | 2602042107 | 2603861239 | 278 |
| 25 | iso_pu_bacteria | 2617270735 | 2617350662 | 278 |
| 26 | iso_pu_bacteria | 2721755755 | 2723843161 | 278 |
| 27 | iso_pu_bacteria | 2791355196 | 2793066070 | 278 |
| 28 | iso_pu_bacteria | 2791355199 | 2793083135 | 278 |
| 29 | iso_pu_bacteria | 2802429603 | 2805916549 | 278 |
| 30 | iso_pu_bacteria | 2816332527 | 2818238040 | 278 |
| 31 | iso_pu_bacteria | 2824600985 | 2824606136 | 278 |
| 32 | iso_pu_bacteria | 2824609381 | 2824616036 | 278 |
| 33 | iso_pu_bacteria | 2824653114 | 2824657334 | 278 |
| 34 | iso_pu_bacteria | 2824671348 | 2824675555 | 278 |
| 35 | iso_pu_bacteria | 2824687955 | 2824692221 | 278 |
| 36 | iso_pu_bacteria | 2824696289 | 2824698712 | 278 |
| 37 | iso_pu_bacteria | 2824704595 | 2824706515 | 278 |
| 38 | iso_pu_bacteria | 2824753945 | 2824756937 | 278 |
| 39 | iso_pu_bacteria | 2824763712 | 2824769733 | 278 |
| 40 | iso_pu_bacteria | 2824773399 | 2824778475 | 278 |
| 41 | iso_pu_bacteria | 2838122688 | 2838127794 | 278 |
| 42 | iso_pu_bacteria | 2841941048 | 2841943087 | 278 |
| 43 | iso_pu_bacteria | 2841949485 | 2841956108 | 278 |
| 44 | iso_pu_bacteria | 2841957949 | 2841960320 | 278 |
| 45 | iso_pu_bacteria | 2841966195 | 2841968271 | 278 |
| 46 | iso_pu_bacteria | 2841974524 | 2841976515 | 278 |
| 47 | iso_pu_bacteria | 2841983080 | 2841987891 | 278 |
| 48 | iso_pu_bacteria | 2842038055 | 2842042806 | 278 |
| 49 | iso_pu_bacteria | 2847930680 | 2847938466 | 278 |
| 50 | iso_pu_bacteria | 2847939898 | 2847944336 | 278 |
| 51 | iso_pu_bacteria | 2849076700 | 2849081427 | 278 |
| 52 | iso_pu_bacteria | 2857509624 | 2857512086 | 278 |
| 53 | iso_pu_bacteria | 2874604998 | 2874612507 | 278 |
| 54 | iso_pu_bacteria | 2874612657 | 2874615711 | 278 |
| 55 | iso_pu_bacteria | 2874620515 | 2874623531 | 278 |
| 56 | iso_pu_bacteria | 2876808645 | 2876810339 | 278 |
| 57 | iso_pu_bacteria | 2879083081 | 2879088705 | 278 |
| 58 | iso_pu_bacteria | 2879110137 | 2879117953 | 278 |
| 59 | iso_pu_bacteria | 2879127579 | 2879132463 | 278 |
| 60 | iso_pu_bacteria | 2879142872 | 2879145963 | 278 |
| 61 | iso_pu_bacteria | 2888388044 | 2888388989 | 278 |
| 62 | iso_pu_bacteria | 2888419890 | 2888422039 | 278 |
| 63 | iso_pu_bacteria | 2889033259 | 2889033540 | 278 |
| 64 | iso_pu_bacteria | 2904666416 | 2904667665 | 278 |
| 65 | iso_pu_bacteria | 2904711408 | 2904719099 | 278 |
| 66 | iso_pu_bacteria | 2906626472 | 2906633007 | 278 |
| 67 | iso_pu_bacteria | 2906643746 | 2906648256 | 278 |
| 68 | iso_pu_bacteria | 2922361189 | 2922362679 | 278 |
| 69 | iso_pu_bacteria | 2922386360 | 2922390308 | 278 |
| 70 | iso_pu_bacteria | 2929615660 | 2929619691 | 278 |
| 71 | iso_pu_bacteria | 2929624759 | 2929627838 | 278 |
| 72 | iso_pu_bacteria | 2932784394 | 2932786023 | 278 |
| 73 | iso_pu_bacteria | 2932794094 | 2932798205 | 278 |
| 74 | iso_pu_bacteria | 2932801729 | 2932803998 | 278 |
| 75 | iso_pu_bacteria | 2932828146 | 2932831067 | 278 |
| 76 | iso_pu_bacteria | 2933577622 | 2933581610 | 278 |
| 77 | iso_pu_bacteria | 2935608549 | 2935612878 | 278 |
| 78 | iso_pu_bacteria | 2935616580 | 2935624146 | 278 |
| 79 | iso_pu_bacteria | 2935648319 | 2935655004 | 278 |
| 80 | iso_pu_bacteria | 2935656913 | 2935663884 | 278 |
| 81 | iso_pu_bacteria | 2935684952 | 2935690085 | 278 |
| 82 | iso_pu_bacteria | 2935694250 | 2935699833 | 278 |
| 83 | iso_pu_bacteria | 2935713505 | 2935722203 | 278 |
| 84 | iso_pu_bacteria | 2935722832 | 2935731512 | 278 |
| 85 | iso_pu_bacteria | 2935732158 | 2935735400 | 278 |
| 86 | iso_pu_bacteria | 2935741537 | 2935745329 | 278 |
| 87 | iso_pu_bacteria | 2935750917 | 2935755096 | 278 |
| 88 | iso_pu_bacteria | 2935769743 | 2935775424 | 278 |
| 89 | iso_pu_bacteria | 2935777560 | 2935780326 | 278 |
| 90 | iso_pu_bacteria | 2935785616 | 2935790673 | 278 |
| 91 | iso_pu_bacteria | 2935793552 | 2935799144 | 278 |
| 92 | iso_pu_bacteria | 2935819856 | 2935824366 | 278 |
| 93 | iso_pu_bacteria | 2935837841 | 2935842977 | 278 |
| 94 | iso_pu_bacteria | 2935847175 | 2935852489 | 278 |
| 95 | iso_pu_bacteria | 2935855204 | 2935862354 | 278 |
| 96 | iso_pu_bacteria | 2935864058 | 2935870489 | 278 |
| 97 | iso_pu_bacteria | 2935873716 | 2935881071 | 278 |
| 98 | iso_pu_bacteria | 2935883170 | 2935884196 | 278 |
| 99 | iso_pu_bacteria | 2935908558 | 2935912356 | 278 |
| 100 | iso_pu_bacteria | 2935916978 | 2935923970 | 278 |
| 101 | iso_pu_bacteria | 2935926038 | 2935929385 | 278 |
| 102 | iso_pu_bacteria | 2935934488 | 2935936016 | 278 |
| 103 | iso_pu_bacteria | 2935942939 | 2935949916 | 278 |
| 104 | iso_pu_bacteria | 2935951376 | 2935957318 | 278 |
| 105 | iso_pu_bacteria | 2935967501 | 2935968349 | 278 |
| 106 | iso_pu_bacteria | 2935984226 | 2935988020 | 278 |
| 107 | iso_pu_bacteria | 2936011229 | 2936018047 | 278 |
| 108 | iso_pu_bacteria | 2936019824 | 2936026543 | 278 |
| 109 | iso_pu_bacteria | 2936028420 | 2936035286 | 278 |
| 110 | iso_pu_bacteria | 2936046547 | 2936053442 | 278 |
| 111 | iso_pu_bacteria | 2936055302 | 2936059423 | 278 |
| 112 | iso_pu_bacteria | 2940556831 | 2940561624 | 278 |
| 113 | iso_pu_bacteria | 2941531003 | 2941533802 | 278 |
| 114 | iso_pu_bacteria | 2941538514 | 2941544201 | 278 |
| 115 | iso_pu_bacteria | 3005506211 | 3005507226 | 278 |
| 116 | iso_pu_bacteria | 3005718088 | 3005719787 | 278 |
| 117 | iso_pu_bacteria | 8006926726 | 8006933156 | 278 |
| 118 | iso_pu_bacteria | 8006964411 | 8006971322 | 278 |
| 119 | iso_pu_bacteria | 8006984368 | 8006989276 | 278 |
| 120 | iso_pu_bacteria | 8006994254 | 8006997750 | 278 |
| 121 | iso_pu_bacteria | 8016511872 | 8016516313 | 278 |
| 122 | iso_pu_bacteria | 8016522445 | 8016523710 | 278 |
| 123 | iso_pu_bacteria | 8016539877 | 8016541495 | 278 |
