F472350
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 648 | 293 | 1296 | 69 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_101318383|Ga0070660_1013183832 |
| Length | 72 |
| Sequence | MNLFRSEEHVARWLDANGYQPGATLSMEGMGALAVAWWSDRLAPDWRPHTREQNAAILERLGLVGAFWTLPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 83 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 84 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 134 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 135 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 137 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 138 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 166 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 167 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 9.41 |
| Rhizosphere | 90.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_101318383 | 3300005339 | Unclassified | 613 |
| 2 | Ga0070658_10812224 | 3300005327 | Unclassified | 812 |
| 3 | Ga0070683_100272657 | 3300005329 | Bacteria | 1609 |
| 4 | Ga0070690_100093749 | 3300005330 | Unclassified | 1981 |
| 5 | Ga0068869_102159589 | 3300005334 | Bacteria | 501 |
| 6 | Ga0070680_100884470 | 3300005336 | Unclassified | 770 |
| 7 | Ga0070682_100102678 | 3300005337 | Unclassified | 1890 |
| 8 | Ga0070682_100786418 | 3300005337 | Unclassified | 772 |
| 9 | Ga0070660_100007052 | 3300005339 | Bacteria | 7807 |
| 10 | Ga0070660_100030204 | 3300005339 | Bacteria | 4064 |
| 11 | Ga0070660_100074625 | 3300005339 | Bacteria | 2654 |
| 12 | Ga0070660_101491972 | 3300005339 | Unclassified | 575 |
| 13 | Ga0070689_102097380 | 3300005340 | Unclassified | 518 |
| 14 | Ga0070661_100254170 | 3300005344 | Bacteria | 1357 |
| 15 | Ga0070661_100348273 | 3300005344 | Bacteria | 1162 |
| 16 | Ga0070661_101360071 | 3300005344 | Bacteria | 597 |
| 17 | Ga0070692_10704722 | 3300005345 | Bacteria | 680 |
| 18 | Ga0070692_10827058 | 3300005345 | Unclassified | 634 |
| 19 | Ga0070671_100499441 | 3300005355 | Bacteria | 1046 |
| 20 | Ga0070674_100293242 | 3300005356 | Bacteria | 1294 |
| 21 | Ga0070659_100480933 | 3300005366 | Bacteria | 1057 |
| 22 | Ga0070659_100700290 | 3300005366 | Bacteria | 876 |
| 23 | Ga0070703_10003289 | 3300005406 | Unclassified | 4607 |
| 24 | Ga0070703_10015024 | 3300005406 | Bacteria | 2212 |
| 25 | Ga0070709_10046079 | 3300005434 | Bacteria | 2709 |
| 26 | Ga0070709_10109424 | 3300005434 | Bacteria | 1855 |
| 27 | Ga0070709_10159971 | 3300005434 | Unclassified | 1565 |
| 28 | Ga0070709_10190241 | 3300005434 | Bacteria | 1447 |
| 29 | Ga0070709_11037628 | 3300005434 | Unclassified | 653 |
| 30 | Ga0070714_100029786 | 3300005435 | Bacteria | 4540 |
| 31 | Ga0070714_100101758 | 3300005435 | Bacteria | 2532 |
| 32 | Ga0070714_100177983 | 3300005435 | Bacteria | 1934 |
| 33 | Ga0070714_100541552 | 3300005435 | Unclassified | 1113 |
| 34 | Ga0070714_100686506 | 3300005435 | Bacteria | 987 |
| 35 | Ga0070714_101408239 | 3300005435 | Bacteria | 681 |
| 36 | Ga0070714_101433206 | 3300005435 | Bacteria | 674 |
| 37 | Ga0070714_101521372 | 3300005435 | Unclassified | 654 |
| 38 | Ga0070713_100036244 | 3300005436 | Bacteria | 3979 |
| 39 | Ga0070713_101623002 | 3300005436 | Bacteria | 628 |
| 40 | Ga0070713_101912666 | 3300005436 | Bacteria | 575 |
| 41 | Ga0070710_10031998 | 3300005437 | Bacteria | 2845 |
| 42 | Ga0070710_10403821 | 3300005437 | Unclassified | 916 |
| 43 | Ga0070710_10564070 | 3300005437 | Bacteria | 788 |
| 44 | Ga0070711_100502401 | 3300005439 | Bacteria | 1000 |
| 45 | Ga0070705_100017042 | 3300005440 | Bacteria | 3784 |
| 46 | Ga0070705_101231697 | 3300005440 | Bacteria | 618 |
| 47 | Ga0070708_100010592 | 3300005445 | Bacteria | 7477 |
| 48 | Ga0070708_100220957 | 3300005445 | Bacteria | 1777 |
| 49 | Ga0070708_101221342 | 3300005445 | Bacteria | 703 |
| 50 | Ga0070708_101438766 | 3300005445 | Bacteria | 643 |
| 51 | Ga0070678_100098411 | 3300005456 | Bacteria | 2261 |
| 52 | Ga0070681_10064252 | 3300005458 | Bacteria | 3641 |
| 53 | Ga0070681_10081212 | 3300005458 | Bacteria | 3198 |
| 54 | Ga0070681_10120713 | 3300005458 | Unclassified | 2556 |
| 55 | Ga0070681_10910767 | 3300005458 | Unclassified | 798 |
| 56 | Ga0070685_10411450 | 3300005466 | Bacteria | 939 |
| 57 | Ga0070706_100000796 | 3300005467 | Bacteria | 35230 |
| 58 | Ga0070706_100084357 | 3300005467 | Bacteria | 2943 |
| 59 | Ga0070706_100368141 | 3300005467 | Unclassified | 1339 |
| 60 | Ga0070706_100462245 | 3300005467 | Bacteria | 1181 |
| 61 | Ga0070706_100788582 | 3300005467 | Bacteria | 880 |
| 62 | Ga0070706_101682801 | 3300005467 | Bacteria | 578 |
| 63 | Ga0070707_100053112 | 3300005468 | Bacteria | 3884 |
| 64 | Ga0070707_100083621 | 3300005468 | Unclassified | 3084 |
| 65 | Ga0070707_100394821 | 3300005468 | Bacteria | 1343 |
| 66 | Ga0070707_100534767 | 3300005468 | Unclassified | 1134 |
| 67 | Ga0070707_100682658 | 3300005468 | Unclassified | 990 |
| 68 | Ga0070707_101359869 | 3300005468 | Bacteria | 677 |
| 69 | Ga0070707_101412195 | 3300005468 | Bacteria | 663 |
| 70 | Ga0070698_100324171 | 3300005471 | Unclassified | 1471 |
| 71 | Ga0070698_100541829 | 3300005471 | Unclassified | 1103 |
| 72 | Ga0070698_100949929 | 3300005471 | Unclassified | 806 |
| 73 | Ga0070698_101417659 | 3300005471 | Bacteria | 646 |
| 74 | Ga0070699_100091842 | 3300005518 | Bacteria | 2655 |
| 75 | Ga0070699_100258720 | 3300005518 | Unclassified | 1556 |
| 76 | Ga0070699_100367758 | 3300005518 | Bacteria | 1297 |
| 77 | Ga0070699_100390867 | 3300005518 | Unclassified | 1257 |
| 78 | Ga0070699_101051120 | 3300005518 | Bacteria | 747 |
| 79 | Ga0070699_101511073 | 3300005518 | Bacteria | 616 |
| 80 | Ga0070679_100008713 | 3300005530 | Bacteria | 9562 |
| 81 | Ga0070679_100815646 | 3300005530 | Unclassified | 876 |
| 82 | Ga0070679_101314686 | 3300005530 | Bacteria | 669 |
| 83 | Ga0070684_100265073 | 3300005535 | Bacteria | 1572 |
| 84 | Ga0070684_100396126 | 3300005535 | Bacteria | 1273 |
| 85 | Ga0070697_100059620 | 3300005536 | Bacteria | 3109 |
| 86 | Ga0070697_100060742 | 3300005536 | Bacteria | 3081 |
| 87 | Ga0070697_100560746 | 3300005536 | Bacteria | 1002 |
| 88 | Ga0070697_100758701 | 3300005536 | Unclassified | 857 |
| 89 | Ga0070697_101017352 | 3300005536 | Bacteria | 737 |
| 90 | Ga0070697_101572216 | 3300005536 | Bacteria | 588 |
| 91 | Ga0070686_100402343 | 3300005544 | Unclassified | 1041 |
| 92 | Ga0070695_100000106 | 3300005545 | Bacteria | 36745 |
| 93 | Ga0070695_100241880 | 3300005545 | Bacteria | 1310 |
| 94 | Ga0070696_100037745 | 3300005546 | Bacteria | 3332 |
| 95 | Ga0070696_100225444 | 3300005546 | Bacteria | 1408 |
| 96 | Ga0070696_100990048 | 3300005546 | Bacteria | 702 |
| 97 | Ga0070696_101111518 | 3300005546 | Bacteria | 665 |
| 98 | Ga0070693_100023037 | 3300005547 | Bacteria | 3322 |
| 99 | Ga0070693_100048457 | 3300005547 | Bacteria | 2420 |
| 100 | Ga0070693_100976876 | 3300005547 | Bacteria | 639 |
| 101 | Ga0070704_100138140 | 3300005549 | Bacteria | 1899 |
| 102 | Ga0070704_100470724 | 3300005549 | Unclassified | 1085 |
| 103 | Ga0070704_101768219 | 3300005549 | Bacteria | 572 |
| 104 | Ga0068855_101907455 | 3300005563 | Unclassified | 602 |
| 105 | Ga0070664_100221828 | 3300005564 | Bacteria | 1692 |
| 106 | Ga0070664_100626636 | 3300005564 | Bacteria | 999 |
| 107 | Ga0068857_100116957 | 3300005577 | Bacteria | 2399 |
| 108 | Ga0068854_100371745 | 3300005578 | Bacteria | 1176 |
| 109 | Ga0068856_100367664 | 3300005614 | Bacteria | 1457 |
| 110 | Ga0068856_100561600 | 3300005614 | Bacteria | 1163 |
| 111 | Ga0068856_100739688 | 3300005614 | Bacteria | 1003 |
| 112 | Ga0070702_100018133 | 3300005615 | Bacteria | 3645 |
| 113 | Ga0068852_100097515 | 3300005616 | Bacteria | 2645 |
| 114 | Ga0068864_100801275 | 3300005618 | Bacteria | 926 |
| 115 | Ga0068866_10917323 | 3300005718 | Bacteria | 617 |
| 116 | Ga0068863_100400859 | 3300005841 | Bacteria | 1342 |
| 117 | Ga0068860_102348296 | 3300005843 | Unclassified | 554 |
| 118 | Ga0081455_10632524 | 3300005937 | Bacteria | 692 |
| 119 | Ga0070717_10044362 | 3300006028 | Bacteria | 3630 |
| 120 | Ga0070717_10373540 | 3300006028 | Bacteria | 1278 |
| 121 | Ga0070717_11244947 | 3300006028 | Unclassified | 677 |
| 122 | Ga0070717_12134900 | 3300006028 | Unclassified | 504 |
| 123 | Ga0070716_100374663 | 3300006173 | Bacteria | 1015 |
| 124 | Ga0070712_100171953 | 3300006175 | Unclassified | 1682 |
| 125 | Ga0070712_100183611 | 3300006175 | Bacteria | 1632 |
| 126 | Ga0070712_100584857 | 3300006175 | Bacteria | 944 |
| 127 | Ga0070712_100931741 | 3300006175 | Bacteria | 750 |
| 128 | Ga0097621_100170451 | 3300006237 | Bacteria | 1876 |
| 129 | Ga0068871_100499753 | 3300006358 | Bacteria | 1096 |
| 130 | Ga0075428_100178818 | 3300006844 | Bacteria | 2297 |
| 131 | Ga0075428_101975839 | 3300006844 | Bacteria | 605 |
| 132 | Ga0075433_11088138 | 3300006852 | Unclassified | 695 |
| 133 | Ga0075434_102007441 | 3300006871 | Unclassified | 584 |
| 134 | Ga0099795_10132538 | 3300007788 | Bacteria | 1007 |
| 135 | Ga0105240_10014499 | 3300009093 | Bacteria | 10761 |
| 136 | Ga0105240_10038961 | 3300009093 | Bacteria | 6092 |
| 137 | Ga0105245_10104078 | 3300009098 | Bacteria | 2631 |
| 138 | Ga0105245_12655229 | 3300009098 | Bacteria | 554 |
| 139 | Ga0105247_10021640 | 3300009101 | Bacteria | 3870 |
| 140 | Ga0114129_11068745 | 3300009147 | Bacteria | 1012 |
| 141 | Ga0105241_10626294 | 3300009174 | Bacteria | 975 |
| 142 | Ga0105241_10878958 | 3300009174 | Unclassified | 831 |
| 143 | Ga0105248_10139772 | 3300009177 | Bacteria | 2732 |
| 144 | Ga0105237_10015176 | 3300009545 | Bacteria | 8027 |
| 145 | Ga0105237_12357027 | 3300009545 | Bacteria | 542 |
| 146 | Ga0105249_11206389 | 3300009553 | Bacteria | 828 |
| 147 | Ga0105239_10904386 | 3300010375 | Unclassified | 1013 |
| 148 | Ga0105239_12066126 | 3300010375 | Unclassified | 662 |
| 149 | Ga0105246_10921566 | 3300011119 | Bacteria | 785 |
| 150 | Ga0157373_10059978 | 3300013100 | Bacteria | 2695 |
| 151 | Ga0157373_10595996 | 3300013100 | Bacteria | 804 |
| 152 | Ga0157370_10077981 | 3300013104 | Bacteria | 3120 |
| 153 | Ga0157370_10214841 | 3300013104 | Bacteria | 1782 |
| 154 | Ga0157370_10360646 | 3300013104 | Bacteria | 1339 |
| 155 | Ga0157369_10185935 | 3300013105 | Bacteria | 2185 |
| 156 | Ga0157369_11457925 | 3300013105 | Bacteria | 696 |
| 157 | Ga0157369_11911750 | 3300013105 | Unclassified | 602 |
| 158 | Ga0157369_12163576 | 3300013105 | Bacteria | 564 |
| 159 | Ga0157374_10728245 | 3300013296 | Bacteria | 1006 |
| 160 | Ga0157374_11704206 | 3300013296 | Bacteria | 655 |
| 161 | Ga0157378_10344157 | 3300013297 | Bacteria | 1455 |
| 162 | Ga0157372_10020621 | 3300013307 | Bacteria | 7113 |
| 163 | Ga0157372_10807531 | 3300013307 | Bacteria | 1090 |
| 164 | Ga0157372_12898163 | 3300013307 | Unclassified | 549 |
| 165 | Ga0157375_10125319 | 3300013308 | Bacteria | 2683 |
| 166 | Ga0157375_13794348 | 3300013308 | Bacteria | 502 |
| 167 | Ga0163163_12158903 | 3300014325 | Bacteria | 616 |
| 168 | Ga0157380_10127367 | 3300014326 | Bacteria | 2166 |
| 169 | Ga0182008_10149787 | 3300014497 | Unclassified | 1170 |
| 170 | Ga0182008_10262925 | 3300014497 | Bacteria | 893 |
| 171 | Ga0182008_10564005 | 3300014497 | Bacteria | 634 |
| 172 | Ga0157377_10808518 | 3300014745 | Unclassified | 692 |
| 173 | Ga0182007_10218724 | 3300015262 | Bacteria | 672 |
| 174 | Ga0206356_10777173 | 3300020070 | Bacteria | 2426 |
| 175 | Ga0206353_10062287 | 3300020082 | Bacteria | 670 |
| 176 | Ga0206353_10614150 | 3300020082 | Bacteria | 1485 |
| 177 | Ga0206353_10964622 | 3300020082 | Bacteria | 1195 |
| 178 | Ga0213874_10379055 | 3300021377 | Unclassified | 547 |
| 179 | Ga0213871_10192881 | 3300021441 | Unclassified | 633 |
| 180 | Ga0207653_10002972 | 3300025885 | Bacteria | 5379 |
| 181 | Ga0207653_10003328 | 3300025885 | Bacteria | 5076 |
| 182 | Ga0207692_10745687 | 3300025898 | Unclassified | 638 |
| 183 | Ga0207710_10025634 | 3300025900 | Bacteria | 2545 |
| 184 | Ga0207699_10071057 | 3300025906 | Bacteria | 2127 |
| 185 | Ga0207705_10020115 | 3300025909 | Bacteria | 4774 |
| 186 | Ga0207705_10441832 | 3300025909 | Unclassified | 1008 |
| 187 | Ga0207684_10000001 | 3300025910 | Bacteria | 1115726 |
| 188 | Ga0207684_10346475 | 3300025910 | Bacteria | 1279 |
| 189 | Ga0207684_10883181 | 3300025910 | Bacteria | 752 |
| 190 | Ga0207654_10516221 | 3300025911 | Bacteria | 845 |
| 191 | Ga0207654_11187884 | 3300025911 | Unclassified | 556 |
| 192 | Ga0207707_10096791 | 3300025912 | Unclassified | 2579 |
| 193 | Ga0207707_10139893 | 3300025912 | Bacteria | 2117 |
| 194 | Ga0207707_10318806 | 3300025912 | Bacteria | 1342 |
| 195 | Ga0207707_10717449 | 3300025912 | Bacteria | 838 |
| 196 | Ga0207707_10997317 | 3300025912 | Unclassified | 687 |
| 197 | Ga0207695_10308149 | 3300025913 | Unclassified | 1474 |
| 198 | Ga0207695_10410444 | 3300025913 | Bacteria | 1239 |
| 199 | Ga0207671_10328681 | 3300025914 | Bacteria | 1211 |
| 200 | Ga0207693_10070448 | 3300025915 | Bacteria | 2736 |
| 201 | Ga0207693_10698858 | 3300025915 | Unclassified | 785 |
| 202 | Ga0207663_10056037 | 3300025916 | Bacteria | 2476 |
| 203 | Ga0207663_10284694 | 3300025916 | Bacteria | 1229 |
| 204 | Ga0207663_11241568 | 3300025916 | Unclassified | 600 |
| 205 | Ga0207660_10142070 | 3300025917 | Bacteria | 1836 |
| 206 | Ga0207660_10390820 | 3300025917 | Unclassified | 1119 |
| 207 | Ga0207657_10014288 | 3300025919 | Bacteria | 7759 |
| 208 | Ga0207657_10014299 | 3300025919 | Bacteria | 7753 |
| 209 | Ga0207657_11095734 | 3300025919 | Unclassified | 609 |
| 210 | Ga0207649_10149703 | 3300025920 | Bacteria | 1606 |
| 211 | Ga0207652_10298962 | 3300025921 | Bacteria | 1453 |
| 212 | Ga0207652_10537351 | 3300025921 | Unclassified | 1051 |
| 213 | Ga0207652_10904742 | 3300025921 | Unclassified | 779 |
| 214 | Ga0207652_11320140 | 3300025921 | Bacteria | 624 |
| 215 | Ga0207646_10023093 | 3300025922 | Bacteria | 5717 |
| 216 | Ga0207646_10122558 | 3300025922 | Bacteria | 2336 |
| 217 | Ga0207646_10584898 | 3300025922 | Bacteria | 1003 |
| 218 | Ga0207646_11004647 | 3300025922 | Unclassified | 737 |
| 219 | Ga0207687_10092009 | 3300025927 | Bacteria | 2214 |
| 220 | Ga0207687_10382013 | 3300025927 | Bacteria | 1154 |
| 221 | Ga0207700_10096997 | 3300025928 | Bacteria | 2342 |
| 222 | Ga0207700_10495125 | 3300025928 | Bacteria | 1081 |
| 223 | Ga0207664_10054299 | 3300025929 | Bacteria | 3174 |
| 224 | Ga0207664_10127933 | 3300025929 | Bacteria | 2134 |
| 225 | Ga0207664_10133314 | 3300025929 | Bacteria | 2094 |
| 226 | Ga0207664_10193901 | 3300025929 | Bacteria | 1750 |
| 227 | Ga0207664_10310865 | 3300025929 | Bacteria | 1388 |
| 228 | Ga0207664_10347829 | 3300025929 | Bacteria | 1312 |
| 229 | Ga0207664_10502498 | 3300025929 | Bacteria | 1086 |
| 230 | Ga0207664_10920759 | 3300025929 | Bacteria | 785 |
| 231 | Ga0207664_11348038 | 3300025929 | Unclassified | 634 |
| 232 | Ga0207664_11370577 | 3300025929 | Unclassified | 628 |
| 233 | Ga0207664_11466435 | 3300025929 | Bacteria | 604 |
| 234 | Ga0207644_11737862 | 3300025931 | Unclassified | 522 |
| 235 | Ga0207690_11571618 | 3300025932 | Unclassified | 550 |
| 236 | Ga0207706_11376466 | 3300025933 | Bacteria | 580 |
| 237 | Ga0207709_10329987 | 3300025935 | Bacteria | 1145 |
| 238 | Ga0207709_10487864 | 3300025935 | Bacteria | 959 |
| 239 | Ga0207670_11217593 | 3300025936 | Bacteria | 637 |
| 240 | Ga0207704_11883252 | 3300025938 | Unclassified | 514 |
| 241 | Ga0207665_10009738 | 3300025939 | Bacteria | 6308 |
| 242 | Ga0207665_10247061 | 3300025939 | Unclassified | 1317 |
| 243 | Ga0207665_11170224 | 3300025939 | Bacteria | 613 |
| 244 | Ga0207711_11121591 | 3300025941 | Bacteria | 727 |
| 245 | Ga0207711_11616837 | 3300025941 | Bacteria | 591 |