| 124 | iso_pu_bacteria | 8016548790 | 8016551758 | 278 |
| 125 | iso_pu_bacteria | 8016557553 | 8016560147 | 278 |
| 126 | iso_pu_bacteria | 8016566248 | 8016566887 | 278 |
| 127 | iso_pu_bacteria | 8016575299 | 8016579617 | 278 |
| 128 | iso_pu_bacteria | 8016595262 | 8016598067 | 278 |
| 129 | iso_pu_bacteria | 8016603502 | 8016604206 | 278 |
| 130 | iso_pu_bacteria | 8016613128 | 8016620787 | 278 |
| 131 | iso_pu_bacteria | 8016622563 | 8016629200 | 278 |
| 132 | iso_pu_bacteria | 8016630954 | 8016633719 | 278 |
| 133 | iso_pu_bacteria | 8017057580 | 8017060220 | 278 |
| 134 | iso_pu_bacteria | 8019538911 | 8019542606 | 278 |
| 135 | iso_pu_bacteria | 8019547302 | 8019548132 | 278 |
| 136 | iso_pu_bacteria | 8019576017 | 8019579742 | 278 |
| 137 | iso_pu_bacteria | 8019586578 | 8019587451 | 278 |
| 138 | iso_pu_bacteria | 8019597564 | 8019603892 | 278 |
| 139 | iso_pu_bacteria | 8019608314 | 8019614647 | 278 |
| 140 | iso_pu_bacteria | 8019648815 | 8019649896 | 278 |
| 141 | iso_pu_bacteria | 8019687851 | 8019693987 | 278 |
| 142 | iso_pu_bacteria | 8055742211 | 8055749053 | 278 |
| 143 | iso_pu_bacteria | 8056673599 | 8056674790 | 278 |
| 144 | 3300005331 | Ga0070670_100250598 | Ga0070670_1002505983 | 279 |
| 145 | 3300005455 | Ga0070663_100148551 | Ga0070663_1001485511 | 279 |
| 146 | 3300014325 | Ga0163163_10169564 | Ga0163163_101695642 | 279 |
| 147 | 3300025904 | Ga0207647_10006314 | Ga0207647_100063144 | 279 |
| 148 | 3300025981 | Ga0207640_10327865 | Ga0207640_103278652 | 279 |
| 149 | 3300048911 | Ga0496108_0445066 | Ga0496108_0445066_240_1082 | 279 |
| 150 | 3300048912 | Ga0496109_0078121 | Ga0496109_0078121_1165_2007 | 279 |
| 151 | 3300049586 | Ga0501070_0020931 | Ga0501070_0020931_3220_4080 | 279 |
| 152 | 3300005336 | Ga0070680_100083477 | Ga0070680_1000834772 | 280 |
| 153 | 3300013297 | Ga0157378_10020349 | Ga0157378_100203492 | 280 |
| 154 | 3300039437 | Ga0436365_1692740 | Ga0436365_1692740_396_1241 | 280 |
| 155 | 3300048088 | Ga0495602_0023281 | Ga0495602_0023281_2968_3816 | 280 |
| 156 | 3300048929 | Ga0496126_0535256 | Ga0496126_0535256_20_865 | 280 |
| 157 | 3300053094 | Ga0500566_0011048 | Ga0500566_0011048_3719_4564 | 280 |
| 158 | 3300053102 | Ga0500554_006967 | Ga0500554_006967_413_1258 | 280 |
| 159 | 3300053136 | Ga0500559_0111278 | Ga0500559_0111278_229_1074 | 280 |
| 160 | 3300053148 | Ga0500590_122857 | Ga0500590_122857_152_997 | 280 |
| 161 | 3300053162 | Ga0500638_017996 | Ga0500638_017996_1902_2747 | 280 |
| 162 | 3300053178 | Ga0500637_0004089 | Ga0500637_0004089_557_1402 | 280 |
| 163 | 3300055283 | Ga0500661_004505 | Ga0500661_004505_1069_1914 | 280 |
| 164 | iso_pu_bacteria | 2739367866 | 2740034003 | 280 |
| 165 | iso_pu_bacteria | 2888378607 | 2888381643 | 280 |
| 166 | iso_pu_bacteria | 3005594810 | 3005596660 | 280 |
| 167 | iso_pu_bacteria | 3005710791 | 3005712736 | 280 |
| 168 | 3300005290 | Ga0065712_10207674 | Ga0065712_102076741 | 281 |
| 169 | 3300005354 | Ga0070675_100454428 | Ga0070675_1004544282 | 281 |
| 170 | 3300005365 | Ga0070688_100046964 | Ga0070688_1000469642 | 281 |
| 171 | 3300005434 | Ga0070709_10247026 | Ga0070709_102470261 | 281 |
| 172 | 3300005439 | Ga0070711_100020239 | Ga0070711_1000202393 | 281 |
| 173 | 3300005441 | Ga0070700_100035249 | Ga0070700_1000352492 | 281 |
| 174 | 3300005466 | Ga0070685_10003349 | Ga0070685_100033495 | 281 |
| 175 | 3300005545 | Ga0070695_100006254 | Ga0070695_1000062546 | 281 |
| 176 | 3300005844 | Ga0068862_100230192 | Ga0068862_1002301922 | 281 |
| 177 | 3300005983 | Ga0081540_1096976 | Ga0081540_10969761 | 281 |
| 178 | 3300006175 | Ga0070712_100007497 | Ga0070712_1000074973 | 281 |
| 179 | 3300006880 | Ga0075429_100372016 | Ga0075429_1003720161 | 281 |
| 180 | 3300009553 | Ga0105249_10142541 | Ga0105249_101425412 | 281 |
| 181 | 3300010375 | Ga0105239_10034199 | Ga0105239_100341992 | 281 |
| 182 | 3300013105 | Ga0157369_10018044 | Ga0157369_100180444 | 281 |
| 183 | 3300013105 | Ga0157369_10024585 | Ga0157369_100245855 | 281 |
| 184 | 3300025915 | Ga0207693_10002265 | Ga0207693_100022656 | 281 |
| 185 | 3300025916 | Ga0207663_10011783 | Ga0207663_100117832 | 281 |
| 186 | 3300025920 | Ga0207649_10010910 | Ga0207649_100109105 | 281 |
| 187 | 3300025923 | Ga0207681_10509575 | Ga0207681_105095751 | 281 |
| 188 | 3300026075 | Ga0207708_10086197 | Ga0207708_100861971 | 281 |
| 189 | 3300026118 | Ga0207675_100094377 | Ga0207675_1000943772 | 281 |
| 190 | 3300026142 | Ga0207698_10081745 | Ga0207698_100817454 | 281 |
| 191 | 3300028800 | Ga0265338_10032423 | Ga0265338_100324235 | 281 |
| 192 | 3300028800 | Ga0265338_10246173 | Ga0265338_102461732 | 281 |
| 193 | 3300031238 | Ga0265332_10107704 | Ga0265332_101077042 | 281 |
| 194 | 3300031240 | Ga0265320_10000413 | Ga0265320_1000041314 | 281 |
| 195 | 3300031241 | Ga0265325_10000221 | Ga0265325_100002217 | 281 |
| 196 | 3300031241 | Ga0265325_10111208 | Ga0265325_101112082 | 281 |
| 197 | 3300031247 | Ga0265340_10115308 | Ga0265340_101153081 | 281 |
| 198 | 3300031249 | Ga0265339_10010002 | Ga0265339_100100022 | 281 |
| 199 | 3300031249 | Ga0265339_10056013 | Ga0265339_100560131 | 281 |
| 200 | 3300031595 | Ga0265313_10000929 | Ga0265313_1000092917 | 281 |
| 201 | 3300031711 | Ga0265314_10011420 | Ga0265314_100114204 | 281 |
| 202 | 3300035695 | Ga0373927_0291332 | Ga0373927_0291332_207_1058 | 281 |
| 203 | 3300036401 | Ga0373937_0003575 | Ga0373937_0003575_10066_10917 | 281 |
| 204 | 3300037068 | Ga0373925_0068046 | Ga0373925_0068046_242_1093 | 281 |
| 205 | 3300047472 | Ga0495686_0059676 | Ga0495686_0059676_848_1699 | 281 |
| 206 | 3300049460 | Ga0495682_0005043 | Ga0495682_0005043_4495_5343 | 281 |