| 246 | Ga0207661_12028071 | 3300025944 | Unclassified | 521 |
| 247 | Ga0207679_12044567 | 3300025945 | Bacteria | 521 |
| 248 | Ga0207667_10028283 | 3300025949 | Bacteria | 6090 |
| 249 | Ga0207667_10200842 | 3300025949 | Bacteria | 2045 |
| 250 | Ga0207667_12160038 | 3300025949 | Unclassified | 514 |
| 251 | Ga0207712_10491888 | 3300025961 | Bacteria | 1047 |
| 252 | Ga0207640_10478505 | 3300025981 | Unclassified | 1032 |
| 253 | Ga0207677_11523081 | 3300026023 | Bacteria | 618 |
| 254 | Ga0207708_10254894 | 3300026075 | Bacteria | 1415 |
| 255 | Ga0207702_10181015 | 3300026078 | Bacteria | 1941 |
| 256 | Ga0207702_10633802 | 3300026078 | Bacteria | 1051 |
| 257 | Ga0207702_11441860 | 3300026078 | Bacteria | 682 |
| 258 | Ga0207641_10801055 | 3300026088 | Bacteria | 932 |
| 259 | Ga0207674_10099691 | 3300026116 | Bacteria | 2887 |
| 260 | Ga0207675_100673310 | 3300026118 | Bacteria | 1042 |
| 261 | Ga0207683_10008480 | 3300026121 | Bacteria | 8796 |
| 262 | Ga0207683_10057000 | 3300026121 | Bacteria | 3429 |
| 263 | Ga0207698_11424200 | 3300026142 | Bacteria | 708 |
| 264 | Ga0268264_12300899 | 3300028381 | Bacteria | 546 |
| 265 | Ga0265319_1053267 | 3300028563 | Bacteria | 1330 |
| 266 | Ga0265336_10011346 | 3300028666 | Bacteria | 3033 |
| 267 | Ga0265338_10002456 | 3300028800 | Bacteria | 27727 |
| 268 | Ga0307408_100897858 | 3300031548 | Bacteria | 811 |
| 269 | Ga0307413_10083893 | 3300031824 | Bacteria | 2052 |
| 270 | Ga0307409_100371533 | 3300031995 | Bacteria | 1356 |
| 271 | Ga0307415_100398362 | 3300032126 | Bacteria | 1174 |
| 272 | Ga0373930_0059219 | 3300034816 | Bacteria | 851 |
| 273 | Ga0373948_0001619 | 3300034817 | Bacteria | 3172 |
| 274 | Ga0373959_0008523 | 3300034820 | Bacteria | 1747 |
| 275 | Ga0373926_0381898 | 3300035083 | Unclassified | 555 |
| 276 | Ga0373928_0001325 | 3300035084 | Bacteria | 4858 |
| 277 | Ga0373929_0003994 | 3300035085 | Bacteria | 2644 |
| 278 | Ga0373940_0005886 | 3300035088 | Bacteria | 2686 |
| 279 | Ga0373944_0253943 | 3300035089 | Unclassified | 650 |
| 280 | Ga0373949_0005034 | 3300035090 | Bacteria | 2976 |
| 281 | Ga0373923_0451465 | 3300035111 | Viruses | 623 |
| 282 | Ga0373932_0003085 | 3300035112 | Bacteria | 4060 |
| 283 | Ga0373936_0045181 | 3300035113 | Bacteria | 1774 |
| 284 | Ga0373939_0043725 | 3300035114 | Bacteria | 1360 |
| 285 | Ga0373941_0004496 | 3300035115 | Bacteria | 3226 |
| 286 | Ga0373953_0026702 | 3300035117 | Bacteria | 2214 |
| 287 | Ga0373954_0238184 | 3300035118 | Unclassified | 896 |
| 288 | Ga0373957_0093482 | 3300035120 | Bacteria | 1198 |
| 289 | Ga0373943_0069446 | 3300035170 | Bacteria | 1780 |
| 290 | Ga0373943_0856389 | 3300035170 | Unclassified | 542 |
| 291 | Ga0373942_0052689 | 3300035207 | Bacteria | 1145 |
| 292 | Ga0373961_0005508 | 3300035241 | Bacteria | 3042 |
| 293 | Ga0373962_0010318 | 3300035242 | Bacteria | 2326 |
| 294 | Ga0373931_0138239 | 3300035691 | Bacteria | 1408 |
| 295 | Ga0373935_0256378 | 3300035692 | Unclassified | 1225 |
| 296 | Ga0373935_0494776 | 3300035692 | Bacteria | 887 |
| 297 | Ga0373947_0059627 | 3300035725 | Bacteria | 2314 |
| 298 | Ga0373947_0416899 | 3300035725 | Bacteria | 907 |
| 299 | Ga0373937_0156923 | 3300036401 | Bacteria | 2133 |
| 300 | Ga0373925_0115353 | 3300037068 | Unclassified | 2079 |
| 301 | Ga0373925_0872865 | 3300037068 | Unclassified | 741 |
| 302 | Ga0373925_1204967 | 3300037068 | Bacteria | 622 |
| 303 | Ga0395899_0205010 | 3300037312 | Bacteria | 1373 |
| 304 | Ga0395899_0790009 | 3300037312 | Bacteria | 587 |
| 305 | Ga0395899_0891796 | 3300037312 | Unclassified | 543 |
| 306 | Ga0395900_0166078 | 3300037418 | Bacteria | 2249 |
| 307 | Ga0395900_0228158 | 3300037418 | Bacteria | 1874 |
| 308 | Ga0395900_0475501 | 3300037418 | Bacteria | 1203 |
| 309 | Ga0395900_0592842 | 3300037418 | Unclassified | 1049 |
| 310 | Ga0395900_0789135 | 3300037418 | Bacteria | 878 |
| 311 | Ga0395900_1737383 | 3300037418 | Unclassified | 535 |
| 312 | Ga0395898_0113838 | 3300037466 | Bacteria | 2592 |
| 313 | Ga0395898_0183211 | 3300037466 | Bacteria | 2001 |
| 314 | Ga0395905_0141173 | 3300037471 | Bacteria | 2266 |
| 315 | Ga0395905_1248302 | 3300037471 | Bacteria | 647 |
| 316 | Ga0395901_0023454 | 3300038443 | Bacteria | 6327 |
| 317 | Ga0395901_0266052 | 3300038443 | Unclassified | 1784 |
| 318 | Ga0395901_0267907 | 3300038443 | Bacteria | 1777 |
| 319 | Ga0395901_0324884 | 3300038443 | Unclassified | 1591 |
| 320 | Ga0395901_0329378 | 3300038443 | Bacteria | 1579 |
| 321 | Ga0395901_0879826 | 3300038443 | Bacteria | 879 |
| 322 | Ga0395901_1765823 | 3300038443 | Unclassified | 568 |
| 323 | Ga0436360_0629357 | 3300039438 | Bacteria | 4824 |
| 324 | Ga0436360_0678051 | 3300039438 | Bacteria | 716 |
| 325 | Ga0439448_0113945 | 3300042005 | Bacteria | 925 |
| 326 | Ga0450894_056013 | 3300042131 | Unclassified | 587 |
| 327 | Ga0466969_0097733 | 3300044656 | Unclassified | 1385 |
| 328 | Ga0466969_0344921 | 3300044656 | Bacteria | 674 |
| 329 | Ga0466972_0013276 | 3300044658 | Bacteria | 4136 |
| 330 | Ga0466972_0554787 | 3300044658 | Bacteria | 542 |
| 331 | Ga0466972_0607633 | 3300044658 | Unclassified | 517 |
| 332 | Ga0466965_0051295 | 3300044683 | Bacteria | 2047 |
| 333 | Ga0466965_0051931 | 3300044683 | Bacteria | 2035 |
| 334 | Ga0466966_0028926 | 3300044684 | Bacteria | 3608 |
| 335 | Ga0466966_0196266 | 3300044684 | Bacteria | 1222 |
| 336 | Ga0466966_0512998 | 3300044684 | Unclassified | 721 |
| 337 | Ga0466961_0020742 | 3300044693 | Bacteria | 4229 |
| 338 | Ga0466961_0179183 | 3300044693 | Bacteria | 1316 |
| 339 | Ga0466961_0330833 | 3300044693 | Bacteria | 928 |
| 340 | Ga0466961_0421754 | 3300044693 | Bacteria | 809 |
| 341 | Ga0466961_0634350 | 3300044693 | Unclassified | 641 |
| 342 | Ga0466963_0002006 | 3300044694 | Bacteria | 11187 |
| 343 | Ga0466963_0006982 | 3300044694 | Bacteria | 6720 |
| 344 | Ga0466963_0007277 | 3300044694 | Bacteria | 6600 |
| 345 | Ga0466963_0008804 | 3300044694 | Bacteria | 6063 |
| 346 | Ga0466963_0011955 | 3300044694 | Bacteria | 5301 |
| 347 | Ga0466963_0094068 | 3300044694 | Bacteria | 2044 |
| 348 | Ga0466963_0113070 | 3300044694 | Bacteria | 1864 |
| 349 | Ga0466963_0255395 | 3300044694 | Bacteria | 1230 |
| 350 | Ga0466963_0458933 | 3300044694 | Bacteria | 899 |
| 351 | Ga0466963_0558805 | 3300044694 | Unclassified | 808 |
| 352 | Ga0466963_0634682 | 3300044694 | Bacteria | 754 |
| 353 | Ga0466964_0032653 | 3300044706 | Bacteria | 2069 |
| 354 | Ga0466964_0061360 | 3300044706 | Bacteria | 1565 |
| 355 | Ga0466964_0077350 | 3300044706 | Bacteria | 1421 |
| 356 | Ga0466964_0089304 | 3300044706 | Unclassified | 1338 |
| 357 | Ga0466964_0123086 | 3300044706 | Bacteria | 1172 |
| 358 | Ga0466964_0744125 | 3300044706 | Unclassified | 550 |
| 359 | Ga0466971_0002599 | 3300044719 | Bacteria | 7639 |
| 360 | Ga0466971_0068966 | 3300044719 | Bacteria | 1604 |
| 361 | Ga0466971_0317019 | 3300044719 | Bacteria | 751 |
| 362 | Ga0466971_0444744 | 3300044719 | Bacteria | 635 |
| 363 | Ga0466968_0002483 | 3300044735 | Bacteria | 6779 |
| 364 | Ga0466968_0014727 | 3300044735 | Bacteria | 3094 |
| 365 | Ga0466968_0063672 | 3300044735 | Bacteria | 1594 |
| 366 | Ga0466968_0067270 | 3300044735 | Bacteria | 1553 |
| 367 | Ga0466968_0072913 | 3300044735 | Bacteria | 1498 |
| 368 | Ga0466968_0076304 | 3300044735 | Unclassified | 1467 |
| 369 | Ga0466968_0081656 | 3300044735 | Bacteria | 1421 |
| 370 | Ga0466968_0408039 | 3300044735 | Bacteria | 667 |
| 371 | Ga0466968_0429655 | 3300044735 | Unclassified | 651 |
| 372 | Ga0466968_0664818 | 3300044735 | Bacteria | 530 |
| 373 | Ga0466970_0025902 | 3300044765 | Bacteria | 3073 |
| 374 | Ga0466970_0047963 | 3300044765 | Bacteria | 2277 |
| 375 | Ga0466957_0029706 | 3300044842 | Bacteria | 3261 |
| 376 | Ga0466957_0040186 | 3300044842 | Bacteria | 2825 |
| 377 | Ga0466957_0451240 | 3300044842 | Bacteria | 886 |