| 207 | 3300049571 | Ga0501034_0253069 | Ga0501034_0253069_304_1155 | 281 |
| 208 | 3300049571 | Ga0501034_0253582 | Ga0501034_0253582_302_1153 | 281 |
| 209 | 3300053133 | Ga0500655_027284 | Ga0500655_027284_63_911 | 281 |
| 210 | 3300060353 | Ga0501082_0326254 | Ga0501082_0326254_218_1072 | 281 |
| 211 | 3300003215 | JGI25153J46596_10006309 | JGI25153J46596_100063095 | 282 |
| 212 | 3300005336 | Ga0070680_100000939 | Ga0070680_1000009392 | 282 |
| 213 | 3300005434 | Ga0070709_10000582 | Ga0070709_1000058216 | 282 |
| 214 | 3300005435 | Ga0070714_100001277 | Ga0070714_10000127720 | 282 |
| 215 | 3300005436 | Ga0070713_100020001 | Ga0070713_1000200014 | 282 |
| 216 | 3300005458 | Ga0070681_10000068 | Ga0070681_1000006833 | 282 |
| 217 | 3300005530 | Ga0070679_100000301 | Ga0070679_10000030131 | 282 |
| 218 | 3300005536 | Ga0070697_100132291 | Ga0070697_1001322911 | 282 |
| 219 | 3300005563 | Ga0068855_100000024 | Ga0068855_100000024170 | 282 |
| 220 | 3300005616 | Ga0068852_100046750 | Ga0068852_1000467503 | 282 |
| 221 | 3300005983 | Ga0081540_1016641 | Ga0081540_10166412 | 282 |
| 222 | 3300006028 | Ga0070717_10170129 | Ga0070717_101701291 | 282 |
| 223 | 3300006051 | Ga0075364_10025047 | Ga0075364_100250473 | 282 |
| 224 | 3300006163 | Ga0070715_10001014 | Ga0070715_100010145 | 282 |
| 225 | 3300006175 | Ga0070712_100016816 | Ga0070712_1000168163 | 282 |
| 226 | 3300009093 | Ga0105240_10000132 | Ga0105240_10000132137 | 282 |
| 227 | 3300009093 | Ga0105240_10069221 | Ga0105240_100692212 | 282 |
| 228 | 3300009177 | Ga0105248_10000009 | Ga0105248_10000009148 | 282 |
| 229 | 3300009551 | Ga0105238_10039972 | Ga0105238_100399724 | 282 |
| 230 | 3300010375 | Ga0105239_10094357 | Ga0105239_100943574 | 282 |
| 231 | 3300010375 | Ga0105239_10254765 | Ga0105239_102547652 | 282 |
| 232 | 3300017792 | Ga0163161_10072003 | Ga0163161_100720031 | 282 |
| 233 | 3300017792 | Ga0163161_10232639 | Ga0163161_102326392 | 282 |
| 234 | 3300021358 | Ga0213873_10024394 | Ga0213873_100243943 | 282 |
| 235 | 3300021384 | Ga0213876_10006865 | Ga0213876_100068655 | 282 |
| 236 | 3300024227 | Ga0228598_1015024 | Ga0228598_10150242 | 282 |
| 237 | 3300025230 | Ga0209563_104990 | Ga0209563_1049902 | 282 |
| 238 | 3300025253 | Ga0209677_108255 | Ga0209677_1082552 | 282 |
| 239 | 3300025273 | Ga0209673_1013333 | Ga0209673_10133333 | 282 |
| 240 | 3300025295 | Ga0209564_1009906 | Ga0209564_10099064 | 282 |
| 241 | 3300025295 | Ga0209564_1020411 | Ga0209564_10204112 | 282 |
| 242 | 3300025297 | Ga0209758_1000141 | Ga0209758_100014152 | 282 |
| 243 | 3300025297 | Ga0209758_1000324 | Ga0209758_100032439 | 282 |
| 244 | 3300025297 | Ga0209758_1001709 | Ga0209758_100170913 | 282 |
| 245 | 3300025297 | Ga0209758_1006410 | Ga0209758_10064103 | 282 |
| 246 | 3300025297 | Ga0209758_1027369 | Ga0209758_10273693 | 282 |
| 247 | 3300025299 | Ga0209256_1005331 | Ga0209256_10053317 | 282 |
| 248 | 3300025302 | Ga0207426_1001139 | Ga0207426_100113922 | 282 |
| 249 | 3300025302 | Ga0207426_1035434 | Ga0207426_10354342 | 282 |
| 250 | 3300025302 | Ga0207426_1053796 | Ga0207426_10537962 | 282 |
| 251 | 3300025303 | Ga0209051_1035927 | Ga0209051_10359272 | 282 |
| 252 | 3300025304 | Ga0209257_1009854 | Ga0209257_10098542 | 282 |
| 253 | 3300025898 | Ga0207692_10000606 | Ga0207692_100006063 | 282 |
| 254 | 3300025898 | Ga0207692_10003679 | Ga0207692_100036793 | 282 |
| 255 | 3300025899 | Ga0207642_10078312 | Ga0207642_100783122 | 282 |
| 256 | 3300025900 | Ga0207710_10053579 | Ga0207710_100535793 | 282 |
| 257 | 3300025900 | Ga0207710_10077240 | Ga0207710_100772402 | 282 |
| 258 | 3300025901 | Ga0207688_10014229 | Ga0207688_100142295 | 282 |
| 259 | 3300025905 | Ga0207685_10062551 | Ga0207685_100625513 | 282 |
| 260 | 3300025906 | Ga0207699_10005515 | Ga0207699_100055155 | 282 |
| 261 | 3300025907 | Ga0207645_10132605 | Ga0207645_101326052 | 282 |
| 262 | 3300025907 | Ga0207645_10150594 | Ga0207645_101505941 | 282 |
| 263 | 3300025908 | Ga0207643_10053352 | Ga0207643_100533523 | 282 |
| 264 | 3300025910 | Ga0207684_10096387 | Ga0207684_100963873 | 282 |
| 265 | 3300025911 | Ga0207654_10036625 | Ga0207654_100366252 | 282 |
| 266 | 3300025912 | Ga0207707_10000002 | Ga0207707_100000021121 | 282 |
| 267 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003291 | 282 |
| 268 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062167 | 282 |
| 269 | 3300025913 | Ga0207695_10103092 | Ga0207695_101030923 | 282 |
| 270 | 3300025913 | Ga0207695_10150935 | Ga0207695_101509352 | 282 |
| 271 | 3300025914 | Ga0207671_10001897 | Ga0207671_100018972 | 282 |
| 272 | 3300025914 | Ga0207671_10137170 | Ga0207671_101371703 | 282 |
| 273 | 3300025914 | Ga0207671_10159721 | Ga0207671_101597212 | 282 |
| 274 | 3300025914 | Ga0207671_10196418 | Ga0207671_101964182 | 282 |
| 275 | 3300025914 | Ga0207671_10448385 | Ga0207671_104483852 | 282 |
| 276 | 3300025915 | Ga0207693_10005103 | Ga0207693_1000510311 | 282 |
| 277 | 3300025915 | Ga0207693_10043784 | Ga0207693_100437843 | 282 |
| 278 | 3300025916 | Ga0207663_10054529 | Ga0207663_100545293 | 282 |
| 279 | 3300025917 | Ga0207660_10001975 | Ga0207660_100019753 | 282 |
| 280 | 3300025919 | Ga0207657_10199384 | Ga0207657_101993841 | 282 |
| 281 | 3300025921 | Ga0207652_10000240 | Ga0207652_1000024016 | 282 |
| 282 | 3300025924 | Ga0207694_10000016 | Ga0207694_10000016263 | 282 |
| 283 | 3300025924 | Ga0207694_10069915 | Ga0207694_100699153 | 282 |
| 284 | 3300025924 | Ga0207694_10355109 | Ga0207694_103551092 | 282 |
| 285 | 3300025925 | Ga0207650_10359863 | Ga0207650_103598632 | 282 |
| 286 | 3300025927 | Ga0207687_10010179 | Ga0207687_100101795 | 282 |
| 287 | 3300025928 | Ga0207700_10053214 | Ga0207700_100532143 | 282 |
| 288 | 3300025929 | Ga0207664_10006176 | Ga0207664_100061763 | 282 |
| 289 | 3300025929 | Ga0207664_10055506 | Ga0207664_100555064 | 282 |
| 290 | 3300025933 | Ga0207706_10381257 | Ga0207706_103812571 | 282 |
| 291 | 3300025934 | Ga0207686_10246828 | Ga0207686_102468283 | 282 |
| 292 | 3300025935 | Ga0207709_10239466 | Ga0207709_102394663 | 282 |
| 293 | 3300025936 | Ga0207670_10028423 | Ga0207670_100284233 | 282 |
| 294 | 3300025938 | Ga0207704_10024331 | Ga0207704_100243315 | 282 |
| 295 | 3300025938 | Ga0207704_10230908 | Ga0207704_102309082 | 282 |
| 296 | 3300025939 | Ga0207665_10000580 | Ga0207665_1000058026 | 282 |
| 297 | 3300025940 | Ga0207691_10041318 | Ga0207691_100413182 | 282 |
| 298 | 3300025941 | Ga0207711_10000003 | Ga0207711_10000003475 | 282 |
| 299 | 3300025941 | Ga0207711_10000005 | Ga0207711_10000005660 | 282 |
| 300 | 3300025941 | Ga0207711_10000015 | Ga0207711_10000015228 | 282 |
| 301 | 3300025941 | Ga0207711_10091611 | Ga0207711_100916112 | 282 |
| 302 | 3300025941 | Ga0207711_10133474 | Ga0207711_101334742 | 282 |
| 303 | 3300025944 | Ga0207661_10036034 | Ga0207661_100360344 | 282 |
| 304 | 3300025945 | Ga0207679_10143273 | Ga0207679_101432732 | 282 |
| 305 | 3300025949 | Ga0207667_10000021 | Ga0207667_1000002184 | 282 |
| 306 | 3300025960 | Ga0207651_10241270 | Ga0207651_102412701 | 282 |
| 307 | 3300025986 | Ga0207658_10131268 | Ga0207658_101312681 | 282 |
| 308 | 3300025986 | Ga0207658_10280888 | Ga0207658_102808881 | 282 |
| 309 | 3300026035 | Ga0207703_10014806 | Ga0207703_100148066 | 282 |
| 310 | 3300026035 | Ga0207703_10124822 | Ga0207703_101248224 | 282 |
| 311 | 3300026035 | Ga0207703_10181246 | Ga0207703_101812464 | 282 |
| 312 | 3300026035 | Ga0207703_10428425 | Ga0207703_104284252 | 282 |
| 313 | 3300026067 | Ga0207678_10019793 | Ga0207678_100197934 | 282 |
| 314 | 3300026067 | Ga0207678_10050648 | Ga0207678_100506484 | 282 |
| 315 | 3300026067 | Ga0207678_10117343 | Ga0207678_101173432 | 282 |
| 316 | 3300026078 | Ga0207702_10004815 | Ga0207702_100048153 | 282 |
| 317 | 3300026088 | Ga0207641_10094672 | Ga0207641_100946725 | 282 |
| 318 | 3300026089 | Ga0207648_10076107 | Ga0207648_100761075 | 282 |
| 319 | 3300026089 | Ga0207648_10088048 | Ga0207648_100880483 | 282 |
| 320 | 3300026095 | Ga0207676_10063603 | Ga0207676_100636033 | 282 |
| 321 | 3300026118 | Ga0207675_100032581 | Ga0207675_1000325816 | 282 |
| 322 | 3300026118 | Ga0207675_100060167 | Ga0207675_1000601673 | 282 |
| 323 | 3300026121 | Ga0207683_10018490 | Ga0207683_100184904 | 282 |
| 324 | 3300026121 | Ga0207683_10035485 | Ga0207683_100354852 | 282 |
| 325 | 3300026121 | Ga0207683_10075529 | Ga0207683_100755292 | 282 |
| 326 | 3300026121 | Ga0207683_10200987 | Ga0207683_102009872 | 282 |
| 327 | 3300026142 | Ga0207698_10032091 | Ga0207698_100320914 | 282 |
| 328 | 3300026142 | Ga0207698_10060819 | Ga0207698_100608194 | 282 |
| 329 | 3300026142 | Ga0207698_10262888 | Ga0207698_102628881 | 282 |
| 330 | 3300026142 | Ga0207698_10265272 | Ga0207698_102652722 | 282 |
| 331 | 3300027296 | Ga0209389_1000004 | Ga0209389_1000004100 | 282 |
| 332 | 3300027361 | Ga0209489_100777 | Ga0209489_10077754 | 282 |
| 333 | 3300027363 | Ga0209700_100013 | Ga0209700_100013186 | 282 |
| 334 | 3300028379 | Ga0268266_10011051 | Ga0268266_100110514 | 282 |
| 335 | 3300028379 | Ga0268266_10285848 | Ga0268266_102858482 | 282 |
| 336 | 3300028380 | Ga0268265_10053336 | Ga0268265_100533365 | 282 |
| 337 | 3300028380 | Ga0268265_10397802 | Ga0268265_103978022 | 282 |
| 338 | 3300028381 | Ga0268264_10000038 | Ga0268264_1000003811 | 282 |
| 339 | 3300028381 | Ga0268264_10243430 | Ga0268264_102434301 | 282 |
| 340 | 3300028786 | Ga0307517_10000085 | Ga0307517_1000008520 | 282 |
| 341 | 3300028800 | Ga0265338_10000007 | Ga0265338_10000007443 | 282 |
| 342 | 3300028800 | Ga0265338_10155753 | Ga0265338_101557531 | 282 |
| 343 | 3300029957 | Ga0265324_10042482 | Ga0265324_100424822 | 282 |
| 344 | 3300030521 | Ga0307511_10052126 | Ga0307511_100521262 | 282 |
| 345 | 3300031235 | Ga0265330_10099923 | Ga0265330_100999232 | 282 |
| 346 | 3300031240 | Ga0265320_10025585 | Ga0265320_100255852 | 282 |
| 347 | 3300031241 | Ga0265325_10000001 | Ga0265325_10000001343 | 282 |
| 348 | 3300031241 | Ga0265325_10022794 | Ga0265325_100227942 | 282 |
| 349 | 3300031249 | Ga0265339_10002071 | Ga0265339_100020719 | 282 |
| 350 | 3300031250 | Ga0265331_10003286 | Ga0265331_100032868 | 282 |
| 351 | 3300031344 | Ga0265316_10073166 | Ga0265316_100731663 | 282 |
| 352 | 3300031344 | Ga0265316_10126120 | Ga0265316_101261202 | 282 |
| 353 | 3300031507 | Ga0307509_10055212 | Ga0307509_100552124 | 282 |
| 354 | 3300031507 | Ga0307509_10095762 | Ga0307509_100957623 | 282 |
| 355 | 3300031595 | Ga0265313_10002900 | Ga0265313_1000290010 | 282 |
| 356 | 3300031616 | Ga0307508_10000034 | Ga0307508_1000003429 | 282 |
| 357 | 3300031616 | Ga0307508_10299411 | Ga0307508_102994112 | 282 |
| 358 | 3300031665 | Ga0316575_10066884 | Ga0316575_100668842 | 282 |
| 359 | 3300031711 | Ga0265314_10003279 | Ga0265314_100032794 | 282 |
| 360 | 3300031711 | Ga0265314_10043034 | Ga0265314_100430342 | 282 |
| 361 | 3300031711 | Ga0265314_10056346 | Ga0265314_100563462 | 282 |
| 362 | 3300031711 | Ga0265314_10065061 | Ga0265314_100650612 | 282 |
| 363 | 3300031712 | Ga0265342_10027066 | Ga0265342_100270663 | 282 |
| 364 | 3300031712 | Ga0265342_10036503 | Ga0265342_100365031 | 282 |
| 365 | 3300031727 | Ga0316576_10003264 | Ga0316576_100032647 | 282 |
| 366 | 3300031730 | Ga0307516_10012055 | Ga0307516_100120553 | 282 |
| 367 | 3300031730 | Ga0307516_10147279 | Ga0307516_101472792 | 282 |
| 368 | 3300031730 | Ga0307516_10222631 | Ga0307516_102226313 | 282 |