| 378 | Ga0466957_0613514 | 3300044842 | Bacteria | 762 |
| 379 | Ga0466957_0641831 | 3300044842 | Bacteria | 746 |
| 380 | Ga0466957_0724830 | 3300044842 | Unclassified | 703 |
| 381 | Ga0466957_1168658 | 3300044842 | Bacteria | 556 |
| 382 | Ga0466957_1332076 | 3300044842 | Unclassified | 521 |
| 383 | Ga0466960_0004236 | 3300044901 | Bacteria | 5584 |
| 384 | Ga0466960_0051154 | 3300044901 | Bacteria | 1995 |
| 385 | Ga0466960_0095368 | 3300044901 | Unclassified | 1523 |
| 386 | Ga0466960_0568622 | 3300044901 | Unclassified | 670 |
| 387 | Ga0466959_0029483 | 3300045049 | Bacteria | 4065 |
| 388 | Ga0466959_0048382 | 3300045049 | Bacteria | 3124 |
| 389 | Ga0466959_0147414 | 3300045049 | Unclassified | 1660 |
| 390 | Ga0466959_0154507 | 3300045049 | Bacteria | 1615 |
| 391 | Ga0466959_0243776 | 3300045049 | Bacteria | 1241 |
| 392 | Ga0466959_0294047 | 3300045049 | Unclassified | 1113 |
| 393 | Ga0466959_0669012 | 3300045049 | Unclassified | 696 |
| 394 | Ga0451576_0093071 | 3300045051 | Bacteria | 3134 |
| 395 | Ga0466958_0012762 | 3300045836 | Bacteria | 4765 |
| 396 | Ga0466958_0024033 | 3300045836 | Bacteria | 3583 |
| 397 | Ga0466958_0027320 | 3300045836 | Bacteria | 3378 |
| 398 | Ga0466958_0043921 | 3300045836 | Bacteria | 2693 |
| 399 | Ga0466958_0047860 | 3300045836 | Bacteria | 2582 |
| 400 | Ga0466958_0119821 | 3300045836 | Bacteria | 1647 |
| 401 | Ga0466958_0142788 | 3300045836 | Unclassified | 1508 |
| 402 | Ga0466958_0148972 | 3300045836 | Bacteria | 1475 |
| 403 | Ga0466958_0161738 | 3300045836 | Bacteria | 1415 |
| 404 | Ga0466958_0251268 | 3300045836 | Bacteria | 1131 |
| 405 | Ga0466958_0261753 | 3300045836 | Bacteria | 1107 |
| 406 | Ga0466958_0412654 | 3300045836 | Bacteria | 872 |
| 407 | Ga0466967_0001698 | 3300045976 | Bacteria | 13107 |
| 408 | Ga0466967_0018440 | 3300045976 | Bacteria | 5577 |
| 409 | Ga0466967_0019123 | 3300045976 | Bacteria | 5500 |
| 410 | Ga0466967_0031130 | 3300045976 | Bacteria | 4488 |
| 411 | Ga0466967_0041815 | 3300045976 | Bacteria | 3956 |
| 412 | Ga0466967_0097345 | 3300045976 | Bacteria | 2685 |
| 413 | Ga0466967_0141072 | 3300045976 | Bacteria | 2244 |
| 414 | Ga0466967_0148818 | 3300045976 | Bacteria | 2186 |
| 415 | Ga0466967_0188795 | 3300045976 | Unclassified | 1947 |
| 416 | Ga0466967_0195643 | 3300045976 | Bacteria | 1912 |
| 417 | Ga0466967_0217653 | 3300045976 | Bacteria | 1813 |
| 418 | Ga0466967_0313145 | 3300045976 | Unclassified | 1512 |
| 419 | Ga0466967_0688965 | 3300045976 | Bacteria | 1012 |
| 420 | Ga0466967_0822397 | 3300045976 | Unclassified | 923 |
| 421 | Ga0466967_0962500 | 3300045976 | Bacteria | 849 |
| 422 | Ga0466967_1471299 | 3300045976 | Unclassified | 678 |
| 423 | Ga0495592_0000123 | 3300046454 | Bacteria | 68503 |
| 424 | Ga0495592_0030159 | 3300046454 | Bacteria | 4101 |
| 425 | Ga0495603_0062804 | 3300046455 | Bacteria | 2192 |
| 426 | Ga0495603_0213450 | 3300046455 | Bacteria | 1114 |
| 427 | Ga0495629_0163855 | 3300046459 | Bacteria | 1544 |
| 428 | Ga0495629_0553006 | 3300046459 | Unclassified | 772 |
| 429 | Ga0495641_0025275 | 3300046461 | Bacteria | 2917 |
| 430 | Ga0495641_0054906 | 3300046461 | Bacteria | 1809 |
| 431 | Ga0495641_0104518 | 3300046461 | Unclassified | 1264 |
| 432 | Ga0495641_0169586 | 3300046461 | Bacteria | 977 |
| 433 | Ga0495651_0000029 | 3300046462 | Bacteria | 105042 |
| 434 | Ga0495651_0269333 | 3300046462 | Bacteria | 1155 |
| 435 | Ga0495653_0003956 | 3300046463 | Bacteria | 11963 |
| 436 | Ga0495653_0285556 | 3300046463 | Bacteria | 1081 |
| 437 | Ga0495653_0391144 | 3300046463 | Bacteria | 886 |
| 438 | Ga0495653_0639204 | 3300046463 | Bacteria | 651 |
| 439 | Ga0495582_0325256 | 3300046473 | Bacteria | 885 |
| 440 | Ga0495582_0550406 | 3300046473 | Bacteria | 667 |
| 441 | Ga0495582_0841344 | 3300046473 | Unclassified | 531 |
| 442 | Ga0495662_0174180 | 3300046476 | Bacteria | 1060 |
| 443 | Ga0495664_0150144 | 3300046477 | Bacteria | 1413 |
| 444 | Ga0495664_0206421 | 3300046477 | Bacteria | 1190 |
| 445 | Ga0495585_0129035 | 3300046492 | Unclassified | 1332 |
| 446 | Ga0495594_0332210 | 3300046499 | Bacteria | 866 |
| 447 | Ga0495596_0178517 | 3300046500 | Unclassified | 825 |
| 448 | Ga0495596_0198907 | 3300046500 | Bacteria | 779 |
| 449 | Ga0495607_0048477 | 3300046501 | Unclassified | 2484 |
| 450 | Ga0495608_0002826 | 3300046511 | Bacteria | 12446 |
| 451 | Ga0495608_0088963 | 3300046511 | Bacteria | 1999 |
| 452 | Ga0495608_0798019 | 3300046511 | Unclassified | 557 |
| 453 | Ga0495618_0009350 | 3300046514 | Bacteria | 5915 |
| 454 | Ga0495618_0318772 | 3300046514 | Bacteria | 963 |
| 455 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 456 | Ga0495628_0075327 | 3300046516 | Bacteria | 2628 |
| 457 | Ga0495630_0291733 | 3300046517 | Unclassified | 1246 |
| 458 | Ga0495630_0302376 | 3300046517 | Bacteria | 1222 |
| 459 | Ga0495630_1378976 | 3300046517 | Bacteria | 530 |
| 460 | Ga0495631_0169942 | 3300046518 | Unclassified | 935 |
| 461 | Ga0495644_0015725 | 3300046523 | Bacteria | 2900 |
| 462 | Ga0495652_0000045 | 3300046529 | Bacteria | 122469 |
| 463 | Ga0495652_0443943 | 3300046529 | Bacteria | 909 |
| 464 | Ga0495640_0004109 | 3300046533 | Bacteria | 11645 |
| 465 | Ga0495640_0088988 | 3300046533 | Bacteria | 2040 |
| 466 | Ga0495586_0021655 | 3300046535 | Bacteria | 3429 |
| 467 | Ga0495587_0000083 | 3300046536 | Bacteria | 73166 |
| 468 | Ga0495598_0411337 | 3300046537 | Unclassified | 530 |
| 469 | Ga0495645_0000306 | 3300046543 | Bacteria | 35497 |
| 470 | Ga0495645_0047894 | 3300046543 | Bacteria | 3113 |
| 471 | Ga0495667_0039034 | 3300046559 | Bacteria | 3160 |
| 472 | Ga0495667_0052463 | 3300046559 | Unclassified | 2686 |
| 473 | Ga0495667_0466033 | 3300046559 | Bacteria | 793 |
| 474 | Ga0495656_0002640 | 3300046615 | Bacteria | 5974 |
| 475 | Ga0495634_0030109 | 3300046642 | Bacteria | 3751 |
| 476 | Ga0495634_0211922 | 3300046642 | Bacteria | 1199 |
| 477 | Ga0495634_0418727 | 3300046642 | Bacteria | 794 |
| 478 | Ga0495611_0090010 | 3300046648 | Unclassified | 1418 |
| 479 | Ga0495635_0963937 | 3300046663 | Bacteria | 544 |
| 480 | Ga0495659_0017587 | 3300046664 | Bacteria | 2372 |
| 481 | Ga0495659_0214380 | 3300046664 | Unclassified | 793 |
| 482 | Ga0495657_0002001 | 3300046675 | Bacteria | 17366 |
| 483 | Ga0495657_0044790 | 3300046675 | Unclassified | 3007 |
| 484 | Ga0495657_0179398 | 3300046675 | Bacteria | 1301 |
| 485 | Ga0495657_0401794 | 3300046675 | Unclassified | 806 |
| 486 | Ga0495599_0000219 | 3300046678 | Bacteria | 36729 |
| 487 | Ga0495599_0055035 | 3300046678 | Bacteria | 2492 |
| 488 | Ga0495623_0000429 | 3300046679 | Bacteria | 27648 |
| 489 | Ga0495623_0715116 | 3300046679 | Bacteria | 512 |
| 490 | Ga0495646_0017542 | 3300046680 | Bacteria | 4540 |
| 491 | Ga0495647_0214101 | 3300046681 | Bacteria | 848 |
| 492 | Ga0495658_0288680 | 3300046683 | Bacteria | 1036 |
| 493 | Ga0495658_0717597 | 3300046683 | Unclassified | 640 |
| 494 | Ga0495613_0002918 | 3300046689 | Bacteria | 12813 |
| 495 | Ga0495613_0381572 | 3300046689 | Unclassified | 964 |
| 496 | Ga0495613_0557969 | 3300046689 | Bacteria | 766 |
| 497 | Ga0495624_0110472 | 3300046690 | Bacteria | 1691 |
| 498 | Ga0495624_0114314 | 3300046690 | Unclassified | 1659 |
| 499 | Ga0495649_0642241 | 3300046694 | Bacteria | 522 |
| 500 | Ga0495600_0071773 | 3300046809 | Bacteria | 2262 |
| 501 | Ga0495600_0120139 | 3300046809 | Bacteria | 1709 |
| 502 | Ga0495600_0586256 | 3300046809 | Unclassified | 679 |
| 503 | Ga0495581_0074306 | 3300047315 | Bacteria | 1967 |
| 504 | Ga0495581_0167220 | 3300047315 | Unclassified | 1286 |
| 505 | Ga0495604_0000072 | 3300047317 | Bacteria | 88631 |
| 506 | Ga0495604_0068411 | 3300047317 | Bacteria | 2695 |
| 507 | Ga0495636_0053620 | 3300047318 | Unclassified | 1693 |
| 508 | Ga0495674_0045450 | 3300047319 | Bacteria | 3899 |
| 509 | Ga0495674_0060387 | 3300047319 | Bacteria | 3308 |
| 510 | Ga0495674_0189677 | 3300047319 | Bacteria | 1709 |
| 511 | Ga0495676_0162915 | 3300047321 | Bacteria | 1576 |
| 512 | Ga0495676_0205444 | 3300047321 | Bacteria | 1366 |
| 513 | Ga0495676_0923640 | 3300047321 | Bacteria | 558 |
| 514 | Ga0495676_1003194 | 3300047321 | Unclassified | 533 |
| 515 | Ga0495680_0003161 | 3300047322 | Bacteria | 16400 |
| 516 | Ga0495680_0205289 | 3300047322 | Unclassified | 1412 |
| 517 | Ga0495675_0000031 | 3300047444 | Bacteria | 99240 |
| 518 | Ga0495675_0077260 | 3300047444 | Bacteria | 2098 |
| 519 | Ga0495677_0045927 | 3300047445 | Unclassified | 1603 |
| 520 | Ga0495673_0242545 | 3300047469 | Unclassified | 660 |
| 521 | Ga0495684_0005222 | 3300047471 | Bacteria | 10121 |
| 522 | Ga0495684_1075699 | 3300047471 | Unclassified | 506 |
| 523 | Ga0495602_0000133 | 3300048088 | Bacteria | 69392 |
| 524 | Ga0495614_0135856 | 3300048089 | Archaea | 1091 |
| 525 | Ga0496100_0185217 | 3300048903 | Bacteria | 1508 |
| 526 | Ga0496100_0981271 | 3300048903 | Unclassified | 664 |
| 527 | Ga0496100_1220986 | 3300048903 | Bacteria | 593 |
| 528 | Ga0496101_0028111 | 3300048904 | Bacteria | 3923 |
| 529 | Ga0496101_0188124 | 3300048904 | Bacteria | 1592 |
| 530 | Ga0496101_1302256 | 3300048904 | Bacteria | 568 |
| 531 | Ga0496102_0028751 | 3300048905 | Bacteria | 4969 |
| 532 | Ga0496102_0031068 | 3300048905 | Bacteria | 4787 |
| 533 | Ga0496102_0051569 | 3300048905 | Bacteria | 3748 |
| 534 | Ga0496102_0226769 | 3300048905 | Bacteria | 1762 |
| 535 | Ga0496102_0677213 | 3300048905 | Unclassified | 954 |
| 536 | Ga0496102_1389417 | 3300048905 | Archaea | 621 |
| 537 | Ga0496102_1500271 | 3300048905 | Unclassified | 593 |
| 538 | Ga0496103_0005252 | 3300048906 | Bacteria | 7776 |
| 539 | Ga0496103_0005964 | 3300048906 | Bacteria | 7287 |
| 540 | Ga0496103_0042219 | 3300048906 | Bacteria | 2805 |
| 541 | Ga0496104_0006253 | 3300048907 | Bacteria | 10464 |
| 542 | Ga0496104_0268810 | 3300048907 | Bacteria | 1617 |
| 543 | Ga0496104_0878823 | 3300048907 | Bacteria | 801 |
| 544 | Ga0496104_1172406 | 3300048907 | Bacteria | 671 |
| 545 | Ga0496104_1738187 | 3300048907 | Bacteria | 526 |
| 546 | Ga0496105_0035035 | 3300048908 | Bacteria | 4130 |
| 547 | Ga0496105_0124219 | 3300048908 | Bacteria | 2127 |
| 548 | Ga0496105_0201937 | 3300048908 | Bacteria | 1622 |
| 549 | Ga0496105_0712398 | 3300048908 | Bacteria | 769 |
| 550 | Ga0496106_0224750 | 3300048909 | Bacteria | 1497 |
| 551 | Ga0496106_0336160 | 3300048909 | Bacteria | 1213 |
| 552 | Ga0496107_0050169 | 3300048910 | Bacteria | 3007 |
| 553 | Ga0496107_0197410 | 3300048910 | Bacteria | 1495 |
| 554 | Ga0496108_0018399 | 3300048911 | Bacteria | 5719 |
| 555 | Ga0496108_0033295 | 3300048911 | Bacteria | 4281 |
| 556 | Ga0496108_0146135 | 3300048911 | Bacteria | 2038 |
| 557 | Ga0496108_0282306 | 3300048911 | Bacteria | 1445 |
| 558 | Ga0496108_1314279 | 3300048911 | Unclassified | 608 |
| 559 | Ga0496109_0020592 | 3300048912 | Bacteria | 5826 |
| 560 | Ga0496109_0277769 | 3300048912 | Unclassified | 1578 |
| 561 | Ga0496109_0398534 | 3300048912 | Bacteria | 1300 |
| 562 | Ga0496109_0447967 | 3300048912 | Bacteria | 1219 |
| 563 | Ga0496109_0633978 | 3300048912 | Bacteria | 1005 |
| 564 | Ga0496110_0102065 | 3300048913 | Bacteria | 2572 |
| 565 | Ga0496110_0233940 | 3300048913 | Bacteria | 1671 |
| 566 | Ga0496111_0033331 | 3300048914 | Bacteria | 3673 |
| 567 | Ga0496111_0033863 | 3300048914 | Bacteria | 3644 |
| 568 | Ga0496111_0063311 | 3300048914 | Bacteria | 2682 |
| 569 | Ga0496112_0022196 | 3300048915 | Bacteria | 6049 |
| 570 | Ga0496112_0099498 | 3300048915 | Bacteria | 2877 |
| 571 | Ga0496112_0196321 | 3300048915 | Bacteria | 1978 |
| 572 | Ga0496112_0214900 | 3300048915 | Bacteria | 1879 |
| 573 | Ga0496112_1096133 | 3300048915 | Bacteria | 714 |
| 574 | Ga0496113_0082165 | 3300048916 | Bacteria | 2470 |
| 575 | Ga0496113_0098110 | 3300048916 | Bacteria | 2267 |
| 576 | Ga0496113_0218826 | 3300048916 | Bacteria | 1517 |
| 577 | Ga0496113_0253050 | 3300048916 | Bacteria | 1406 |
| 578 | Ga0496113_0458241 | 3300048916 | Bacteria | 1025 |
| 579 | Ga0496113_0710081 | 3300048916 | Bacteria | 802 |
| 580 | Ga0496114_0083140 | 3300048917 | Unclassified | 2708 |
| 581 | Ga0496114_0094393 | 3300048917 | Bacteria | 2544 |
| 582 | Ga0496114_0515985 | 3300048917 | Bacteria | 1057 |
| 583 | Ga0496115_0060441 | 3300048918 | Bacteria | 3053 |
| 584 | Ga0496115_0074222 | 3300048918 | Bacteria | 2761 |
| 585 | Ga0496115_0813106 | 3300048918 | Bacteria | 726 |
| 586 | Ga0501031_0004754 | 3300049568 | Bacteria | 8820 |
| 587 | Ga0501032_0287055 | 3300049569 | Bacteria | 1065 |
| 588 | Ga0501036_0046060 | 3300049572 | Bacteria | 3693 |
| 589 | Ga0501037_0467186 | 3300049573 | Bacteria | 859 |
| 590 | Ga0501038_0061306 | 3300049574 | Bacteria | 3217 |
| 591 | Ga0501039_0007399 | 3300049575 | Bacteria | 8373 |
| 592 | Ga0501039_0316644 | 3300049575 | Bacteria | 1227 |
| 593 | Ga0501040_0011540 | 3300049576 | Bacteria | 5783 |
| 594 | Ga0501040_0302114 | 3300049576 | Bacteria | 1144 |
| 595 | Ga0501041_0000831 | 3300049577 | Bacteria | 16549 |
| 596 | Ga0501042_0000539 | 3300049578 | Bacteria | 19836 |
| 597 | Ga0501043_0054289 | 3300049579 | Bacteria | 3146 |
| 598 | Ga0501046_0001759 | 3300049580 | Bacteria | 20697 |
| 599 | Ga0501046_0441601 | 3300049580 | Bacteria | 936 |
| 600 | Ga0501048_0057279 | 3300049582 | Bacteria | 2763 |
| 601 | Ga0501067_0015125 | 3300049583 | Bacteria | 4270 |
| 602 | Ga0501067_0029377 | 3300049583 | Bacteria | 3046 |
| 603 | Ga0501068_0009363 | 3300049584 | Bacteria | 5477 |
| 604 | Ga0501068_0184377 | 3300049584 | Bacteria | 1320 |
| 605 | Ga0501069_0023595 | 3300049585 | Bacteria | 3355 |
| 606 | Ga0501070_0345084 | 3300049586 | Unclassified | 1209 |
| 607 | Ga0501071_0020772 | 3300049587 | Bacteria | 4566 |
| 608 | Ga0501072_0008040 | 3300049588 | Bacteria | 8004 |
| 609 | Ga0501072_0701543 | 3300049588 | Bacteria | 795 |
| 610 | Ga0501073_0026944 | 3300049589 | Bacteria | 4115 |
| 611 | Ga0501074_0002779 | 3300049590 | Bacteria | 12247 |
| 612 | Ga0501075_0000468 | 3300049591 | Bacteria | 24012 |
| 613 | Ga0501076_0004870 | 3300049592 | Bacteria | 9595 |
| 614 | Ga0501077_0035080 | 3300049593 | Unclassified | 3193 |
| 615 | Ga0501079_0004598 | 3300049741 | Bacteria | 10228 |
| 616 | Ga0501079_0435867 | 3300049741 | Bacteria | 1029 |
| 617 | Ga0501080_0093538 | 3300049742 | Bacteria | 2791 |
| 618 | Ga0501081_0003165 | 3300049743 | Bacteria | 10467 |
| 619 | Ga0501081_0825000 | 3300049743 | Bacteria | 698 |
| 620 | Ga0501083_0094187 | 3300049744 | Bacteria | 1977 |
| 621 | Ga0501035_0013695 | 3300049822 | Bacteria | 7483 |
| 622 | Ga0501045_0001327 | 3300049824 | Bacteria | 16429 |
| 623 | nmdc:mga03683_169982_c1 | 3300050489 | Bacteria | 990 |
| 624 | nmdc:mga00v17_535052_c1 | 3300050491 | Unclassified | 758 |
| 625 | nmdc:mga08x19_425082_c1 | 3300050514 | Bacteria | 933 |
| 626 | Ga0495601_0000626 | 3300053077 | Bacteria | 18860 |
| 627 | Ga0495601_0009387 | 3300053077 | Bacteria | 5786 |
| 628 | Ga0495601_0577305 | 3300053077 | Bacteria | 722 |
| 629 | Ga0495612_0103599 | 3300053078 | Bacteria | 1213 |
| 630 | Ga0495655_0102925 | 3300053083 | Unclassified | 848 |
| 631 | Ga0495595_0068824 | 3300053084 | Bacteria | 1670 |
| 632 | Ga0495595_0368329 | 3300053084 | Unclassified | 726 |
| 633 | Ga0495595_0639443 | 3300053084 | Bacteria | 544 |
| 634 | Ga0495619_0005077 | 3300053085 | Bacteria | 8362 |
| 635 | Ga0495619_0052173 | 3300053085 | Bacteria | 2703 |
| 636 | Ga0495619_0058992 | 3300053085 | Bacteria | 2549 |
| 637 | Ga0501084_0003996 | 3300054114 | Bacteria | 12014 |
| 638 | Ga0501084_1077032 | 3300054114 | Bacteria | 675 |
| 639 | Ga0587073_0211367 | 3300059492 | Archaea | 587 |
| 640 | Ga0501082_0002382 | 3300060353 | Bacteria | 16473 |