| 369 | 3300032139 | Ga0316580_10065881 | Ga0316580_100658811 | 282 |
| 370 | 3300033179 | Ga0307507_10072118 | Ga0307507_100721184 | 282 |
| 371 | 3300033180 | Ga0307510_10003336 | Ga0307510_100033369 | 282 |
| 372 | 3300033180 | Ga0307510_10129708 | Ga0307510_101297082 | 282 |
| 373 | 3300033180 | Ga0307510_10134712 | Ga0307510_101347123 | 282 |
| 374 | 3300034816 | Ga0373930_0017130 | Ga0373930_0017130_310_1161 | 282 |
| 375 | 3300035091 | Ga0373951_0013454 | Ga0373951_0013454_263_1114 | 282 |
| 376 | 3300035112 | Ga0373932_0039539 | Ga0373932_0039539_417_1307 | 282 |
| 377 | 3300035114 | Ga0373939_0020564 | Ga0373939_0020564_854_1744 | 282 |
| 378 | 3300035119 | Ga0373956_0169285 | Ga0373956_0169285_82_936 | 282 |
| 379 | 3300035242 | Ga0373962_0013703 | Ga0373962_0013703_224_1114 | 282 |
| 380 | 3300035242 | Ga0373962_0040622 | Ga0373962_0040622_96_947 | 282 |
| 381 | 3300035398 | Ga0316574_0160494 | Ga0316574_0160494_26_877 | 282 |
| 382 | 3300035691 | Ga0373931_0017054 | Ga0373931_0017054_848_1699 | 282 |
| 383 | 3300035691 | Ga0373931_0115566 | Ga0373931_0115566_88_978 | 282 |
| 384 | 3300035692 | Ga0373935_0017908 | Ga0373935_0017908_560_1411 | 282 |
| 385 | 3300035695 | Ga0373927_0010098 | Ga0373927_0010098_4055_4906 | 282 |
| 386 | 3300035724 | Ga0373933_0002876 | Ga0373933_0002876_1156_2004 | 282 |
| 387 | 3300035725 | Ga0373947_0019804 | Ga0373947_0019804_1774_2625 | 282 |
| 388 | 3300035725 | Ga0373947_0423588 | Ga0373947_0423588_22_876 | 282 |
| 389 | 3300036401 | Ga0373937_0517638 | Ga0373937_0517638_188_1039 | 282 |
| 390 | 3300036712 | Ga0316584_0260862 | Ga0316584_0260862_92_943 | 282 |
| 391 | 3300037068 | Ga0373925_0108119 | Ga0373925_0108119_276_1127 | 282 |
| 392 | 3300037068 | Ga0373925_0351276 | Ga0373925_0351276_225_1076 | 282 |
| 393 | 3300037471 | Ga0395905_0008003 | Ga0395905_0008003_346_1194 | 282 |
| 394 | 3300037471 | Ga0395905_0178275 | Ga0395905_0178275_758_1609 | 282 |
| 395 | 3300037471 | Ga0395905_0389908 | Ga0395905_0389908_338_1189 | 282 |
| 396 | 3300038443 | Ga0395901_0321760 | Ga0395901_0321760_252_1100 | 282 |
| 397 | 3300039437 | Ga0436365_0211858 | Ga0436365_0211858_2804_3655 | 282 |
| 398 | 3300039437 | Ga0436365_1017537 | Ga0436365_1017537_2618_3472 | 282 |
| 399 | 3300039438 | Ga0436360_1321389 | Ga0436360_1321389_128_979 | 282 |
| 400 | 3300039447 | Ga0436361_0818803 | Ga0436361_0818803_1314_2165 | 282 |
| 401 | 3300039450 | Ga0436363_0020937 | Ga0436363_0020937_18_869 | 282 |
| 402 | 3300039450 | Ga0436363_1486701 | Ga0436363_1486701_471_1322 | 282 |
| 403 | 3300039453 | Ga0436362_0128483 | Ga0436362_0128483_3691_4542 | 282 |
| 404 | 3300039453 | Ga0436362_1240820 | Ga0436362_1240820_2487_3338 | 282 |
| 405 | 3300044673 | Ga0453683_0014438 | Ga0453683_0014438_4187_5044 | 282 |
| 406 | 3300044684 | Ga0466966_0000419 | Ga0466966_0000419_18785_19636 | 282 |
| 407 | 3300044693 | Ga0466961_0000020 | Ga0466961_0000020_64979_65830 | 282 |
| 408 | 3300045049 | Ga0466959_0023409 | Ga0466959_0023409_385_1236 | 282 |
| 409 | 3300045051 | Ga0451576_0000242 | Ga0451576_0000242_77037_77894 | 282 |
| 410 | 3300045051 | Ga0451576_0353520 | Ga0451576_0353520_176_1027 | 282 |
| 411 | 3300046454 | Ga0495592_0014283 | Ga0495592_0014283_1081_1932 | 282 |
| 412 | 3300046454 | Ga0495592_0057877 | Ga0495592_0057877_624_1622 | 282 |
| 413 | 3300046455 | Ga0495603_0004299 | Ga0495603_0004299_3858_4709 | 282 |
| 414 | 3300046459 | Ga0495629_0101341 | Ga0495629_0101341_397_1248 | 282 |
| 415 | 3300046459 | Ga0495629_0101425 | Ga0495629_0101425_1017_1868 | 282 |
| 416 | 3300046460 | Ga0495638_0020663 | Ga0495638_0020663_1864_2712 | 282 |
| 417 | 3300046460 | Ga0495638_0032262 | Ga0495638_0032262_1664_2515 | 282 |
| 418 | 3300046460 | Ga0495638_0042046 | Ga0495638_0042046_1212_2063 | 282 |
| 419 | 3300046462 | Ga0495651_0002943 | Ga0495651_0002943_9937_10788 | 282 |
| 420 | 3300046462 | Ga0495651_0025932 | Ga0495651_0025932_1358_2209 | 282 |
| 421 | 3300046462 | Ga0495651_0085487 | Ga0495651_0085487_520_1371 | 282 |
| 422 | 3300046462 | Ga0495651_0217327 | Ga0495651_0217327_390_1244 | 282 |
| 423 | 3300046462 | Ga0495651_0248930 | Ga0495651_0248930_71_922 | 282 |
| 424 | 3300046474 | Ga0495605_0046795 | Ga0495605_0046795_1048_1899 | 282 |
| 425 | 3300046477 | Ga0495664_0230356 | Ga0495664_0230356_96_947 | 282 |
| 426 | 3300046507 | Ga0495606_0023769 | Ga0495606_0023769_3289_4140 | 282 |
| 427 | 3300046507 | Ga0495606_0048670 | Ga0495606_0048670_1198_2049 | 282 |
| 428 | 3300046507 | Ga0495606_0176022 | Ga0495606_0176022_266_1117 | 282 |
| 429 | 3300046511 | Ga0495608_0025823 | Ga0495608_0025823_2832_3683 | 282 |
| 430 | 3300046511 | Ga0495608_0168866 | Ga0495608_0168866_97_1026 | 282 |
| 431 | 3300046513 | Ga0495616_0057330 | Ga0495616_0057330_712_1563 | 282 |
| 432 | 3300046514 | Ga0495618_0043410 | Ga0495618_0043410_903_1754 | 282 |
| 433 | 3300046514 | Ga0495618_0269510 | Ga0495618_0269510_97_1005 | 282 |
| 434 | 3300046516 | Ga0495628_0055958 | Ga0495628_0055958_578_1576 | 282 |
| 435 | 3300046517 | Ga0495630_0151444 | Ga0495630_0151444_191_1042 | 282 |
| 436 | 3300046522 | Ga0495643_0048901 | Ga0495643_0048901_341_1189 | 282 |
| 437 | 3300046522 | Ga0495643_0053422 | Ga0495643_0053422_208_1059 | 282 |
| 438 | 3300046522 | Ga0495643_0073092 | Ga0495643_0073092_608_1459 | 282 |
| 439 | 3300046523 | Ga0495644_0120921 | Ga0495644_0120921_20_871 | 282 |
| 440 | 3300046529 | Ga0495652_0020012 | Ga0495652_0020012_16_867 | 282 |
| 441 | 3300046533 | Ga0495640_0029617 | Ga0495640_0029617_83_934 | 282 |
| 442 | 3300046536 | Ga0495587_0115593 | Ga0495587_0115593_336_1190 | 282 |
| 443 | 3300046536 | Ga0495587_0116821 | Ga0495587_0116821_598_1449 | 282 |
| 444 | 3300046557 | Ga0495622_0037345 | Ga0495622_0037345_789_1640 | 282 |