| 641 | Ga0501082_1472840 | 3300060353 | Bacteria | 594 |
| 642 | Ga0466962_0003932 | 3300061719 | Bacteria | 7110 |
| 643 | Ga0466962_0152342 | 3300061719 | Bacteria | 1122 |
| 644 | Ga0466962_0348275 | 3300061719 | Bacteria | 737 |
| 645 | Ga0466962_0551878 | 3300061719 | Bacteria | 585 |
| 646 | Ga0466962_0656597 | 3300061719 | Unclassified | 536 |
| 647 | Ga0530510_0057010 | 3300061734 | Bacteria | 2823 |
| 648 | Ga0530510_0318979 | 3300061734 | Bacteria | 1165 |
| 649 | Ga0070660_101318383 | |||
| 650 | Ga0070658_10812224 | |||
| 651 | Ga0070683_100272657 | |||
| 652 | Ga0070690_100093749 | |||
| 653 | Ga0068869_102159589 | |||
| 654 | Ga0070680_100884470 | |||
| 655 | Ga0070682_100102678 | |||
| 656 | Ga0070682_100786418 | |||
| 657 | Ga0070660_100007052 | |||
| 658 | Ga0070660_100030204 | |||
| 659 | Ga0070660_100074625 | |||
| 660 | Ga0070660_101491972 | |||
| 661 | Ga0070689_102097380 | |||
| 662 | Ga0070661_100254170 | |||
| 663 | Ga0070661_100348273 | |||
| 664 | Ga0070661_101360071 | |||
| 665 | Ga0070692_10704722 | |||
| 666 | Ga0070692_10827058 | |||
| 667 | Ga0070671_100499441 | |||
| 668 | Ga0070674_100293242 | |||
| 669 | Ga0070659_100480933 | |||
| 670 | Ga0070659_100700290 | |||
| 671 | Ga0070703_10003289 | |||
| 672 | Ga0070703_10015024 | |||
| 673 | Ga0070709_10046079 | |||
| 674 | Ga0070709_10109424 | |||
| 675 | Ga0070709_10159971 | |||
| 676 | Ga0070709_10190241 | |||
| 677 | Ga0070709_11037628 | |||
| 678 | Ga0070714_100029786 | |||
| 679 | Ga0070714_100101758 | |||
| 680 | Ga0070714_100177983 | |||
| 681 | Ga0070714_100541552 | |||
| 682 | Ga0070714_100686506 | |||
| 683 | Ga0070714_101408239 | |||
| 684 | Ga0070714_101433206 | |||
| 685 | Ga0070714_101521372 | |||
| 686 | Ga0070713_100036244 | |||
| 687 | Ga0070713_101623002 | |||
| 688 | Ga0070713_101912666 | |||
| 689 | Ga0070710_10031998 | |||
| 690 | Ga0070710_10403821 | |||
| 691 | Ga0070710_10564070 | |||
| 692 | Ga0070711_100502401 | |||
| 693 | Ga0070705_100017042 | |||
| 694 | Ga0070705_101231697 | |||
| 695 | Ga0070708_100010592 | |||
| 696 | Ga0070708_100220957 | |||
| 697 | Ga0070708_101221342 | |||
| 698 | Ga0070708_101438766 | |||
| 699 | Ga0070678_100098411 | |||
| 700 | Ga0070681_10064252 | |||
| 701 | Ga0070681_10081212 | |||
| 702 | Ga0070681_10120713 | |||
| 703 | Ga0070681_10910767 | |||
| 704 | Ga0070685_10411450 | |||
| 705 | Ga0070706_100000796 | |||
| 706 | Ga0070706_100084357 | |||
| 707 | Ga0070706_100368141 | |||
| 708 | Ga0070706_100462245 | |||
| 709 | Ga0070706_100788582 | |||
| 710 | Ga0070706_101682801 | |||
| 711 | Ga0070707_100053112 | |||
| 712 | Ga0070707_100083621 | |||
| 713 | Ga0070707_100394821 | |||
| 714 | Ga0070707_100534767 | |||
| 715 | Ga0070707_100682658 | |||
| 716 | Ga0070707_101359869 | |||
| 717 | Ga0070707_101412195 | |||
| 718 | Ga0070698_100324171 | |||
| 719 | Ga0070698_100541829 | |||
| 720 | Ga0070698_100949929 | |||
| 721 | Ga0070698_101417659 | |||
| 722 | Ga0070699_100091842 | |||
| 723 | Ga0070699_100258720 | |||
| 724 | Ga0070699_100367758 | |||
| 725 | Ga0070699_100390867 | |||
| 726 | Ga0070699_101051120 | |||
| 727 | Ga0070699_101511073 | |||
| 728 | Ga0070679_100008713 | |||
| 729 | Ga0070679_100815646 | |||
| 730 | Ga0070679_101314686 | |||
| 731 | Ga0070684_100265073 | |||
| 732 | Ga0070684_100396126 | |||
| 733 | Ga0070697_100059620 | |||
| 734 | Ga0070697_100060742 | |||
| 735 | Ga0070697_100560746 | |||
| 736 | Ga0070697_100758701 | |||
| 737 | Ga0070697_101017352 | |||
| 738 | Ga0070697_101572216 | |||
| 739 | Ga0070686_100402343 | |||
| 740 | Ga0070695_100000106 | |||
| 741 | Ga0070695_100241880 | |||
| 742 | Ga0070696_100037745 | |||
| 743 | Ga0070696_100225444 | |||
| 744 | Ga0070696_100990048 | |||
| 745 | Ga0070696_101111518 | |||
| 746 | Ga0070693_100023037 | |||
| 747 | Ga0070693_100048457 | |||
| 748 | Ga0070693_100976876 | |||
| 749 | Ga0070704_100138140 | |||
| 750 | Ga0070704_100470724 | |||
| 751 | Ga0070704_101768219 | |||
| 752 | Ga0068855_101907455 | |||
| 753 | Ga0070664_100221828 | |||
| 754 | Ga0070664_100626636 | |||
| 755 | Ga0068857_100116957 | |||
| 756 | Ga0068854_100371745 | |||
| 757 | Ga0068856_100367664 | |||
| 758 | Ga0068856_100561600 | |||
| 759 | Ga0068856_100739688 | |||
| 760 | Ga0070702_100018133 | |||
| 761 | Ga0068852_100097515 | |||
| 762 | Ga0068864_100801275 | |||
| 763 | Ga0068866_10917323 | |||
| 764 | Ga0068863_100400859 | |||
| 765 | Ga0068860_102348296 | |||
| 766 | Ga0081455_10632524 | |||
| 767 | Ga0070717_10044362 | |||
| 768 | Ga0070717_10373540 | |||
| 769 | Ga0070717_11244947 | |||
| 770 | Ga0070717_12134900 | |||
| 771 | Ga0070716_100374663 | |||
| 772 | Ga0070712_100171953 | |||
| 773 | Ga0070712_100183611 | |||
| 774 | Ga0070712_100584857 | |||
| 775 | Ga0070712_100931741 | |||
| 776 | Ga0097621_100170451 | |||
| 777 | Ga0068871_100499753 | |||
| 778 | Ga0075428_100178818 | |||
| 779 | Ga0075428_101975839 | |||
| 780 | Ga0075433_11088138 | |||
| 781 | Ga0075434_102007441 | |||
| 782 | Ga0099795_10132538 | |||
| 783 | Ga0105240_10014499 | |||
| 784 | Ga0105240_10038961 | |||
| 785 | Ga0105245_10104078 | |||
| 786 | Ga0105245_12655229 | |||
| 787 | Ga0105247_10021640 | |||
| 788 | Ga0114129_11068745 | |||
| 789 | Ga0105241_10626294 | |||
| 790 | Ga0105241_10878958 | |||
| 791 | Ga0105248_10139772 | |||
| 792 | Ga0105237_10015176 | |||
| 793 | Ga0105237_12357027 | |||
| 794 | Ga0105249_11206389 | |||
| 795 | Ga0105239_10904386 | |||
| 796 | Ga0105239_12066126 | |||
| 797 | Ga0105246_10921566 | |||
| 798 | Ga0157373_10059978 | |||
| 799 | Ga0157373_10595996 | |||
| 800 | Ga0157370_10077981 | |||
| 801 | Ga0157370_10214841 | |||
| 802 | Ga0157370_10360646 | |||
| 803 | Ga0157369_10185935 | |||
| 804 | Ga0157369_11457925 | |||
| 805 | Ga0157369_11911750 | |||
| 806 | Ga0157369_12163576 | |||
| 807 | Ga0157374_10728245 | |||
| 808 | Ga0157374_11704206 | |||
| 809 | Ga0157378_10344157 | |||
| 810 | Ga0157372_10020621 | |||
| 811 | Ga0157372_10807531 | |||
| 812 | Ga0157372_12898163 | |||
| 813 | Ga0157375_10125319 | |||
| 814 | Ga0157375_13794348 | |||
| 815 | Ga0163163_12158903 | |||
| 816 | Ga0157380_10127367 | |||
| 817 | Ga0182008_10149787 | |||
| 818 | Ga0182008_10262925 | |||
| 819 | Ga0182008_10564005 | |||
| 820 | Ga0157377_10808518 | |||
| 821 | Ga0182007_10218724 | |||
| 822 | Ga0206356_10777173 | |||
| 823 | Ga0206353_10062287 | |||
| 824 | Ga0206353_10614150 | |||
| 825 | Ga0206353_10964622 | |||
| 826 | Ga0213874_10379055 | |||
| 827 | Ga0213871_10192881 | |||
| 828 | Ga0207653_10002972 | |||
| 829 | Ga0207653_10003328 | |||
| 830 | Ga0207692_10745687 | |||
| 831 | Ga0207710_10025634 | |||
| 832 | Ga0207699_10071057 | |||
| 833 | Ga0207705_10020115 | |||
| 834 | Ga0207705_10441832 | |||
| 835 | Ga0207684_10000001 | |||
| 836 | Ga0207684_10346475 | |||
| 837 | Ga0207684_10883181 | |||
| 838 | Ga0207654_10516221 | |||
| 839 | Ga0207654_11187884 | |||
| 840 | Ga0207707_10096791 | |||
| 841 | Ga0207707_10139893 | |||
| 842 | Ga0207707_10318806 | |||
| 843 | Ga0207707_10717449 | |||
| 844 | Ga0207707_10997317 | |||
| 845 | Ga0207695_10308149 | |||
| 846 | Ga0207695_10410444 | |||
| 847 | Ga0207671_10328681 | |||
| 848 | Ga0207693_10070448 | |||
| 849 | Ga0207693_10698858 | |||
| 850 | Ga0207663_10056037 | |||
| 851 | Ga0207663_10284694 | |||
| 852 | Ga0207663_11241568 | |||
| 853 | Ga0207660_10142070 | |||
| 854 | Ga0207660_10390820 | |||
| 855 | Ga0207657_10014288 | |||
| 856 | Ga0207657_10014299 | |||
| 857 | Ga0207657_11095734 | |||
| 858 | Ga0207649_10149703 | |||
| 859 | Ga0207652_10298962 | |||
| 860 | Ga0207652_10537351 | |||
| 861 | Ga0207652_10904742 | |||
| 862 | Ga0207652_11320140 | |||
| 863 | Ga0207646_10023093 | |||
| 864 | Ga0207646_10122558 | |||
| 865 | Ga0207646_10584898 | |||
| 866 | Ga0207646_11004647 | |||
| 867 | Ga0207687_10092009 | |||
| 868 | Ga0207687_10382013 | |||