| 445 | 3300046557 | Ga0495622_0060902 | Ga0495622_0060902_852_1703 | 282 |
| 446 | 3300046559 | Ga0495667_0235608 | Ga0495667_0235608_259_1110 | 282 |
| 447 | 3300046615 | Ga0495656_0013292 | Ga0495656_0013292_393_1244 | 282 |
| 448 | 3300046615 | Ga0495656_0017604 | Ga0495656_0017604_1396_2247 | 282 |
| 449 | 3300046642 | Ga0495634_0111264 | Ga0495634_0111264_701_1552 | 282 |
| 450 | 3300046648 | Ga0495611_0009307 | Ga0495611_0009307_1594_2445 | 282 |
| 451 | 3300046660 | Ga0495625_0097509 | Ga0495625_0097509_99_947 | 282 |
| 452 | 3300046660 | Ga0495625_0116234 | Ga0495625_0116234_75_926 | 282 |
| 453 | 3300046660 | Ga0495625_0173233 | Ga0495625_0173233_228_1079 | 282 |
| 454 | 3300046663 | Ga0495635_0106465 | Ga0495635_0106465_937_1788 | 282 |
| 455 | 3300046663 | Ga0495635_0260853 | Ga0495635_0260853_85_936 | 282 |
| 456 | 3300046664 | Ga0495659_0030718 | Ga0495659_0030718_847_1698 | 282 |
| 457 | 3300046664 | Ga0495659_0034014 | Ga0495659_0034014_736_1587 | 282 |
| 458 | 3300046674 | Ga0495588_0033223 | Ga0495588_0033223_508_1359 | 282 |
| 459 | 3300046674 | Ga0495588_0173464 | Ga0495588_0173464_219_1070 | 282 |
| 460 | 3300046675 | Ga0495657_0022214 | Ga0495657_0022214_881_1732 | 282 |
| 461 | 3300046675 | Ga0495657_0095210 | Ga0495657_0095210_14_865 | 282 |
| 462 | 3300046678 | Ga0495599_0111102 | Ga0495599_0111102_538_1392 | 282 |
| 463 | 3300046679 | Ga0495623_0020931 | Ga0495623_0020931_1385_2383 | 282 |
| 464 | 3300046679 | Ga0495623_0046161 | Ga0495623_0046161_1033_1884 | 282 |
| 465 | 3300046680 | Ga0495646_0023266 | Ga0495646_0023266_2812_3663 | 282 |
| 466 | 3300046684 | Ga0495669_0002200 | Ga0495669_0002200_4262_5113 | 282 |
| 467 | 3300046689 | Ga0495613_0295144 | Ga0495613_0295144_11_865 | 282 |
| 468 | 3300046690 | Ga0495624_0097946 | Ga0495624_0097946_286_1137 | 282 |
| 469 | 3300046694 | Ga0495649_0033655 | Ga0495649_0033655_180_1031 | 282 |
| 470 | 3300046809 | Ga0495600_0003794 | Ga0495600_0003794_1748_2599 | 282 |
| 471 | 3300046809 | Ga0495600_0050620 | Ga0495600_0050620_1006_1857 | 282 |
| 472 | 3300047317 | Ga0495604_0024585 | Ga0495604_0024585_3350_4201 | 282 |
| 473 | 3300047317 | Ga0495604_0034404 | Ga0495604_0034404_1453_2304 | 282 |
| 474 | 3300047317 | Ga0495604_0038058 | Ga0495604_0038058_486_1484 | 282 |
| 475 | 3300047318 | Ga0495636_0085627 | Ga0495636_0085627_115_966 | 282 |
| 476 | 3300047318 | Ga0495636_0123217 | Ga0495636_0123217_135_986 | 282 |
| 477 | 3300047319 | Ga0495674_0507609 | Ga0495674_0507609_85_936 | 282 |
| 478 | 3300047320 | Ga0495672_0014045 | Ga0495672_0014045_394_1245 | 282 |
| 479 | 3300047320 | Ga0495672_0042911 | Ga0495672_0042911_368_1219 | 282 |
| 480 | 3300047321 | Ga0495676_0365702 | Ga0495676_0365702_48_899 | 282 |
| 481 | 3300047322 | Ga0495680_0190465 | Ga0495680_0190465_347_1198 | 282 |
| 482 | 3300047445 | Ga0495677_0032747 | Ga0495677_0032747_806_1657 | 282 |
| 483 | 3300047471 | Ga0495684_0117067 | Ga0495684_0117067_853_1704 | 282 |
| 484 | 3300047471 | Ga0495684_0131539 | Ga0495684_0131539_19_870 | 282 |
| 485 | 3300047472 | Ga0495686_0061185 | Ga0495686_0061185_270_1121 | 282 |
| 486 | 3300047472 | Ga0495686_0242226 | Ga0495686_0242226_19_870 | 282 |
| 487 | 3300048088 | Ga0495602_0107207 | Ga0495602_0107207_674_1525 | 282 |
| 488 | 3300048903 | Ga0496100_0053153 | Ga0496100_0053153_128_979 | 282 |
| 489 | 3300048904 | Ga0496101_0004586 | Ga0496101_0004586_7767_8618 | 282 |
| 490 | 3300048905 | Ga0496102_0007305 | Ga0496102_0007305_3746_4597 | 282 |
| 491 | 3300048905 | Ga0496102_0052186 | Ga0496102_0052186_2829_3680 | 282 |
| 492 | 3300048906 | Ga0496103_0010719 | Ga0496103_0010719_1043_1894 | 282 |
| 493 | 3300048906 | Ga0496103_0041718 | Ga0496103_0041718_296_1147 | 282 |
| 494 | 3300048906 | Ga0496103_0194998 | Ga0496103_0194998_289_1140 | 282 |
| 495 | 3300048907 | Ga0496104_0027060 | Ga0496104_0027060_1835_2686 | 282 |
| 496 | 3300048907 | Ga0496104_0054323 | Ga0496104_0054323_2736_3587 | 282 |
| 497 | 3300048907 | Ga0496104_0099919 | Ga0496104_0099919_307_1158 | 282 |
| 498 | 3300048908 | Ga0496105_0077493 | Ga0496105_0077493_666_1517 | 282 |
| 499 | 3300048908 | Ga0496105_0084786 | Ga0496105_0084786_903_1754 | 282 |
| 500 | 3300048908 | Ga0496105_0182208 | Ga0496105_0182208_663_1514 | 282 |
| 501 | 3300048908 | Ga0496105_0223467 | Ga0496105_0223467_588_1439 | 282 |
| 502 | 3300048909 | Ga0496106_0005619 | Ga0496106_0005619_3502_4353 | 282 |
| 503 | 3300048909 | Ga0496106_0017753 | Ga0496106_0017753_2088_2939 | 282 |
| 504 | 3300048909 | Ga0496106_0066022 | Ga0496106_0066022_643_1494 | 282 |
| 505 | 3300048909 | Ga0496106_0135990 | Ga0496106_0135990_162_1013 | 282 |
| 506 | 3300048910 | Ga0496107_0000808 | Ga0496107_0000808_7753_8604 | 282 |
| 507 | 3300048910 | Ga0496107_0034118 | Ga0496107_0034118_1650_2501 | 282 |
| 508 | 3300048911 | Ga0496108_0018943 | Ga0496108_0018943_214_1065 | 282 |
| 509 | 3300048911 | Ga0496108_0044389 | Ga0496108_0044389_115_966 | 282 |
| 510 | 3300048912 | Ga0496109_0427324 | Ga0496109_0427324_277_1128 | 282 |
| 511 | 3300048913 | Ga0496110_0297108 | Ga0496110_0297108_303_1154 | 282 |
| 512 | 3300048913 | Ga0496110_0371834 | Ga0496110_0371834_245_1096 | 282 |
| 513 | 3300048914 | Ga0496111_0016617 | Ga0496111_0016617_842_1693 | 282 |
| 514 | 3300048914 | Ga0496111_0225778 | Ga0496111_0225778_433_1284 | 282 |
| 515 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_79740_80591 | 282 |
| 516 | 3300048915 | Ga0496112_0058241 | Ga0496112_0058241_42_893 | 282 |
| 517 | 3300048915 | Ga0496112_0064765 | Ga0496112_0064765_1810_2661 | 282 |
| 518 | 3300048915 | Ga0496112_0119981 | Ga0496112_0119981_1114_1965 | 282 |
| 519 | 3300048916 | Ga0496113_0009715 | Ga0496113_0009715_326_1177 | 282 |