| 869 | Ga0207700_10096997 | |||
| 870 | Ga0207700_10495125 | |||
| 871 | Ga0207664_10054299 | |||
| 872 | Ga0207664_10127933 | |||
| 873 | Ga0207664_10133314 | |||
| 874 | Ga0207664_10193901 | |||
| 875 | Ga0207664_10310865 | |||
| 876 | Ga0207664_10347829 | |||
| 877 | Ga0207664_10502498 | |||
| 878 | Ga0207664_10920759 | |||
| 879 | Ga0207664_11348038 | |||
| 880 | Ga0207664_11370577 | |||
| 881 | Ga0207664_11466435 | |||
| 882 | Ga0207644_11737862 | |||
| 883 | Ga0207690_11571618 | |||
| 884 | Ga0207706_11376466 | |||
| 885 | Ga0207709_10329987 | |||
| 886 | Ga0207709_10487864 | |||
| 887 | Ga0207670_11217593 | |||
| 888 | Ga0207704_11883252 | |||
| 889 | Ga0207665_10009738 | |||
| 890 | Ga0207665_10247061 | |||
| 891 | Ga0207665_11170224 | |||
| 892 | Ga0207711_11121591 | |||
| 893 | Ga0207711_11616837 | |||
| 894 | Ga0207661_12028071 | |||
| 895 | Ga0207679_12044567 | |||
| 896 | Ga0207667_10028283 | |||
| 897 | Ga0207667_10200842 | |||
| 898 | Ga0207667_12160038 | |||
| 899 | Ga0207712_10491888 | |||
| 900 | Ga0207640_10478505 | |||
| 901 | Ga0207677_11523081 | |||
| 902 | Ga0207708_10254894 | |||
| 903 | Ga0207702_10181015 | |||
| 904 | Ga0207702_10633802 | |||
| 905 | Ga0207702_11441860 | |||
| 906 | Ga0207641_10801055 | |||
| 907 | Ga0207674_10099691 | |||
| 908 | Ga0207675_100673310 | |||
| 909 | Ga0207683_10008480 | |||
| 910 | Ga0207683_10057000 | |||
| 911 | Ga0207698_11424200 | |||
| 912 | Ga0268264_12300899 | |||
| 913 | Ga0265319_1053267 | |||
| 914 | Ga0265336_10011346 | |||
| 915 | Ga0265338_10002456 | |||
| 916 | Ga0307408_100897858 | |||
| 917 | Ga0307413_10083893 | |||
| 918 | Ga0307409_100371533 | |||
| 919 | Ga0307415_100398362 | |||
| 920 | Ga0373930_0059219 | |||
| 921 | Ga0373948_0001619 | |||
| 922 | Ga0373959_0008523 | |||
| 923 | Ga0373926_0381898 | |||
| 924 | Ga0373928_0001325 | |||
| 925 | Ga0373929_0003994 | |||
| 926 | Ga0373940_0005886 | |||
| 927 | Ga0373944_0253943 | |||
| 928 | Ga0373949_0005034 | |||
| 929 | Ga0373923_0451465 | |||
| 930 | Ga0373932_0003085 | |||
| 931 | Ga0373936_0045181 | |||
| 932 | Ga0373939_0043725 | |||
| 933 | Ga0373941_0004496 | |||
| 934 | Ga0373953_0026702 | |||
| 935 | Ga0373954_0238184 | |||
| 936 | Ga0373957_0093482 | |||
| 937 | Ga0373943_0069446 | |||
| 938 | Ga0373943_0856389 | |||
| 939 | Ga0373942_0052689 | |||
| 940 | Ga0373961_0005508 | |||
| 941 | Ga0373962_0010318 | |||
| 942 | Ga0373931_0138239 | |||
| 943 | Ga0373935_0256378 | |||
| 944 | Ga0373935_0494776 | |||
| 945 | Ga0373947_0059627 | |||
| 946 | Ga0373947_0416899 | |||
| 947 | Ga0373937_0156923 | |||
| 948 | Ga0373925_0115353 | |||
| 949 | Ga0373925_0872865 | |||
| 950 | Ga0373925_1204967 | |||
| 951 | Ga0395899_0205010 | |||
| 952 | Ga0395899_0790009 | |||
| 953 | Ga0395899_0891796 | |||
| 954 | Ga0395900_0166078 | |||
| 955 | Ga0395900_0228158 | |||
| 956 | Ga0395900_0475501 | |||
| 957 | Ga0395900_0592842 | |||
| 958 | Ga0395900_0789135 | |||
| 959 | Ga0395900_1737383 | |||
| 960 | Ga0395898_0113838 | |||
| 961 | Ga0395898_0183211 | |||
| 962 | Ga0395905_0141173 | |||
| 963 | Ga0395905_1248302 | |||
| 964 | Ga0395901_0023454 | |||
| 965 | Ga0395901_0266052 | |||
| 966 | Ga0395901_0267907 | |||
| 967 | Ga0395901_0324884 | |||
| 968 | Ga0395901_0329378 | |||
| 969 | Ga0395901_0879826 | |||
| 970 | Ga0395901_1765823 | |||
| 971 | Ga0436360_0629357 | |||
| 972 | Ga0436360_0678051 | |||
| 973 | Ga0439448_0113945 | |||
| 974 | Ga0450894_056013 | |||
| 975 | Ga0466969_0097733 | |||
| 976 | Ga0466969_0344921 | |||
| 977 | Ga0466972_0013276 | |||
| 978 | Ga0466972_0554787 | |||
| 979 | Ga0466972_0607633 | |||
| 980 | Ga0466965_0051295 | |||
| 981 | Ga0466965_0051931 | |||
| 982 | Ga0466966_0028926 | |||
| 983 | Ga0466966_0196266 | |||
| 984 | Ga0466966_0512998 | |||
| 985 | Ga0466961_0020742 | |||
| 986 | Ga0466961_0179183 | |||
| 987 | Ga0466961_0330833 | |||
| 988 | Ga0466961_0421754 | |||
| 989 | Ga0466961_0634350 | |||
| 990 | Ga0466963_0002006 | |||
| 991 | Ga0466963_0006982 | |||
| 992 | Ga0466963_0007277 | |||
| 993 | Ga0466963_0008804 | |||
| 994 | Ga0466963_0011955 | |||
| 995 | Ga0466963_0094068 | |||
| 996 | Ga0466963_0113070 | |||
| 997 | Ga0466963_0255395 | |||
| 998 | Ga0466963_0458933 | |||
| 999 | Ga0466963_0558805 | |||
| 1000 | Ga0466963_0634682 | |||
| 1001 | Ga0466964_0032653 | |||
| 1002 | Ga0466964_0061360 | |||
| 1003 | Ga0466964_0077350 | |||
| 1004 | Ga0466964_0089304 | |||
| 1005 | Ga0466964_0123086 | |||
| 1006 | Ga0466964_0744125 | |||
| 1007 | Ga0466971_0002599 | |||
| 1008 | Ga0466971_0068966 | |||
| 1009 | Ga0466971_0317019 | |||
| 1010 | Ga0466971_0444744 | |||
| 1011 | Ga0466968_0002483 | |||
| 1012 | Ga0466968_0014727 | |||
| 1013 | Ga0466968_0063672 | |||
| 1014 | Ga0466968_0067270 | |||
| 1015 | Ga0466968_0072913 | |||
| 1016 | Ga0466968_0076304 | |||
| 1017 | Ga0466968_0081656 | |||
| 1018 | Ga0466968_0408039 | |||
| 1019 | Ga0466968_0429655 | |||
| 1020 | Ga0466968_0664818 | |||
| 1021 | Ga0466970_0025902 | |||
| 1022 | Ga0466970_0047963 | |||
| 1023 | Ga0466957_0029706 | |||
| 1024 | Ga0466957_0040186 | |||
| 1025 | Ga0466957_0451240 | |||
| 1026 | Ga0466957_0613514 | |||
| 1027 | Ga0466957_0641831 | |||
| 1028 | Ga0466957_0724830 | |||
| 1029 | Ga0466957_1168658 | |||
| 1030 | Ga0466957_1332076 | |||
| 1031 | Ga0466960_0004236 | |||
| 1032 | Ga0466960_0051154 | |||
| 1033 | Ga0466960_0095368 | |||
| 1034 | Ga0466960_0568622 | |||
| 1035 | Ga0466959_0029483 | |||
| 1036 | Ga0466959_0048382 | |||
| 1037 | Ga0466959_0147414 | |||
| 1038 | Ga0466959_0154507 | |||
| 1039 | Ga0466959_0243776 | |||
| 1040 | Ga0466959_0294047 | |||
| 1041 | Ga0466959_0669012 | |||
| 1042 | Ga0451576_0093071 | |||
| 1043 | Ga0466958_0012762 | |||
| 1044 | Ga0466958_0024033 | |||
| 1045 | Ga0466958_0027320 | |||
| 1046 | Ga0466958_0043921 | |||
| 1047 | Ga0466958_0047860 | |||
| 1048 | Ga0466958_0119821 | |||
| 1049 | Ga0466958_0142788 | |||
| 1050 | Ga0466958_0148972 | |||
| 1051 | Ga0466958_0161738 | |||
| 1052 | Ga0466958_0251268 | |||
| 1053 | Ga0466958_0261753 | |||
| 1054 | Ga0466958_0412654 | |||
| 1055 | Ga0466967_0001698 | |||
| 1056 | Ga0466967_0018440 | |||
| 1057 | Ga0466967_0019123 | |||
| 1058 | Ga0466967_0031130 | |||
| 1059 | Ga0466967_0041815 | |||
| 1060 | Ga0466967_0097345 | |||
| 1061 | Ga0466967_0141072 | |||
| 1062 | Ga0466967_0148818 | |||
| 1063 | Ga0466967_0188795 | |||
| 1064 | Ga0466967_0195643 | |||
| 1065 | Ga0466967_0217653 | |||
| 1066 | Ga0466967_0313145 | |||
| 1067 | Ga0466967_0688965 | |||
| 1068 | Ga0466967_0822397 | |||
| 1069 | Ga0466967_0962500 | |||
| 1070 | Ga0466967_1471299 | |||
| 1071 | Ga0495592_0000123 | |||
| 1072 | Ga0495592_0030159 | |||
| 1073 | Ga0495603_0062804 | |||
| 1074 | Ga0495603_0213450 | |||
| 1075 | Ga0495629_0163855 | |||
| 1076 | Ga0495629_0553006 | |||
| 1077 | Ga0495641_0025275 | |||
| 1078 | Ga0495641_0054906 | |||
| 1079 | Ga0495641_0104518 | |||
| 1080 | Ga0495641_0169586 | |||
| 1081 | Ga0495651_0000029 | |||
| 1082 | Ga0495651_0269333 | |||
| 1083 | Ga0495653_0003956 | |||
| 1084 | Ga0495653_0285556 | |||
| 1085 | Ga0495653_0391144 | |||
| 1086 | Ga0495653_0639204 | |||
| 1087 | Ga0495582_0325256 | |||
| 1088 | Ga0495582_0550406 | |||
| 1089 | Ga0495582_0841344 | |||
| 1090 | Ga0495662_0174180 | |||
| 1091 | Ga0495664_0150144 | |||
| 1092 | Ga0495664_0206421 | |||
| 1093 | Ga0495585_0129035 | |||
| 1094 | Ga0495594_0332210 | |||
| 1095 | Ga0495596_0178517 | |||
| 1096 | Ga0495596_0198907 | |||
| 1097 | Ga0495607_0048477 | |||
| 1098 | Ga0495608_0002826 | |||
| 1099 | Ga0495608_0088963 | |||
| 1100 | Ga0495608_0798019 | |||
| 1101 | Ga0495618_0009350 | |||
| 1102 | Ga0495618_0318772 | |||
| 1103 | Ga0495628_0000016 | |||
| 1104 | Ga0495628_0075327 | |||
| 1105 | Ga0495630_0291733 | |||
| 1106 | Ga0495630_0302376 | |||
| 1107 | Ga0495630_1378976 | |||
| 1108 | Ga0495631_0169942 | |||
| 1109 | Ga0495644_0015725 | |||
| 1110 | Ga0495652_0000045 | |||
| 1111 | Ga0495652_0443943 | |||
| 1112 | Ga0495640_0004109 | |||
| 1113 | Ga0495640_0088988 | |||
| 1114 | Ga0495586_0021655 | |||
| 1115 | Ga0495587_0000083 | |||
| 1116 | Ga0495598_0411337 | |||
| 1117 | Ga0495645_0000306 | |||
| 1118 | Ga0495645_0047894 | |||
| 1119 | Ga0495667_0039034 | |||
| 1120 | Ga0495667_0052463 | |||
| 1121 | Ga0495667_0466033 | |||
| 1122 | Ga0495656_0002640 | |||
| 1123 | Ga0495634_0030109 | |||
| 1124 | Ga0495634_0211922 | |||
| 1125 | Ga0495634_0418727 | |||
| 1126 | Ga0495611_0090010 | |||
| 1127 | Ga0495635_0963937 | |||
| 1128 | Ga0495659_0017587 | |||
| 1129 | Ga0495659_0214380 | |||
| 1130 | Ga0495657_0002001 | |||
| 1131 | Ga0495657_0044790 | |||
| 1132 | Ga0495657_0179398 | |||
| 1133 | Ga0495657_0401794 | |||
| 1134 | Ga0495599_0000219 | |||
| 1135 | Ga0495599_0055035 | |||
| 1136 | Ga0495623_0000429 | |||
| 1137 | Ga0495623_0715116 | |||
| 1138 | Ga0495646_0017542 | |||
| 1139 | Ga0495647_0214101 | |||
| 1140 | Ga0495658_0288680 | |||
| 1141 | Ga0495658_0717597 | |||
| 1142 | Ga0495613_0002918 | |||
| 1143 | Ga0495613_0381572 | |||
| 1144 | Ga0495613_0557969 | |||
| 1145 | Ga0495624_0110472 | |||
| 1146 | Ga0495624_0114314 | |||
| 1147 | Ga0495649_0642241 | |||
| 1148 | Ga0495600_0071773 | |||
| 1149 | Ga0495600_0120139 | |||
| 1150 | Ga0495600_0586256 | |||
| 1151 | Ga0495581_0074306 | |||
| 1152 | Ga0495581_0167220 | |||
| 1153 | Ga0495604_0000072 | |||
| 1154 | Ga0495604_0068411 | |||
| 1155 | Ga0495636_0053620 | |||
| 1156 | Ga0495674_0045450 | |||
| 1157 | Ga0495674_0060387 | |||
| 1158 | Ga0495674_0189677 | |||
| 1159 | Ga0495676_0162915 | |||
| 1160 | Ga0495676_0205444 | |||
| 1161 | Ga0495676_0923640 | |||
| 1162 | Ga0495676_1003194 | |||
| 1163 | Ga0495680_0003161 | |||
| 1164 | Ga0495680_0205289 | |||
| 1165 | Ga0495675_0000031 | |||
| 1166 | Ga0495675_0077260 | |||
| 1167 | Ga0495677_0045927 | |||
| 1168 | Ga0495673_0242545 | |||
| 1169 | Ga0495684_0005222 | |||
| 1170 | Ga0495684_1075699 | |||
| 1171 | Ga0495602_0000133 | |||
| 1172 | Ga0495614_0135856 | |||
| 1173 | Ga0496100_0185217 | |||
| 1174 | Ga0496100_0981271 | |||
| 1175 | Ga0496100_1220986 | |||
| 1176 | Ga0496101_0028111 | |||
| 1177 | Ga0496101_0188124 | |||
| 1178 | Ga0496101_1302256 | |||
| 1179 | Ga0496102_0028751 | |||
| 1180 | Ga0496102_0031068 | |||
| 1181 | Ga0496102_0051569 | |||
| 1182 | Ga0496102_0226769 | |||
| 1183 | Ga0496102_0677213 | |||
| 1184 | Ga0496102_1389417 | |||
| 1185 | Ga0496102_1500271 | |||
| 1186 | Ga0496103_0005252 | |||
| 1187 | Ga0496103_0005964 | |||
| 1188 | Ga0496103_0042219 | |||
| 1189 | Ga0496104_0006253 | |||
| 1190 | Ga0496104_0268810 | |||
| 1191 | Ga0496104_0878823 | |||
| 1192 | Ga0496104_1172406 | |||
| 1193 | Ga0496104_1738187 | |||
| 1194 | Ga0496105_0035035 | |||
| 1195 | Ga0496105_0124219 | |||
| 1196 | Ga0496105_0201937 | |||
| 1197 | Ga0496105_0712398 | |||
| 1198 | Ga0496106_0224750 | |||
| 1199 | Ga0496106_0336160 | |||
| 1200 | Ga0496107_0050169 | |||
| 1201 | Ga0496107_0197410 | |||
| 1202 | Ga0496108_0018399 | |||
| 1203 | Ga0496108_0033295 | |||
| 1204 | Ga0496108_0146135 | |||
| 1205 | Ga0496108_0282306 | |||
| 1206 | Ga0496108_1314279 | |||
| 1207 | Ga0496109_0020592 | |||
| 1208 | Ga0496109_0277769 | |||
| 1209 | Ga0496109_0398534 | |||
| 1210 | Ga0496109_0447967 | |||
| 1211 | Ga0496109_0633978 | |||
| 1212 | Ga0496110_0102065 | |||
| 1213 | Ga0496110_0233940 | |||
| 1214 | Ga0496111_0033331 | |||
| 1215 | Ga0496111_0033863 | |||
| 1216 | Ga0496111_0063311 | |||
| 1217 | Ga0496112_0022196 | |||
| 1218 | Ga0496112_0099498 | |||
| 1219 | Ga0496112_0196321 | |||
| 1220 | Ga0496112_0214900 | |||
| 1221 | Ga0496112_1096133 | |||
| 1222 | Ga0496113_0082165 | |||
| 1223 | Ga0496113_0098110 | |||
| 1224 | Ga0496113_0218826 | |||
| 1225 | Ga0496113_0253050 | |||
| 1226 | Ga0496113_0458241 | |||
| 1227 | Ga0496113_0710081 | |||
| 1228 | Ga0496114_0083140 | |||
| 1229 | Ga0496114_0094393 | |||
| 1230 | Ga0496114_0515985 | |||
| 1231 | Ga0496115_0060441 | |||
| 1232 | Ga0496115_0074222 | |||
| 1233 | Ga0496115_0813106 | |||
| 1234 | Ga0501031_0004754 | |||
| 1235 | Ga0501032_0287055 | |||
| 1236 | Ga0501036_0046060 | |||
| 1237 | Ga0501037_0467186 | |||
| 1238 | Ga0501038_0061306 | |||
| 1239 | Ga0501039_0007399 | |||
| 1240 | Ga0501039_0316644 | |||
| 1241 | Ga0501040_0011540 | |||
| 1242 | Ga0501040_0302114 | |||
| 1243 | Ga0501041_0000831 | |||
| 1244 | Ga0501042_0000539 | |||
| 1245 | Ga0501043_0054289 | |||
| 1246 | Ga0501046_0001759 | |||
| 1247 | Ga0501046_0441601 | |||
| 1248 | Ga0501048_0057279 | |||
| 1249 | Ga0501067_0015125 | |||
| 1250 | Ga0501067_0029377 | |||
| 1251 | Ga0501068_0009363 | |||
| 1252 | Ga0501068_0184377 | |||
| 1253 | Ga0501069_0023595 | |||
| 1254 | Ga0501070_0345084 | |||
| 1255 | Ga0501071_0020772 | |||
| 1256 | Ga0501072_0008040 | |||
| 1257 | Ga0501072_0701543 | |||
| 1258 | Ga0501073_0026944 | |||
| 1259 | Ga0501074_0002779 | |||
| 1260 | Ga0501075_0000468 | |||
| 1261 | Ga0501076_0004870 | |||
| 1262 | Ga0501077_0035080 | |||
| 1263 | Ga0501079_0004598 | |||
| 1264 | Ga0501079_0435867 | |||
| 1265 | Ga0501080_0093538 | |||
| 1266 | Ga0501081_0003165 | |||
| 1267 | Ga0501081_0825000 | |||
| 1268 | Ga0501083_0094187 | |||
| 1269 | Ga0501035_0013695 | |||
| 1270 | Ga0501045_0001327 | |||
| 1271 | nmdc:mga03683_169982_c1 | |||
| 1272 | nmdc:mga00v17_535052_c1 | |||
| 1273 | nmdc:mga08x19_425082_c1 | |||
| 1274 | Ga0495601_0000626 | |||
| 1275 | Ga0495601_0009387 | |||
| 1276 | Ga0495601_0577305 | |||
| 1277 | Ga0495612_0103599 | |||
| 1278 | Ga0495655_0102925 | |||
| 1279 | Ga0495595_0068824 | |||
| 1280 | Ga0495595_0368329 | |||
| 1281 | Ga0495595_0639443 | |||
| 1282 | Ga0495619_0005077 | |||
| 1283 | Ga0495619_0052173 | |||
| 1284 | Ga0495619_0058992 | |||
| 1285 | Ga0501084_0003996 | |||
| 1286 | Ga0501084_1077032 | |||
| 1287 | Ga0587073_0211367 | |||
| 1288 | Ga0501082_0002382 | |||
| 1289 | Ga0501082_1472840 | |||
| 1290 | Ga0466962_0003932 | |||
| 1291 | Ga0466962_0152342 | |||
| 1292 | Ga0466962_0348275 | |||
| 1293 | Ga0466962_0551878 | |||
| 1294 | Ga0466962_0656597 | |||
| 1295 | Ga0530510_0057010 | |||
| 1296 | Ga0530510_0318979 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oqq-assembly1.cif.gz_B | legionella pneumophila sidj/saccharomyces cerevisiae calmodulin complex | 0.6072 | 22 | 63 |
| 7qoo-assembly1.cif.gz_W | structure of the human inner kinetochore ccan complex | 0.5001 | 6 | 61 |
| 1mnm-assembly1.cif.gz_C | yeast matalpha2/mcm1/dna ternary transcription complex crystal structure | 0.4886 | 15 | 62 |
| 7czl-assembly1.cif.gz_N | structural insights into a dimeric psb27-photosystem ii complex from a cyanobacterium thermosynechococcus vulcanus | 0.4801 | 7 | 61 |
| 4ne1-assembly1.cif.gz_W | human mhf1 mhf2 dna complexes | 0.4727 | 7 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9W4B1_214_299_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.7313 | 23 | 60 | 1.10.238.10 |
| af_Q9BXY5_429_514_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.6985 | 25 | 64 | 1.10.238.10 |
| af_Q9SYG2_94_158_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.6911 | 23 | 61 | 1.10.10.60 |
| af_Q6KAQ7_662_715_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.6766 | 23 | 62 | 1.10.10.60 |
| af_Q9VM59_135_186_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.6324 | 23 | 63 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838KFP3-F1-model_v4 | Uncharacterized protein | 0.9813 | 27 | 69 |
|
| AF-A0A4S3JQG9-F1-model_v4 | LexA repressor DNA-binding domain-containing protein | 0.9502 | 23 | 67 |
GO:0018836
|
| AF-A0A838KFP3-F1-model_v4 | Uncharacterized protein | 0.9192 | 27 | 69 |
|
| AF-A0A2V8EP18-F1-model_v4 | Alkylmercury lyase | 0.9027 | 27 | 68 |
GO:0016829
|
| AF-A0A7V9B7Y4-F1-model_v4 | Uncharacterized protein | 0.8874 | 23 | 68 |
|