| 520 | 3300048916 | Ga0496113_0043860 | Ga0496113_0043860_1001_1852 | 282 |
| 521 | 3300048917 | Ga0496114_0026566 | Ga0496114_0026566_902_1753 | 282 |
| 522 | 3300048917 | Ga0496114_0042858 | Ga0496114_0042858_1620_2471 | 282 |
| 523 | 3300048917 | Ga0496114_0044410 | Ga0496114_0044410_1836_2687 | 282 |
| 524 | 3300048918 | Ga0496115_0041375 | Ga0496115_0041375_2067_2918 | 282 |
| 525 | 3300048918 | Ga0496115_0186259 | Ga0496115_0186259_378_1229 | 282 |
| 526 | 3300048919 | Ga0496116_0004266 | Ga0496116_0004266_7423_8280 | 282 |
| 527 | 3300048919 | Ga0496116_0060416 | Ga0496116_0060416_530_1381 | 282 |
| 528 | 3300048921 | Ga0496118_0064136 | Ga0496118_0064136_899_1750 | 282 |
| 529 | 3300048921 | Ga0496118_0132685 | Ga0496118_0132685_153_1004 | 282 |
| 530 | 3300048921 | Ga0496118_0157147 | Ga0496118_0157147_130_987 | 282 |
| 531 | 3300048921 | Ga0496118_0254340 | Ga0496118_0254340_113_964 | 282 |
| 532 | 3300048922 | Ga0496119_0012771 | Ga0496119_0012771_4361_5212 | 282 |
| 533 | 3300048922 | Ga0496119_0031235 | Ga0496119_0031235_636_1487 | 282 |
| 534 | 3300048922 | Ga0496119_0052000 | Ga0496119_0052000_1278_2129 | 282 |
| 535 | 3300048922 | Ga0496119_0126030 | Ga0496119_0126030_219_1070 | 282 |
| 536 | 3300048923 | Ga0496120_0048159 | Ga0496120_0048159_846_1703 | 282 |
| 537 | 3300048923 | Ga0496120_0076050 | Ga0496120_0076050_180_1028 | 282 |
| 538 | 3300048924 | Ga0496121_0000099 | Ga0496121_0000099_3976_4827 | 282 |
| 539 | 3300048924 | Ga0496121_0000178 | Ga0496121_0000178_23514_24365 | 282 |
| 540 | 3300048924 | Ga0496121_0142291 | Ga0496121_0142291_489_1340 | 282 |
| 541 | 3300048924 | Ga0496121_0179020 | Ga0496121_0179020_639_1490 | 282 |
| 542 | 3300048924 | Ga0496121_0202130 | Ga0496121_0202130_501_1352 | 282 |
| 543 | 3300048925 | Ga0496122_0217945 | Ga0496122_0217945_147_998 | 282 |
| 544 | 3300048927 | Ga0496124_0008073 | Ga0496124_0008073_6949_7800 | 282 |
| 545 | 3300048927 | Ga0496124_0053777 | Ga0496124_0053777_2316_3167 | 282 |
| 546 | 3300048927 | Ga0496124_0401555 | Ga0496124_0401555_60_911 | 282 |
| 547 | 3300048928 | Ga0496125_0018440 | Ga0496125_0018440_1838_2695 | 282 |
| 548 | 3300048928 | Ga0496125_0051098 | Ga0496125_0051098_164_1015 | 282 |
| 549 | 3300048929 | Ga0496126_0025411 | Ga0496126_0025411_3507_4358 | 282 |
| 550 | 3300048929 | Ga0496126_0064343 | Ga0496126_0064343_2079_2930 | 282 |
| 551 | 3300048929 | Ga0496126_0122538 | Ga0496126_0122538_775_1626 | 282 |
| 552 | 3300048929 | Ga0496126_0143836 | Ga0496126_0143836_1098_1946 | 282 |
| 553 | 3300048929 | Ga0496126_0243471 | Ga0496126_0243471_443_1294 | 282 |
| 554 | 3300048929 | Ga0496126_0361982 | Ga0496126_0361982_247_1098 | 282 |
| 555 | 3300048929 | Ga0496126_0393619 | Ga0496126_0393619_230_1081 | 282 |
| 556 | 3300049460 | Ga0495682_0011847 | Ga0495682_0011847_1971_2822 | 282 |
| 557 | 3300049571 | Ga0501034_0021712 | Ga0501034_0021712_490_1371 | 282 |
| 558 | 3300049573 | Ga0501037_0220515 | Ga0501037_0220515_234_1115 | 282 |
| 559 | 3300049581 | Ga0501047_0016854 | Ga0501047_0016854_328_1209 | 282 |
| 560 | 3300049581 | Ga0501047_0266391 | Ga0501047_0266391_608_1459 | 282 |
| 561 | 3300049583 | Ga0501067_0003070 | Ga0501067_0003070_4594_5475 | 282 |
| 562 | 3300049585 | Ga0501069_0003810 | Ga0501069_0003810_4376_5257 | 282 |
| 563 | 3300049585 | Ga0501069_0080351 | Ga0501069_0080351_971_1822 | 282 |
| 564 | 3300049586 | Ga0501070_0021099 | Ga0501070_0021099_603_1484 | 282 |
| 565 | 3300049586 | Ga0501070_0141316 | Ga0501070_0141316_499_1350 | 282 |
| 566 | 3300049588 | Ga0501072_0060304 | Ga0501072_0060304_1044_1895 | 282 |
| 567 | 3300049590 | Ga0501074_0061029 | Ga0501074_0061029_1562_2443 | 282 |
| 568 | 3300049741 | Ga0501079_0001956 | Ga0501079_0001956_13881_14732 | 282 |
| 569 | 3300049822 | Ga0501035_0002651 | Ga0501035_0002651_3217_4098 | 282 |
| 570 | 3300049823 | Ga0501044_0142405 | Ga0501044_0142405_609_1460 | 282 |
| 571 | 3300049823 | Ga0501044_0145560 | Ga0501044_0145560_754_1635 | 282 |
| 572 | 3300050489 | nmdc:mga03683_83186_c1 | nmdc:mga03683_83186_c1_439_1290 | 282 |
| 573 | 3300050491 | nmdc:mga00v17_219998_c1 | nmdc:mga00v17_219998_c1_341_1192 | 282 |
| 574 | 3300050491 | nmdc:mga00v17_31325_c1 | nmdc:mga00v17_31325_c1_989_1846 | 282 |
| 575 | 3300050492 | nmdc:mga0yw44_101657_c1 | nmdc:mga0yw44_101657_c1_328_1179 | 282 |
| 576 | 3300050492 | nmdc:mga0yw44_44260_c1 | nmdc:mga0yw44_44260_c1_878_1729 | 282 |
| 577 | 3300050493 | nmdc:mga0k408_125943_c1 | nmdc:mga0k408_125943_c1_367_1215 | 282 |
| 578 | 3300050494 | nmdc:mga06z11_127663_c1 | nmdc:mga06z11_127663_c1_76_927 | 282 |
| 579 | 3300050494 | nmdc:mga06z11_4441_c1 | nmdc:mga06z11_4441_c1_1688_2539 | 282 |
| 580 | 3300050496 | nmdc:mga07m45_237815_c1 | nmdc:mga07m45_237815_c1_140_991 | 282 |
| 581 | 3300050507 | nmdc:mga05p37_69657_c1 | nmdc:mga05p37_69657_c1_1063_1914 | 282 |
| 582 | 3300050511 | nmdc:mga08y16_190300_c1 | nmdc:mga08y16_190300_c1_981_1832 | 282 |
| 583 | 3300050511 | nmdc:mga08y16_220898_c1 | nmdc:mga08y16_220898_c1_480_1331 | 282 |
| 584 | 3300050516 | nmdc:mga0sz30_15258_c1 | nmdc:mga0sz30_15258_c1_329_1180 | 282 |
| 585 | 3300053077 | Ga0495601_0136919 | Ga0495601_0136919_252_1106 | 282 |
| 586 | 3300053080 | Ga0500635_0001453 | Ga0500635_0001453_1641_2492 | 282 |
| 587 | 3300053084 | Ga0495595_0089780 | Ga0495595_0089780_575_1426 | 282 |
| 588 | 3300053084 | Ga0495595_0138699 | Ga0495595_0138699_305_1156 | 282 |
| 589 | 3300053085 | Ga0495619_0097184 | Ga0495619_0097184_705_1556 | 282 |
| 590 | 3300053086 | Ga0500578_0170974 | Ga0500578_0170974_263_1114 | 282 |
| 591 | 3300053087 | Ga0500643_000018 | Ga0500643_000018_282920_283771 | 282 |
| 592 | 3300053091 | Ga0500647_0018541 | Ga0500647_0018541_914_1765 | 282 |
| 593 | 3300053091 | Ga0500647_0052730 | Ga0500647_0052730_844_1695 | 282 |
| 594 | 3300053093 | Ga0500651_0005607 | Ga0500651_0005607_5703_6554 | 282 |
| 595 | 3300053094 | Ga0500566_0000008 | Ga0500566_0000008_69677_70528 | 282 |
| 596 | 3300053094 | Ga0500566_0005804 | Ga0500566_0005804_5642_6493 | 282 |
| 597 | 3300053095 | Ga0500640_127704 | Ga0500640_127704_37_888 | 282 |
| 598 | 3300053096 | Ga0500641_0013157 | Ga0500641_0013157_1530_2378 | 282 |
| 599 | 3300053096 | Ga0500641_0054600 | Ga0500641_0054600_605_1456 | 282 |
| 600 | 3300053098 | Ga0500650_0000650 | Ga0500650_0000650_1961_2809 | 282 |
| 601 | 3300053098 | Ga0500650_0110326 | Ga0500650_0110326_414_1265 | 282 |
| 602 | 3300053103 | Ga0500555_004973 | Ga0500555_004973_844_1695 | 282 |
| 603 | 3300053104 | Ga0500556_0067726 | Ga0500556_0067726_75_926 | 282 |
| 604 | 3300053104 | Ga0500556_0120649 | Ga0500556_0120649_112_963 | 282 |
| 605 | 3300053105 | Ga0500557_000008 | Ga0500557_000008_101353_102204 | 282 |
| 606 | 3300053108 | Ga0500562_010666 | Ga0500562_010666_291_1142 | 282 |
| 607 | 3300053109 | Ga0500569_050354 | Ga0500569_050354_61_912 | 282 |
| 608 | 3300053111 | Ga0500572_000613 | Ga0500572_000613_2441_3292 | 282 |
| 609 | 3300053115 | Ga0500591_017145 | Ga0500591_017145_154_1005 | 282 |
| 610 | 3300053119 | Ga0500595_007004 | Ga0500595_007004_940_1791 | 282 |
| 611 | 3300053119 | Ga0500595_007694 | Ga0500595_007694_3043_3894 | 282 |
| 612 | 3300053119 | Ga0500595_015175 | Ga0500595_015175_870_1721 | 282 |
| 613 | 3300053119 | Ga0500595_026858 | Ga0500595_026858_946_1797 | 282 |
| 614 | 3300053119 | Ga0500595_040960 | Ga0500595_040960_583_1434 | 282 |
| 615 | 3300053122 | Ga0500608_011051 | Ga0500608_011051_962_1813 | 282 |
| 616 | 3300053122 | Ga0500608_088447 | Ga0500608_088447_177_1028 | 282 |
| 617 | 3300053123 | Ga0500614_003090 | Ga0500614_003090_473_1324 | 282 |
| 618 | 3300053126 | Ga0500621_071249 | Ga0500621_071249_484_1335 | 282 |
| 619 | 3300053128 | Ga0500626_060325 | Ga0500626_060325_128_979 | 282 |
| 620 | 3300053136 | Ga0500559_0022048 | Ga0500559_0022048_1225_2076 | 282 |
| 621 | 3300053138 | Ga0500564_044060 | Ga0500564_044060_1045_1896 | 282 |
| 622 | 3300053139 | Ga0500568_0000833 | Ga0500568_0000833_9878_10726 | 282 |
| 623 | 3300053139 | Ga0500568_0003231 | Ga0500568_0003231_3822_4673 | 282 |
| 624 | 3300053140 | Ga0500573_0060874 | Ga0500573_0060874_911_1762 | 282 |
| 625 | 3300053148 | Ga0500590_062006 | Ga0500590_062006_887_1738 | 282 |
| 626 | 3300053150 | Ga0500603_000033 | Ga0500603_000033_30258_31109 | 282 |
| 627 | 3300053151 | Ga0500604_0001087 | Ga0500604_0001087_5871_6719 | 282 |
| 628 | 3300053153 | Ga0500616_0036946 | Ga0500616_0036946_1410_2261 | 282 |
| 629 | 3300053154 | Ga0500619_002479 | Ga0500619_002479_2550_3398 | 282 |
| 630 | 3300053156 | Ga0500622_0033063 | Ga0500622_0033063_526_1377 | 282 |
| 631 | 3300053158 | Ga0500627_0069343 | Ga0500627_0069343_62_913 | 282 |
| 632 | 3300053159 | Ga0500630_002640 | Ga0500630_002640_5824_6675 | 282 |
| 633 | 3300053162 | Ga0500638_081928 | Ga0500638_081928_354_1205 | 282 |
| 634 | 3300053163 | Ga0500639_000010 | Ga0500639_000010_96389_97240 | 282 |
| 635 | 3300053177 | Ga0500636_0000550 | Ga0500636_0000550_5594_6445 | 282 |
| 636 | 3300053178 | Ga0500637_0171913 | Ga0500637_0171913_11_862 | 282 |
| 637 | 3300053729 | Ga0500625_012573 | Ga0500625_012573_1363_2214 | 282 |
| 638 | 3300053730 | Ga0500645_018713 | Ga0500645_018713_240_1088 | 282 |
| 639 | 3300053731 | Ga0500609_007874 | Ga0500609_007874_555_1406 | 282 |
| 640 | 3300053735 | Ga0500596_003343 | Ga0500596_003343_1395_2246 | 282 |
| 641 | 3300053735 | Ga0500596_005085 | Ga0500596_005085_1001_1852 | 282 |
| 642 | 3300053736 | Ga0500599_003627 | Ga0500599_003627_993_1844 | 282 |
| 643 | 3300053737 | Ga0500601_002579 | Ga0500601_002579_358_1209 | 282 |
| 644 | 3300054114 | Ga0501084_0012218 | Ga0501084_0012218_1362_2243 | 282 |
| 645 | 3300054114 | Ga0501084_0137570 | Ga0501084_0137570_551_1402 | 282 |
| 646 | 3300055283 | Ga0500661_004963 | Ga0500661_004963_420_1271 | 282 |
| 647 | 3300060353 | Ga0501082_0149417 | Ga0501082_0149417_242_1123 | 282 |
| 648 | 3300060353 | Ga0501082_0398686 | Ga0501082_0398686_253_1104 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p19-assembly1.cif.gz_B | improved nadph-dependent blue fluorescent protein | 0.9334 | 1 | 253 |
| 3asu-assembly1.cif.gz_B-2 | crystal structure of serine dehydrogenase from escherichia coli | 0.9278 | 2 | 253 |
| 3asu-assembly1.cif.gz_A-2 | crystal structure of serine dehydrogenase from escherichia coli | 0.9203 | 2 | 256 |
| 3p19-assembly1.cif.gz_B | improved nadph-dependent blue fluorescent protein | 0.9169 | 1 | 253 |
| 2nwq-assembly1.cif.gz_A | short chain dehydrogenase from pseudomonas aeruginosa | 0.9144 | 1 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9333 | 2 | 185 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9303 | 85 | 185 | 3.40.50.720 |
| 2ehdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9301 | 2 | 253 | 3.40.50.720 |
| af_A0A0P0X9U1_21_128_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9273 | 2 | 88 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9219 | 2 | 196 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S0FLQ2-F1-model_v4 | deleted | 0.9999 | 1 | 192 |
|
| AF-A0A2M8ZND5-F1-model_v4 | deleted | 0.9926 | 1 | 282 |
|
| AF-A0A3C0M730-F1-model_v4 | Oxidoreductase | 0.9926 | 1 | 241 |
GO:0008202
GO:0016491 |
| AF-A0A7C9BMA6-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.99 | 2 | 186 |
GO:0016491
|
| AF-A0A3S0FLQ2-F1-model_v4 | deleted | 0.9896 | 1 | 192 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar