F472350

General Info

Members Datasets Scaffolds Average Seq Length
648 293 1296 69

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_101318383|Ga0070660_1013183832
Length 72
Sequence MNLFRSEEHVARWLDANGYQPGATLSMEGMGALAVAWWSDRLAPDWRPHTREQNAAILERLGLVGAFWTLPS

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 9.41
Rhizosphere 90.12
Stem 0
Stem Tuber 0
Unclassified 21.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_101318383 3300005339 Unclassified 613
2 Ga0070658_10812224 3300005327 Unclassified 812
3 Ga0070683_100272657 3300005329 Bacteria 1609
4 Ga0070690_100093749 3300005330 Unclassified 1981
5 Ga0068869_102159589 3300005334 Bacteria 501
6 Ga0070680_100884470 3300005336 Unclassified 770
7 Ga0070682_100102678 3300005337 Unclassified 1890
8 Ga0070682_100786418 3300005337 Unclassified 772
9 Ga0070660_100007052 3300005339 Bacteria 7807
10 Ga0070660_100030204 3300005339 Bacteria 4064
11 Ga0070660_100074625 3300005339 Bacteria 2654
12 Ga0070660_101491972 3300005339 Unclassified 575
13 Ga0070689_102097380 3300005340 Unclassified 518
14 Ga0070661_100254170 3300005344 Bacteria 1357
15 Ga0070661_100348273 3300005344 Bacteria 1162
16 Ga0070661_101360071 3300005344 Bacteria 597
17 Ga0070692_10704722 3300005345 Bacteria 680
18 Ga0070692_10827058 3300005345 Unclassified 634
19 Ga0070671_100499441 3300005355 Bacteria 1046
20 Ga0070674_100293242 3300005356 Bacteria 1294
21 Ga0070659_100480933 3300005366 Bacteria 1057
22 Ga0070659_100700290 3300005366 Bacteria 876
23 Ga0070703_10003289 3300005406 Unclassified 4607
24 Ga0070703_10015024 3300005406 Bacteria 2212
25 Ga0070709_10046079 3300005434 Bacteria 2709
26 Ga0070709_10109424 3300005434 Bacteria 1855
27 Ga0070709_10159971 3300005434 Unclassified 1565
28 Ga0070709_10190241 3300005434 Bacteria 1447
29 Ga0070709_11037628 3300005434 Unclassified 653
30 Ga0070714_100029786 3300005435 Bacteria 4540
31 Ga0070714_100101758 3300005435 Bacteria 2532
32 Ga0070714_100177983 3300005435 Bacteria 1934
33 Ga0070714_100541552 3300005435 Unclassified 1113
34 Ga0070714_100686506 3300005435 Bacteria 987
35 Ga0070714_101408239 3300005435 Bacteria 681
36 Ga0070714_101433206 3300005435 Bacteria 674
37 Ga0070714_101521372 3300005435 Unclassified 654
38 Ga0070713_100036244 3300005436 Bacteria 3979
39 Ga0070713_101623002 3300005436 Bacteria 628
40 Ga0070713_101912666 3300005436 Bacteria 575
41 Ga0070710_10031998 3300005437 Bacteria 2845
42 Ga0070710_10403821 3300005437 Unclassified 916
43 Ga0070710_10564070 3300005437 Bacteria 788
44 Ga0070711_100502401 3300005439 Bacteria 1000
45 Ga0070705_100017042 3300005440 Bacteria 3784
46 Ga0070705_101231697 3300005440 Bacteria 618
47 Ga0070708_100010592 3300005445 Bacteria 7477
48 Ga0070708_100220957 3300005445 Bacteria 1777
49 Ga0070708_101221342 3300005445 Bacteria 703
50 Ga0070708_101438766 3300005445 Bacteria 643
51 Ga0070678_100098411 3300005456 Bacteria 2261
52 Ga0070681_10064252 3300005458 Bacteria 3641
53 Ga0070681_10081212 3300005458 Bacteria 3198
54 Ga0070681_10120713 3300005458 Unclassified 2556
55 Ga0070681_10910767 3300005458 Unclassified 798
56 Ga0070685_10411450 3300005466 Bacteria 939
57 Ga0070706_100000796 3300005467 Bacteria 35230
58 Ga0070706_100084357 3300005467 Bacteria 2943
59 Ga0070706_100368141 3300005467 Unclassified 1339
60 Ga0070706_100462245 3300005467 Bacteria 1181
61 Ga0070706_100788582 3300005467 Bacteria 880
62 Ga0070706_101682801 3300005467 Bacteria 578
63 Ga0070707_100053112 3300005468 Bacteria 3884
64 Ga0070707_100083621 3300005468 Unclassified 3084
65 Ga0070707_100394821 3300005468 Bacteria 1343
66 Ga0070707_100534767 3300005468 Unclassified 1134
67 Ga0070707_100682658 3300005468 Unclassified 990
68 Ga0070707_101359869 3300005468 Bacteria 677
69 Ga0070707_101412195 3300005468 Bacteria 663
70 Ga0070698_100324171 3300005471 Unclassified 1471
71 Ga0070698_100541829 3300005471 Unclassified 1103
72 Ga0070698_100949929 3300005471 Unclassified 806
73 Ga0070698_101417659 3300005471 Bacteria 646
74 Ga0070699_100091842 3300005518 Bacteria 2655
75 Ga0070699_100258720 3300005518 Unclassified 1556
76 Ga0070699_100367758 3300005518 Bacteria 1297
77 Ga0070699_100390867 3300005518 Unclassified 1257
78 Ga0070699_101051120 3300005518 Bacteria 747
79 Ga0070699_101511073 3300005518 Bacteria 616
80 Ga0070679_100008713 3300005530 Bacteria 9562
81 Ga0070679_100815646 3300005530 Unclassified 876
82 Ga0070679_101314686 3300005530 Bacteria 669
83 Ga0070684_100265073 3300005535 Bacteria 1572
84 Ga0070684_100396126 3300005535 Bacteria 1273
85 Ga0070697_100059620 3300005536 Bacteria 3109
86 Ga0070697_100060742 3300005536 Bacteria 3081
87 Ga0070697_100560746 3300005536 Bacteria 1002
88 Ga0070697_100758701 3300005536 Unclassified 857
89 Ga0070697_101017352 3300005536 Bacteria 737
90 Ga0070697_101572216 3300005536 Bacteria 588
91 Ga0070686_100402343 3300005544 Unclassified 1041
92 Ga0070695_100000106 3300005545 Bacteria 36745
93 Ga0070695_100241880 3300005545 Bacteria 1310
94 Ga0070696_100037745 3300005546 Bacteria 3332
95 Ga0070696_100225444 3300005546 Bacteria 1408
96 Ga0070696_100990048 3300005546 Bacteria 702
97 Ga0070696_101111518 3300005546 Bacteria 665
98 Ga0070693_100023037 3300005547 Bacteria 3322
99 Ga0070693_100048457 3300005547 Bacteria 2420
100 Ga0070693_100976876 3300005547 Bacteria 639
101 Ga0070704_100138140 3300005549 Bacteria 1899
102 Ga0070704_100470724 3300005549 Unclassified 1085
103 Ga0070704_101768219 3300005549 Bacteria 572
104 Ga0068855_101907455 3300005563 Unclassified 602
105 Ga0070664_100221828 3300005564 Bacteria 1692
106 Ga0070664_100626636 3300005564 Bacteria 999
107 Ga0068857_100116957 3300005577 Bacteria 2399
108 Ga0068854_100371745 3300005578 Bacteria 1176
109 Ga0068856_100367664 3300005614 Bacteria 1457
110 Ga0068856_100561600 3300005614 Bacteria 1163
111 Ga0068856_100739688 3300005614 Bacteria 1003
112 Ga0070702_100018133 3300005615 Bacteria 3645
113 Ga0068852_100097515 3300005616 Bacteria 2645
114 Ga0068864_100801275 3300005618 Bacteria 926
115 Ga0068866_10917323 3300005718 Bacteria 617
116 Ga0068863_100400859 3300005841 Bacteria 1342
117 Ga0068860_102348296 3300005843 Unclassified 554
118 Ga0081455_10632524 3300005937 Bacteria 692
119 Ga0070717_10044362 3300006028 Bacteria 3630
120 Ga0070717_10373540 3300006028 Bacteria 1278
121 Ga0070717_11244947 3300006028 Unclassified 677
122 Ga0070717_12134900 3300006028 Unclassified 504
123 Ga0070716_100374663 3300006173 Bacteria 1015
124 Ga0070712_100171953 3300006175 Unclassified 1682
125 Ga0070712_100183611 3300006175 Bacteria 1632
126 Ga0070712_100584857 3300006175 Bacteria 944
127 Ga0070712_100931741 3300006175 Bacteria 750
128 Ga0097621_100170451 3300006237 Bacteria 1876
129 Ga0068871_100499753 3300006358 Bacteria 1096
130 Ga0075428_100178818 3300006844 Bacteria 2297
131 Ga0075428_101975839 3300006844 Bacteria 605
132 Ga0075433_11088138 3300006852 Unclassified 695
133 Ga0075434_102007441 3300006871 Unclassified 584
134 Ga0099795_10132538 3300007788 Bacteria 1007
135 Ga0105240_10014499 3300009093 Bacteria 10761
136 Ga0105240_10038961 3300009093 Bacteria 6092
137 Ga0105245_10104078 3300009098 Bacteria 2631
138 Ga0105245_12655229 3300009098 Bacteria 554
139 Ga0105247_10021640 3300009101 Bacteria 3870
140 Ga0114129_11068745 3300009147 Bacteria 1012
141 Ga0105241_10626294 3300009174 Bacteria 975
142 Ga0105241_10878958 3300009174 Unclassified 831
143 Ga0105248_10139772 3300009177 Bacteria 2732
144 Ga0105237_10015176 3300009545 Bacteria 8027
145 Ga0105237_12357027 3300009545 Bacteria 542
146 Ga0105249_11206389 3300009553 Bacteria 828
147 Ga0105239_10904386 3300010375 Unclassified 1013
148 Ga0105239_12066126 3300010375 Unclassified 662
149 Ga0105246_10921566 3300011119 Bacteria 785
150 Ga0157373_10059978 3300013100 Bacteria 2695
151 Ga0157373_10595996 3300013100 Bacteria 804
152 Ga0157370_10077981 3300013104 Bacteria 3120
153 Ga0157370_10214841 3300013104 Bacteria 1782
154 Ga0157370_10360646 3300013104 Bacteria 1339
155 Ga0157369_10185935 3300013105 Bacteria 2185
156 Ga0157369_11457925 3300013105 Bacteria 696
157 Ga0157369_11911750 3300013105 Unclassified 602
158 Ga0157369_12163576 3300013105 Bacteria 564
159 Ga0157374_10728245 3300013296 Bacteria 1006
160 Ga0157374_11704206 3300013296 Bacteria 655
161 Ga0157378_10344157 3300013297 Bacteria 1455
162 Ga0157372_10020621 3300013307 Bacteria 7113
163 Ga0157372_10807531 3300013307 Bacteria 1090
164 Ga0157372_12898163 3300013307 Unclassified 549
165 Ga0157375_10125319 3300013308 Bacteria 2683
166 Ga0157375_13794348 3300013308 Bacteria 502
167 Ga0163163_12158903 3300014325 Bacteria 616
168 Ga0157380_10127367 3300014326 Bacteria 2166
169 Ga0182008_10149787 3300014497 Unclassified 1170
170 Ga0182008_10262925 3300014497 Bacteria 893
171 Ga0182008_10564005 3300014497 Bacteria 634
172 Ga0157377_10808518 3300014745 Unclassified 692
173 Ga0182007_10218724 3300015262 Bacteria 672
174 Ga0206356_10777173 3300020070 Bacteria 2426
175 Ga0206353_10062287 3300020082 Bacteria 670
176 Ga0206353_10614150 3300020082 Bacteria 1485
177 Ga0206353_10964622 3300020082 Bacteria 1195
178 Ga0213874_10379055 3300021377 Unclassified 547
179 Ga0213871_10192881 3300021441 Unclassified 633
180 Ga0207653_10002972 3300025885 Bacteria 5379
181 Ga0207653_10003328 3300025885 Bacteria 5076
182 Ga0207692_10745687 3300025898 Unclassified 638
183 Ga0207710_10025634 3300025900 Bacteria 2545
184 Ga0207699_10071057 3300025906 Bacteria 2127
185 Ga0207705_10020115 3300025909 Bacteria 4774
186 Ga0207705_10441832 3300025909 Unclassified 1008
187 Ga0207684_10000001 3300025910 Bacteria 1115726
188 Ga0207684_10346475 3300025910 Bacteria 1279
189 Ga0207684_10883181 3300025910 Bacteria 752
190 Ga0207654_10516221 3300025911 Bacteria 845
191 Ga0207654_11187884 3300025911 Unclassified 556
192 Ga0207707_10096791 3300025912 Unclassified 2579
193 Ga0207707_10139893 3300025912 Bacteria 2117
194 Ga0207707_10318806 3300025912 Bacteria 1342
195 Ga0207707_10717449 3300025912 Bacteria 838
196 Ga0207707_10997317 3300025912 Unclassified 687
197 Ga0207695_10308149 3300025913 Unclassified 1474
198 Ga0207695_10410444 3300025913 Bacteria 1239
199 Ga0207671_10328681 3300025914 Bacteria 1211
200 Ga0207693_10070448 3300025915 Bacteria 2736
201 Ga0207693_10698858 3300025915 Unclassified 785
202 Ga0207663_10056037 3300025916 Bacteria 2476
203 Ga0207663_10284694 3300025916 Bacteria 1229
204 Ga0207663_11241568 3300025916 Unclassified 600
205 Ga0207660_10142070 3300025917 Bacteria 1836
206 Ga0207660_10390820 3300025917 Unclassified 1119
207 Ga0207657_10014288 3300025919 Bacteria 7759
208 Ga0207657_10014299 3300025919 Bacteria 7753
209 Ga0207657_11095734 3300025919 Unclassified 609
210 Ga0207649_10149703 3300025920 Bacteria 1606
211 Ga0207652_10298962 3300025921 Bacteria 1453
212 Ga0207652_10537351 3300025921 Unclassified 1051
213 Ga0207652_10904742 3300025921 Unclassified 779
214 Ga0207652_11320140 3300025921 Bacteria 624
215 Ga0207646_10023093 3300025922 Bacteria 5717
216 Ga0207646_10122558 3300025922 Bacteria 2336
217 Ga0207646_10584898 3300025922 Bacteria 1003
218 Ga0207646_11004647 3300025922 Unclassified 737
219 Ga0207687_10092009 3300025927 Bacteria 2214
220 Ga0207687_10382013 3300025927 Bacteria 1154
221 Ga0207700_10096997 3300025928 Bacteria 2342
222 Ga0207700_10495125 3300025928 Bacteria 1081
223 Ga0207664_10054299 3300025929 Bacteria 3174
224 Ga0207664_10127933 3300025929 Bacteria 2134
225 Ga0207664_10133314 3300025929 Bacteria 2094
226 Ga0207664_10193901 3300025929 Bacteria 1750
227 Ga0207664_10310865 3300025929 Bacteria 1388
228 Ga0207664_10347829 3300025929 Bacteria 1312
229 Ga0207664_10502498 3300025929 Bacteria 1086
230 Ga0207664_10920759 3300025929 Bacteria 785
231 Ga0207664_11348038 3300025929 Unclassified 634
232 Ga0207664_11370577 3300025929 Unclassified 628
233 Ga0207664_11466435 3300025929 Bacteria 604
234 Ga0207644_11737862 3300025931 Unclassified 522
235 Ga0207690_11571618 3300025932 Unclassified 550
236 Ga0207706_11376466 3300025933 Bacteria 580
237 Ga0207709_10329987 3300025935 Bacteria 1145
238 Ga0207709_10487864 3300025935 Bacteria 959
239 Ga0207670_11217593 3300025936 Bacteria 637
240 Ga0207704_11883252 3300025938 Unclassified 514
241 Ga0207665_10009738 3300025939 Bacteria 6308
242 Ga0207665_10247061 3300025939 Unclassified 1317
243 Ga0207665_11170224 3300025939 Bacteria 613
244 Ga0207711_11121591 3300025941 Bacteria 727
245 Ga0207711_11616837 3300025941 Bacteria 591
246 Ga0207661_12028071 3300025944 Unclassified 521
247 Ga0207679_12044567 3300025945 Bacteria 521
248 Ga0207667_10028283 3300025949 Bacteria 6090
249 Ga0207667_10200842 3300025949 Bacteria 2045
250 Ga0207667_12160038 3300025949 Unclassified 514
251 Ga0207712_10491888 3300025961 Bacteria 1047
252 Ga0207640_10478505 3300025981 Unclassified 1032
253 Ga0207677_11523081 3300026023 Bacteria 618
254 Ga0207708_10254894 3300026075 Bacteria 1415
255 Ga0207702_10181015 3300026078 Bacteria 1941
256 Ga0207702_10633802 3300026078 Bacteria 1051
257 Ga0207702_11441860 3300026078 Bacteria 682
258 Ga0207641_10801055 3300026088 Bacteria 932
259 Ga0207674_10099691 3300026116 Bacteria 2887
260 Ga0207675_100673310 3300026118 Bacteria 1042
261 Ga0207683_10008480 3300026121 Bacteria 8796
262 Ga0207683_10057000 3300026121 Bacteria 3429
263 Ga0207698_11424200 3300026142 Bacteria 708
264 Ga0268264_12300899 3300028381 Bacteria 546
265 Ga0265319_1053267 3300028563 Bacteria 1330
266 Ga0265336_10011346 3300028666 Bacteria 3033
267 Ga0265338_10002456 3300028800 Bacteria 27727
268 Ga0307408_100897858 3300031548 Bacteria 811
269 Ga0307413_10083893 3300031824 Bacteria 2052
270 Ga0307409_100371533 3300031995 Bacteria 1356
271 Ga0307415_100398362 3300032126 Bacteria 1174
272 Ga0373930_0059219 3300034816 Bacteria 851
273 Ga0373948_0001619 3300034817 Bacteria 3172
274 Ga0373959_0008523 3300034820 Bacteria 1747
275 Ga0373926_0381898 3300035083 Unclassified 555
276 Ga0373928_0001325 3300035084 Bacteria 4858
277 Ga0373929_0003994 3300035085 Bacteria 2644
278 Ga0373940_0005886 3300035088 Bacteria 2686
279 Ga0373944_0253943 3300035089 Unclassified 650
280 Ga0373949_0005034 3300035090 Bacteria 2976
281 Ga0373923_0451465 3300035111 Viruses 623
282 Ga0373932_0003085 3300035112 Bacteria 4060
283 Ga0373936_0045181 3300035113 Bacteria 1774
284 Ga0373939_0043725 3300035114 Bacteria 1360
285 Ga0373941_0004496 3300035115 Bacteria 3226
286 Ga0373953_0026702 3300035117 Bacteria 2214
287 Ga0373954_0238184 3300035118 Unclassified 896
288 Ga0373957_0093482 3300035120 Bacteria 1198
289 Ga0373943_0069446 3300035170 Bacteria 1780
290 Ga0373943_0856389 3300035170 Unclassified 542
291 Ga0373942_0052689 3300035207 Bacteria 1145
292 Ga0373961_0005508 3300035241 Bacteria 3042
293 Ga0373962_0010318 3300035242 Bacteria 2326
294 Ga0373931_0138239 3300035691 Bacteria 1408
295 Ga0373935_0256378 3300035692 Unclassified 1225
296 Ga0373935_0494776 3300035692 Bacteria 887
297 Ga0373947_0059627 3300035725 Bacteria 2314
298 Ga0373947_0416899 3300035725 Bacteria 907
299 Ga0373937_0156923 3300036401 Bacteria 2133
300 Ga0373925_0115353 3300037068 Unclassified 2079
301 Ga0373925_0872865 3300037068 Unclassified 741
302 Ga0373925_1204967 3300037068 Bacteria 622
303 Ga0395899_0205010 3300037312 Bacteria 1373
304 Ga0395899_0790009 3300037312 Bacteria 587
305 Ga0395899_0891796 3300037312 Unclassified 543
306 Ga0395900_0166078 3300037418 Bacteria 2249
307 Ga0395900_0228158 3300037418 Bacteria 1874
308 Ga0395900_0475501 3300037418 Bacteria 1203
309 Ga0395900_0592842 3300037418 Unclassified 1049
310 Ga0395900_0789135 3300037418 Bacteria 878
311 Ga0395900_1737383 3300037418 Unclassified 535
312 Ga0395898_0113838 3300037466 Bacteria 2592
313 Ga0395898_0183211 3300037466 Bacteria 2001
314 Ga0395905_0141173 3300037471 Bacteria 2266
315 Ga0395905_1248302 3300037471 Bacteria 647
316 Ga0395901_0023454 3300038443 Bacteria 6327
317 Ga0395901_0266052 3300038443 Unclassified 1784
318 Ga0395901_0267907 3300038443 Bacteria 1777
319 Ga0395901_0324884 3300038443 Unclassified 1591
320 Ga0395901_0329378 3300038443 Bacteria 1579
321 Ga0395901_0879826 3300038443 Bacteria 879
322 Ga0395901_1765823 3300038443 Unclassified 568
323 Ga0436360_0629357 3300039438 Bacteria 4824
324 Ga0436360_0678051 3300039438 Bacteria 716
325 Ga0439448_0113945 3300042005 Bacteria 925
326 Ga0450894_056013 3300042131 Unclassified 587
327 Ga0466969_0097733 3300044656 Unclassified 1385
328 Ga0466969_0344921 3300044656 Bacteria 674
329 Ga0466972_0013276 3300044658 Bacteria 4136
330 Ga0466972_0554787 3300044658 Bacteria 542
331 Ga0466972_0607633 3300044658 Unclassified 517
332 Ga0466965_0051295 3300044683 Bacteria 2047
333 Ga0466965_0051931 3300044683 Bacteria 2035
334 Ga0466966_0028926 3300044684 Bacteria 3608
335 Ga0466966_0196266 3300044684 Bacteria 1222
336 Ga0466966_0512998 3300044684 Unclassified 721
337 Ga0466961_0020742 3300044693 Bacteria 4229
338 Ga0466961_0179183 3300044693 Bacteria 1316
339 Ga0466961_0330833 3300044693 Bacteria 928
340 Ga0466961_0421754 3300044693 Bacteria 809
341 Ga0466961_0634350 3300044693 Unclassified 641
342 Ga0466963_0002006 3300044694 Bacteria 11187
343 Ga0466963_0006982 3300044694 Bacteria 6720
344 Ga0466963_0007277 3300044694 Bacteria 6600
345 Ga0466963_0008804 3300044694 Bacteria 6063
346 Ga0466963_0011955 3300044694 Bacteria 5301
347 Ga0466963_0094068 3300044694 Bacteria 2044
348 Ga0466963_0113070 3300044694 Bacteria 1864
349 Ga0466963_0255395 3300044694 Bacteria 1230
350 Ga0466963_0458933 3300044694 Bacteria 899
351 Ga0466963_0558805 3300044694 Unclassified 808
352 Ga0466963_0634682 3300044694 Bacteria 754
353 Ga0466964_0032653 3300044706 Bacteria 2069
354 Ga0466964_0061360 3300044706 Bacteria 1565
355 Ga0466964_0077350 3300044706 Bacteria 1421
356 Ga0466964_0089304 3300044706 Unclassified 1338
357 Ga0466964_0123086 3300044706 Bacteria 1172
358 Ga0466964_0744125 3300044706 Unclassified 550
359 Ga0466971_0002599 3300044719 Bacteria 7639
360 Ga0466971_0068966 3300044719 Bacteria 1604
361 Ga0466971_0317019 3300044719 Bacteria 751
362 Ga0466971_0444744 3300044719 Bacteria 635
363 Ga0466968_0002483 3300044735 Bacteria 6779
364 Ga0466968_0014727 3300044735 Bacteria 3094
365 Ga0466968_0063672 3300044735 Bacteria 1594
366 Ga0466968_0067270 3300044735 Bacteria 1553
367 Ga0466968_0072913 3300044735 Bacteria 1498
368 Ga0466968_0076304 3300044735 Unclassified 1467
369 Ga0466968_0081656 3300044735 Bacteria 1421
370 Ga0466968_0408039 3300044735 Bacteria 667
371 Ga0466968_0429655 3300044735 Unclassified 651
372 Ga0466968_0664818 3300044735 Bacteria 530
373 Ga0466970_0025902 3300044765 Bacteria 3073
374 Ga0466970_0047963 3300044765 Bacteria 2277
375 Ga0466957_0029706 3300044842 Bacteria 3261
376 Ga0466957_0040186 3300044842 Bacteria 2825
377 Ga0466957_0451240 3300044842 Bacteria 886
378 Ga0466957_0613514 3300044842 Bacteria 762
379 Ga0466957_0641831 3300044842 Bacteria 746
380 Ga0466957_0724830 3300044842 Unclassified 703
381 Ga0466957_1168658 3300044842 Bacteria 556
382 Ga0466957_1332076 3300044842 Unclassified 521
383 Ga0466960_0004236 3300044901 Bacteria 5584
384 Ga0466960_0051154 3300044901 Bacteria 1995
385 Ga0466960_0095368 3300044901 Unclassified 1523
386 Ga0466960_0568622 3300044901 Unclassified 670
387 Ga0466959_0029483 3300045049 Bacteria 4065
388 Ga0466959_0048382 3300045049 Bacteria 3124
389 Ga0466959_0147414 3300045049 Unclassified 1660
390 Ga0466959_0154507 3300045049 Bacteria 1615
391 Ga0466959_0243776 3300045049 Bacteria 1241
392 Ga0466959_0294047 3300045049 Unclassified 1113
393 Ga0466959_0669012 3300045049 Unclassified 696
394 Ga0451576_0093071 3300045051 Bacteria 3134
395 Ga0466958_0012762 3300045836 Bacteria 4765
396 Ga0466958_0024033 3300045836 Bacteria 3583
397 Ga0466958_0027320 3300045836 Bacteria 3378
398 Ga0466958_0043921 3300045836 Bacteria 2693
399 Ga0466958_0047860 3300045836 Bacteria 2582
400 Ga0466958_0119821 3300045836 Bacteria 1647
401 Ga0466958_0142788 3300045836 Unclassified 1508
402 Ga0466958_0148972 3300045836 Bacteria 1475
403 Ga0466958_0161738 3300045836 Bacteria 1415
404 Ga0466958_0251268 3300045836 Bacteria 1131
405 Ga0466958_0261753 3300045836 Bacteria 1107
406 Ga0466958_0412654 3300045836 Bacteria 872
407 Ga0466967_0001698 3300045976 Bacteria 13107
408 Ga0466967_0018440 3300045976 Bacteria 5577
409 Ga0466967_0019123 3300045976 Bacteria 5500
410 Ga0466967_0031130 3300045976 Bacteria 4488
411 Ga0466967_0041815 3300045976 Bacteria 3956
412 Ga0466967_0097345 3300045976 Bacteria 2685
413 Ga0466967_0141072 3300045976 Bacteria 2244
414 Ga0466967_0148818 3300045976 Bacteria 2186
415 Ga0466967_0188795 3300045976 Unclassified 1947
416 Ga0466967_0195643 3300045976 Bacteria 1912
417 Ga0466967_0217653 3300045976 Bacteria 1813
418 Ga0466967_0313145 3300045976 Unclassified 1512
419 Ga0466967_0688965 3300045976 Bacteria 1012
420 Ga0466967_0822397 3300045976 Unclassified 923
421 Ga0466967_0962500 3300045976 Bacteria 849
422 Ga0466967_1471299 3300045976 Unclassified 678
423 Ga0495592_0000123 3300046454 Bacteria 68503
424 Ga0495592_0030159 3300046454 Bacteria 4101
425 Ga0495603_0062804 3300046455 Bacteria 2192
426 Ga0495603_0213450 3300046455 Bacteria 1114
427 Ga0495629_0163855 3300046459 Bacteria 1544
428 Ga0495629_0553006 3300046459 Unclassified 772
429 Ga0495641_0025275 3300046461 Bacteria 2917
430 Ga0495641_0054906 3300046461 Bacteria 1809
431 Ga0495641_0104518 3300046461 Unclassified 1264
432 Ga0495641_0169586 3300046461 Bacteria 977
433 Ga0495651_0000029 3300046462 Bacteria 105042
434 Ga0495651_0269333 3300046462 Bacteria 1155
435 Ga0495653_0003956 3300046463 Bacteria 11963
436 Ga0495653_0285556 3300046463 Bacteria 1081
437 Ga0495653_0391144 3300046463 Bacteria 886
438 Ga0495653_0639204 3300046463 Bacteria 651
439 Ga0495582_0325256 3300046473 Bacteria 885
440 Ga0495582_0550406 3300046473 Bacteria 667
441 Ga0495582_0841344 3300046473 Unclassified 531
442 Ga0495662_0174180 3300046476 Bacteria 1060
443 Ga0495664_0150144 3300046477 Bacteria 1413
444 Ga0495664_0206421 3300046477 Bacteria 1190
445 Ga0495585_0129035 3300046492 Unclassified 1332
446 Ga0495594_0332210 3300046499 Bacteria 866
447 Ga0495596_0178517 3300046500 Unclassified 825
448 Ga0495596_0198907 3300046500 Bacteria 779
449 Ga0495607_0048477 3300046501 Unclassified 2484
450 Ga0495608_0002826 3300046511 Bacteria 12446
451 Ga0495608_0088963 3300046511 Bacteria 1999
452 Ga0495608_0798019 3300046511 Unclassified 557
453 Ga0495618_0009350 3300046514 Bacteria 5915
454 Ga0495618_0318772 3300046514 Bacteria 963
455 Ga0495628_0000016 3300046516 Bacteria 170260
456 Ga0495628_0075327 3300046516 Bacteria 2628
457 Ga0495630_0291733 3300046517 Unclassified 1246
458 Ga0495630_0302376 3300046517 Bacteria 1222
459 Ga0495630_1378976 3300046517 Bacteria 530
460 Ga0495631_0169942 3300046518 Unclassified 935
461 Ga0495644_0015725 3300046523 Bacteria 2900
462 Ga0495652_0000045 3300046529 Bacteria 122469
463 Ga0495652_0443943 3300046529 Bacteria 909
464 Ga0495640_0004109 3300046533 Bacteria 11645
465 Ga0495640_0088988 3300046533 Bacteria 2040
466 Ga0495586_0021655 3300046535 Bacteria 3429
467 Ga0495587_0000083 3300046536 Bacteria 73166
468 Ga0495598_0411337 3300046537 Unclassified 530
469 Ga0495645_0000306 3300046543 Bacteria 35497
470 Ga0495645_0047894 3300046543 Bacteria 3113
471 Ga0495667_0039034 3300046559 Bacteria 3160
472 Ga0495667_0052463 3300046559 Unclassified 2686
473 Ga0495667_0466033 3300046559 Bacteria 793
474 Ga0495656_0002640 3300046615 Bacteria 5974
475 Ga0495634_0030109 3300046642 Bacteria 3751
476 Ga0495634_0211922 3300046642 Bacteria 1199
477 Ga0495634_0418727 3300046642 Bacteria 794
478 Ga0495611_0090010 3300046648 Unclassified 1418
479 Ga0495635_0963937 3300046663 Bacteria 544
480 Ga0495659_0017587 3300046664 Bacteria 2372
481 Ga0495659_0214380 3300046664 Unclassified 793
482 Ga0495657_0002001 3300046675 Bacteria 17366
483 Ga0495657_0044790 3300046675 Unclassified 3007
484 Ga0495657_0179398 3300046675 Bacteria 1301
485 Ga0495657_0401794 3300046675 Unclassified 806
486 Ga0495599_0000219 3300046678 Bacteria 36729
487 Ga0495599_0055035 3300046678 Bacteria 2492
488 Ga0495623_0000429 3300046679 Bacteria 27648
489 Ga0495623_0715116 3300046679 Bacteria 512
490 Ga0495646_0017542 3300046680 Bacteria 4540
491 Ga0495647_0214101 3300046681 Bacteria 848
492 Ga0495658_0288680 3300046683 Bacteria 1036
493 Ga0495658_0717597 3300046683 Unclassified 640
494 Ga0495613_0002918 3300046689 Bacteria 12813
495 Ga0495613_0381572 3300046689 Unclassified 964
496 Ga0495613_0557969 3300046689 Bacteria 766
497 Ga0495624_0110472 3300046690 Bacteria 1691
498 Ga0495624_0114314 3300046690 Unclassified 1659
499 Ga0495649_0642241 3300046694 Bacteria 522
500 Ga0495600_0071773 3300046809 Bacteria 2262
501 Ga0495600_0120139 3300046809 Bacteria 1709
502 Ga0495600_0586256 3300046809 Unclassified 679
503 Ga0495581_0074306 3300047315 Bacteria 1967
504 Ga0495581_0167220 3300047315 Unclassified 1286
505 Ga0495604_0000072 3300047317 Bacteria 88631
506 Ga0495604_0068411 3300047317 Bacteria 2695
507 Ga0495636_0053620 3300047318 Unclassified 1693
508 Ga0495674_0045450 3300047319 Bacteria 3899
509 Ga0495674_0060387 3300047319 Bacteria 3308
510 Ga0495674_0189677 3300047319 Bacteria 1709
511 Ga0495676_0162915 3300047321 Bacteria 1576
512 Ga0495676_0205444 3300047321 Bacteria 1366
513 Ga0495676_0923640 3300047321 Bacteria 558
514 Ga0495676_1003194 3300047321 Unclassified 533
515 Ga0495680_0003161 3300047322 Bacteria 16400
516 Ga0495680_0205289 3300047322 Unclassified 1412
517 Ga0495675_0000031 3300047444 Bacteria 99240
518 Ga0495675_0077260 3300047444 Bacteria 2098
519 Ga0495677_0045927 3300047445 Unclassified 1603
520 Ga0495673_0242545 3300047469 Unclassified 660
521 Ga0495684_0005222 3300047471 Bacteria 10121
522 Ga0495684_1075699 3300047471 Unclassified 506
523 Ga0495602_0000133 3300048088 Bacteria 69392
524 Ga0495614_0135856 3300048089 Archaea 1091
525 Ga0496100_0185217 3300048903 Bacteria 1508
526 Ga0496100_0981271 3300048903 Unclassified 664
527 Ga0496100_1220986 3300048903 Bacteria 593
528 Ga0496101_0028111 3300048904 Bacteria 3923
529 Ga0496101_0188124 3300048904 Bacteria 1592
530 Ga0496101_1302256 3300048904 Bacteria 568
531 Ga0496102_0028751 3300048905 Bacteria 4969
532 Ga0496102_0031068 3300048905 Bacteria 4787
533 Ga0496102_0051569 3300048905 Bacteria 3748
534 Ga0496102_0226769 3300048905 Bacteria 1762
535 Ga0496102_0677213 3300048905 Unclassified 954
536 Ga0496102_1389417 3300048905 Archaea 621
537 Ga0496102_1500271 3300048905 Unclassified 593
538 Ga0496103_0005252 3300048906 Bacteria 7776
539 Ga0496103_0005964 3300048906 Bacteria 7287
540 Ga0496103_0042219 3300048906 Bacteria 2805
541 Ga0496104_0006253 3300048907 Bacteria 10464
542 Ga0496104_0268810 3300048907 Bacteria 1617
543 Ga0496104_0878823 3300048907 Bacteria 801
544 Ga0496104_1172406 3300048907 Bacteria 671
545 Ga0496104_1738187 3300048907 Bacteria 526
546 Ga0496105_0035035 3300048908 Bacteria 4130
547 Ga0496105_0124219 3300048908 Bacteria 2127
548 Ga0496105_0201937 3300048908 Bacteria 1622
549 Ga0496105_0712398 3300048908 Bacteria 769
550 Ga0496106_0224750 3300048909 Bacteria 1497
551 Ga0496106_0336160 3300048909 Bacteria 1213
552 Ga0496107_0050169 3300048910 Bacteria 3007
553 Ga0496107_0197410 3300048910 Bacteria 1495
554 Ga0496108_0018399 3300048911 Bacteria 5719
555 Ga0496108_0033295 3300048911 Bacteria 4281
556 Ga0496108_0146135 3300048911 Bacteria 2038
557 Ga0496108_0282306 3300048911 Bacteria 1445
558 Ga0496108_1314279 3300048911 Unclassified 608
559 Ga0496109_0020592 3300048912 Bacteria 5826
560 Ga0496109_0277769 3300048912 Unclassified 1578
561 Ga0496109_0398534 3300048912 Bacteria 1300
562 Ga0496109_0447967 3300048912 Bacteria 1219
563 Ga0496109_0633978 3300048912 Bacteria 1005
564 Ga0496110_0102065 3300048913 Bacteria 2572
565 Ga0496110_0233940 3300048913 Bacteria 1671
566 Ga0496111_0033331 3300048914 Bacteria 3673
567 Ga0496111_0033863 3300048914 Bacteria 3644
568 Ga0496111_0063311 3300048914 Bacteria 2682
569 Ga0496112_0022196 3300048915 Bacteria 6049
570 Ga0496112_0099498 3300048915 Bacteria 2877
571 Ga0496112_0196321 3300048915 Bacteria 1978
572 Ga0496112_0214900 3300048915 Bacteria 1879
573 Ga0496112_1096133 3300048915 Bacteria 714
574 Ga0496113_0082165 3300048916 Bacteria 2470
575 Ga0496113_0098110 3300048916 Bacteria 2267
576 Ga0496113_0218826 3300048916 Bacteria 1517
577 Ga0496113_0253050 3300048916 Bacteria 1406
578 Ga0496113_0458241 3300048916 Bacteria 1025
579 Ga0496113_0710081 3300048916 Bacteria 802
580 Ga0496114_0083140 3300048917 Unclassified 2708
581 Ga0496114_0094393 3300048917 Bacteria 2544
582 Ga0496114_0515985 3300048917 Bacteria 1057
583 Ga0496115_0060441 3300048918 Bacteria 3053
584 Ga0496115_0074222 3300048918 Bacteria 2761
585 Ga0496115_0813106 3300048918 Bacteria 726
586 Ga0501031_0004754 3300049568 Bacteria 8820
587 Ga0501032_0287055 3300049569 Bacteria 1065
588 Ga0501036_0046060 3300049572 Bacteria 3693
589 Ga0501037_0467186 3300049573 Bacteria 859
590 Ga0501038_0061306 3300049574 Bacteria 3217
591 Ga0501039_0007399 3300049575 Bacteria 8373
592 Ga0501039_0316644 3300049575 Bacteria 1227
593 Ga0501040_0011540 3300049576 Bacteria 5783
594 Ga0501040_0302114 3300049576 Bacteria 1144
595 Ga0501041_0000831 3300049577 Bacteria 16549
596 Ga0501042_0000539 3300049578 Bacteria 19836
597 Ga0501043_0054289 3300049579 Bacteria 3146
598 Ga0501046_0001759 3300049580 Bacteria 20697
599 Ga0501046_0441601 3300049580 Bacteria 936
600 Ga0501048_0057279 3300049582 Bacteria 2763
601 Ga0501067_0015125 3300049583 Bacteria 4270
602 Ga0501067_0029377 3300049583 Bacteria 3046
603 Ga0501068_0009363 3300049584 Bacteria 5477
604 Ga0501068_0184377 3300049584 Bacteria 1320
605 Ga0501069_0023595 3300049585 Bacteria 3355
606 Ga0501070_0345084 3300049586 Unclassified 1209
607 Ga0501071_0020772 3300049587 Bacteria 4566
608 Ga0501072_0008040 3300049588 Bacteria 8004
609 Ga0501072_0701543 3300049588 Bacteria 795
610 Ga0501073_0026944 3300049589 Bacteria 4115
611 Ga0501074_0002779 3300049590 Bacteria 12247
612 Ga0501075_0000468 3300049591 Bacteria 24012
613 Ga0501076_0004870 3300049592 Bacteria 9595
614 Ga0501077_0035080 3300049593 Unclassified 3193
615 Ga0501079_0004598 3300049741 Bacteria 10228
616 Ga0501079_0435867 3300049741 Bacteria 1029
617 Ga0501080_0093538 3300049742 Bacteria 2791
618 Ga0501081_0003165 3300049743 Bacteria 10467
619 Ga0501081_0825000 3300049743 Bacteria 698
620 Ga0501083_0094187 3300049744 Bacteria 1977
621 Ga0501035_0013695 3300049822 Bacteria 7483
622 Ga0501045_0001327 3300049824 Bacteria 16429
623 nmdc:mga03683_169982_c1 3300050489 Bacteria 990
624 nmdc:mga00v17_535052_c1 3300050491 Unclassified 758
625 nmdc:mga08x19_425082_c1 3300050514 Bacteria 933
626 Ga0495601_0000626 3300053077 Bacteria 18860
627 Ga0495601_0009387 3300053077 Bacteria 5786
628 Ga0495601_0577305 3300053077 Bacteria 722
629 Ga0495612_0103599 3300053078 Bacteria 1213
630 Ga0495655_0102925 3300053083 Unclassified 848
631 Ga0495595_0068824 3300053084 Bacteria 1670
632 Ga0495595_0368329 3300053084 Unclassified 726
633 Ga0495595_0639443 3300053084 Bacteria 544
634 Ga0495619_0005077 3300053085 Bacteria 8362
635 Ga0495619_0052173 3300053085 Bacteria 2703
636 Ga0495619_0058992 3300053085 Bacteria 2549
637 Ga0501084_0003996 3300054114 Bacteria 12014
638 Ga0501084_1077032 3300054114 Bacteria 675
639 Ga0587073_0211367 3300059492 Archaea 587
640 Ga0501082_0002382 3300060353 Bacteria 16473
641 Ga0501082_1472840 3300060353 Bacteria 594
642 Ga0466962_0003932 3300061719 Bacteria 7110
643 Ga0466962_0152342 3300061719 Bacteria 1122
644 Ga0466962_0348275 3300061719 Bacteria 737
645 Ga0466962_0551878 3300061719 Bacteria 585
646 Ga0466962_0656597 3300061719 Unclassified 536
647 Ga0530510_0057010 3300061734 Bacteria 2823
648 Ga0530510_0318979 3300061734 Bacteria 1165
649 Ga0070660_101318383
650 Ga0070658_10812224
651 Ga0070683_100272657
652 Ga0070690_100093749
653 Ga0068869_102159589
654 Ga0070680_100884470
655 Ga0070682_100102678
656 Ga0070682_100786418
657 Ga0070660_100007052
658 Ga0070660_100030204
659 Ga0070660_100074625
660 Ga0070660_101491972
661 Ga0070689_102097380
662 Ga0070661_100254170
663 Ga0070661_100348273
664 Ga0070661_101360071
665 Ga0070692_10704722
666 Ga0070692_10827058
667 Ga0070671_100499441
668 Ga0070674_100293242
669 Ga0070659_100480933
670 Ga0070659_100700290
671 Ga0070703_10003289
672 Ga0070703_10015024
673 Ga0070709_10046079
674 Ga0070709_10109424
675 Ga0070709_10159971
676 Ga0070709_10190241
677 Ga0070709_11037628
678 Ga0070714_100029786
679 Ga0070714_100101758
680 Ga0070714_100177983
681 Ga0070714_100541552
682 Ga0070714_100686506
683 Ga0070714_101408239
684 Ga0070714_101433206
685 Ga0070714_101521372
686 Ga0070713_100036244
687 Ga0070713_101623002
688 Ga0070713_101912666
689 Ga0070710_10031998
690 Ga0070710_10403821
691 Ga0070710_10564070
692 Ga0070711_100502401
693 Ga0070705_100017042
694 Ga0070705_101231697
695 Ga0070708_100010592
696 Ga0070708_100220957
697 Ga0070708_101221342
698 Ga0070708_101438766
699 Ga0070678_100098411
700 Ga0070681_10064252
701 Ga0070681_10081212
702 Ga0070681_10120713
703 Ga0070681_10910767
704 Ga0070685_10411450
705 Ga0070706_100000796
706 Ga0070706_100084357
707 Ga0070706_100368141
708 Ga0070706_100462245
709 Ga0070706_100788582
710 Ga0070706_101682801
711 Ga0070707_100053112
712 Ga0070707_100083621
713 Ga0070707_100394821
714 Ga0070707_100534767
715 Ga0070707_100682658
716 Ga0070707_101359869
717 Ga0070707_101412195
718 Ga0070698_100324171
719 Ga0070698_100541829
720 Ga0070698_100949929
721 Ga0070698_101417659
722 Ga0070699_100091842
723 Ga0070699_100258720
724 Ga0070699_100367758
725 Ga0070699_100390867
726 Ga0070699_101051120
727 Ga0070699_101511073
728 Ga0070679_100008713
729 Ga0070679_100815646
730 Ga0070679_101314686
731 Ga0070684_100265073
732 Ga0070684_100396126
733 Ga0070697_100059620
734 Ga0070697_100060742
735 Ga0070697_100560746
736 Ga0070697_100758701
737 Ga0070697_101017352
738 Ga0070697_101572216
739 Ga0070686_100402343
740 Ga0070695_100000106
741 Ga0070695_100241880
742 Ga0070696_100037745
743 Ga0070696_100225444
744 Ga0070696_100990048
745 Ga0070696_101111518
746 Ga0070693_100023037
747 Ga0070693_100048457
748 Ga0070693_100976876
749 Ga0070704_100138140
750 Ga0070704_100470724
751 Ga0070704_101768219
752 Ga0068855_101907455
753 Ga0070664_100221828
754 Ga0070664_100626636
755 Ga0068857_100116957
756 Ga0068854_100371745
757 Ga0068856_100367664
758 Ga0068856_100561600
759 Ga0068856_100739688
760 Ga0070702_100018133
761 Ga0068852_100097515
762 Ga0068864_100801275
763 Ga0068866_10917323
764 Ga0068863_100400859
765 Ga0068860_102348296
766 Ga0081455_10632524
767 Ga0070717_10044362
768 Ga0070717_10373540
769 Ga0070717_11244947
770 Ga0070717_12134900
771 Ga0070716_100374663
772 Ga0070712_100171953
773 Ga0070712_100183611
774 Ga0070712_100584857
775 Ga0070712_100931741
776 Ga0097621_100170451
777 Ga0068871_100499753
778 Ga0075428_100178818
779 Ga0075428_101975839
780 Ga0075433_11088138
781 Ga0075434_102007441
782 Ga0099795_10132538
783 Ga0105240_10014499
784 Ga0105240_10038961
785 Ga0105245_10104078
786 Ga0105245_12655229
787 Ga0105247_10021640
788 Ga0114129_11068745
789 Ga0105241_10626294
790 Ga0105241_10878958
791 Ga0105248_10139772
792 Ga0105237_10015176
793 Ga0105237_12357027
794 Ga0105249_11206389
795 Ga0105239_10904386
796 Ga0105239_12066126
797 Ga0105246_10921566
798 Ga0157373_10059978
799 Ga0157373_10595996
800 Ga0157370_10077981
801 Ga0157370_10214841
802 Ga0157370_10360646
803 Ga0157369_10185935
804 Ga0157369_11457925
805 Ga0157369_11911750
806 Ga0157369_12163576
807 Ga0157374_10728245
808 Ga0157374_11704206
809 Ga0157378_10344157
810 Ga0157372_10020621
811 Ga0157372_10807531
812 Ga0157372_12898163
813 Ga0157375_10125319
814 Ga0157375_13794348
815 Ga0163163_12158903
816 Ga0157380_10127367
817 Ga0182008_10149787
818 Ga0182008_10262925
819 Ga0182008_10564005
820 Ga0157377_10808518
821 Ga0182007_10218724
822 Ga0206356_10777173
823 Ga0206353_10062287
824 Ga0206353_10614150
825 Ga0206353_10964622
826 Ga0213874_10379055
827 Ga0213871_10192881
828 Ga0207653_10002972
829 Ga0207653_10003328
830 Ga0207692_10745687
831 Ga0207710_10025634
832 Ga0207699_10071057
833 Ga0207705_10020115
834 Ga0207705_10441832
835 Ga0207684_10000001
836 Ga0207684_10346475
837 Ga0207684_10883181
838 Ga0207654_10516221
839 Ga0207654_11187884
840 Ga0207707_10096791
841 Ga0207707_10139893
842 Ga0207707_10318806
843 Ga0207707_10717449
844 Ga0207707_10997317
845 Ga0207695_10308149
846 Ga0207695_10410444
847 Ga0207671_10328681
848 Ga0207693_10070448
849 Ga0207693_10698858
850 Ga0207663_10056037
851 Ga0207663_10284694
852 Ga0207663_11241568
853 Ga0207660_10142070
854 Ga0207660_10390820
855 Ga0207657_10014288
856 Ga0207657_10014299
857 Ga0207657_11095734
858 Ga0207649_10149703
859 Ga0207652_10298962
860 Ga0207652_10537351
861 Ga0207652_10904742
862 Ga0207652_11320140
863 Ga0207646_10023093
864 Ga0207646_10122558
865 Ga0207646_10584898
866 Ga0207646_11004647
867 Ga0207687_10092009
868 Ga0207687_10382013
869 Ga0207700_10096997
870 Ga0207700_10495125
871 Ga0207664_10054299
872 Ga0207664_10127933
873 Ga0207664_10133314
874 Ga0207664_10193901
875 Ga0207664_10310865
876 Ga0207664_10347829
877 Ga0207664_10502498
878 Ga0207664_10920759
879 Ga0207664_11348038
880 Ga0207664_11370577
881 Ga0207664_11466435
882 Ga0207644_11737862
883 Ga0207690_11571618
884 Ga0207706_11376466
885 Ga0207709_10329987
886 Ga0207709_10487864
887 Ga0207670_11217593
888 Ga0207704_11883252
889 Ga0207665_10009738
890 Ga0207665_10247061
891 Ga0207665_11170224
892 Ga0207711_11121591
893 Ga0207711_11616837
894 Ga0207661_12028071
895 Ga0207679_12044567
896 Ga0207667_10028283
897 Ga0207667_10200842
898 Ga0207667_12160038
899 Ga0207712_10491888
900 Ga0207640_10478505
901 Ga0207677_11523081
902 Ga0207708_10254894
903 Ga0207702_10181015
904 Ga0207702_10633802
905 Ga0207702_11441860
906 Ga0207641_10801055
907 Ga0207674_10099691
908 Ga0207675_100673310
909 Ga0207683_10008480
910 Ga0207683_10057000
911 Ga0207698_11424200
912 Ga0268264_12300899
913 Ga0265319_1053267
914 Ga0265336_10011346
915 Ga0265338_10002456
916 Ga0307408_100897858
917 Ga0307413_10083893
918 Ga0307409_100371533
919 Ga0307415_100398362
920 Ga0373930_0059219
921 Ga0373948_0001619
922 Ga0373959_0008523
923 Ga0373926_0381898
924 Ga0373928_0001325
925 Ga0373929_0003994
926 Ga0373940_0005886
927 Ga0373944_0253943
928 Ga0373949_0005034
929 Ga0373923_0451465
930 Ga0373932_0003085
931 Ga0373936_0045181
932 Ga0373939_0043725
933 Ga0373941_0004496
934 Ga0373953_0026702
935 Ga0373954_0238184
936 Ga0373957_0093482
937 Ga0373943_0069446
938 Ga0373943_0856389
939 Ga0373942_0052689
940 Ga0373961_0005508
941 Ga0373962_0010318
942 Ga0373931_0138239
943 Ga0373935_0256378
944 Ga0373935_0494776
945 Ga0373947_0059627
946 Ga0373947_0416899
947 Ga0373937_0156923
948 Ga0373925_0115353
949 Ga0373925_0872865
950 Ga0373925_1204967
951 Ga0395899_0205010
952 Ga0395899_0790009
953 Ga0395899_0891796
954 Ga0395900_0166078
955 Ga0395900_0228158
956 Ga0395900_0475501
957 Ga0395900_0592842
958 Ga0395900_0789135
959 Ga0395900_1737383
960 Ga0395898_0113838
961 Ga0395898_0183211
962 Ga0395905_0141173
963 Ga0395905_1248302
964 Ga0395901_0023454
965 Ga0395901_0266052
966 Ga0395901_0267907
967 Ga0395901_0324884
968 Ga0395901_0329378
969 Ga0395901_0879826
970 Ga0395901_1765823
971 Ga0436360_0629357
972 Ga0436360_0678051
973 Ga0439448_0113945
974 Ga0450894_056013
975 Ga0466969_0097733
976 Ga0466969_0344921
977 Ga0466972_0013276
978 Ga0466972_0554787
979 Ga0466972_0607633
980 Ga0466965_0051295
981 Ga0466965_0051931
982 Ga0466966_0028926
983 Ga0466966_0196266
984 Ga0466966_0512998
985 Ga0466961_0020742
986 Ga0466961_0179183
987 Ga0466961_0330833
988 Ga0466961_0421754
989 Ga0466961_0634350
990 Ga0466963_0002006
991 Ga0466963_0006982
992 Ga0466963_0007277
993 Ga0466963_0008804
994 Ga0466963_0011955
995 Ga0466963_0094068
996 Ga0466963_0113070
997 Ga0466963_0255395
998 Ga0466963_0458933
999 Ga0466963_0558805
1000 Ga0466963_0634682
1001 Ga0466964_0032653
1002 Ga0466964_0061360
1003 Ga0466964_0077350
1004 Ga0466964_0089304
1005 Ga0466964_0123086
1006 Ga0466964_0744125
1007 Ga0466971_0002599
1008 Ga0466971_0068966
1009 Ga0466971_0317019
1010 Ga0466971_0444744
1011 Ga0466968_0002483
1012 Ga0466968_0014727
1013 Ga0466968_0063672
1014 Ga0466968_0067270
1015 Ga0466968_0072913
1016 Ga0466968_0076304
1017 Ga0466968_0081656
1018 Ga0466968_0408039
1019 Ga0466968_0429655
1020 Ga0466968_0664818
1021 Ga0466970_0025902
1022 Ga0466970_0047963
1023 Ga0466957_0029706
1024 Ga0466957_0040186
1025 Ga0466957_0451240
1026 Ga0466957_0613514
1027 Ga0466957_0641831
1028 Ga0466957_0724830
1029 Ga0466957_1168658
1030 Ga0466957_1332076
1031 Ga0466960_0004236
1032 Ga0466960_0051154
1033 Ga0466960_0095368
1034 Ga0466960_0568622
1035 Ga0466959_0029483
1036 Ga0466959_0048382
1037 Ga0466959_0147414
1038 Ga0466959_0154507
1039 Ga0466959_0243776
1040 Ga0466959_0294047
1041 Ga0466959_0669012
1042 Ga0451576_0093071
1043 Ga0466958_0012762
1044 Ga0466958_0024033
1045 Ga0466958_0027320
1046 Ga0466958_0043921
1047 Ga0466958_0047860
1048 Ga0466958_0119821
1049 Ga0466958_0142788
1050 Ga0466958_0148972
1051 Ga0466958_0161738
1052 Ga0466958_0251268
1053 Ga0466958_0261753
1054 Ga0466958_0412654
1055 Ga0466967_0001698
1056 Ga0466967_0018440
1057 Ga0466967_0019123
1058 Ga0466967_0031130
1059 Ga0466967_0041815
1060 Ga0466967_0097345
1061 Ga0466967_0141072
1062 Ga0466967_0148818
1063 Ga0466967_0188795
1064 Ga0466967_0195643
1065 Ga0466967_0217653
1066 Ga0466967_0313145
1067 Ga0466967_0688965
1068 Ga0466967_0822397
1069 Ga0466967_0962500
1070 Ga0466967_1471299
1071 Ga0495592_0000123
1072 Ga0495592_0030159
1073 Ga0495603_0062804
1074 Ga0495603_0213450
1075 Ga0495629_0163855
1076 Ga0495629_0553006
1077 Ga0495641_0025275
1078 Ga0495641_0054906
1079 Ga0495641_0104518
1080 Ga0495641_0169586
1081 Ga0495651_0000029
1082 Ga0495651_0269333
1083 Ga0495653_0003956
1084 Ga0495653_0285556
1085 Ga0495653_0391144
1086 Ga0495653_0639204
1087 Ga0495582_0325256
1088 Ga0495582_0550406
1089 Ga0495582_0841344
1090 Ga0495662_0174180
1091 Ga0495664_0150144
1092 Ga0495664_0206421
1093 Ga0495585_0129035
1094 Ga0495594_0332210
1095 Ga0495596_0178517
1096 Ga0495596_0198907
1097 Ga0495607_0048477
1098 Ga0495608_0002826
1099 Ga0495608_0088963
1100 Ga0495608_0798019
1101 Ga0495618_0009350
1102 Ga0495618_0318772
1103 Ga0495628_0000016
1104 Ga0495628_0075327
1105 Ga0495630_0291733
1106 Ga0495630_0302376
1107 Ga0495630_1378976
1108 Ga0495631_0169942
1109 Ga0495644_0015725
1110 Ga0495652_0000045
1111 Ga0495652_0443943
1112 Ga0495640_0004109
1113 Ga0495640_0088988
1114 Ga0495586_0021655
1115 Ga0495587_0000083
1116 Ga0495598_0411337
1117 Ga0495645_0000306
1118 Ga0495645_0047894
1119 Ga0495667_0039034
1120 Ga0495667_0052463
1121 Ga0495667_0466033
1122 Ga0495656_0002640
1123 Ga0495634_0030109
1124 Ga0495634_0211922
1125 Ga0495634_0418727
1126 Ga0495611_0090010
1127 Ga0495635_0963937
1128 Ga0495659_0017587
1129 Ga0495659_0214380
1130 Ga0495657_0002001
1131 Ga0495657_0044790
1132 Ga0495657_0179398
1133 Ga0495657_0401794
1134 Ga0495599_0000219
1135 Ga0495599_0055035
1136 Ga0495623_0000429
1137 Ga0495623_0715116
1138 Ga0495646_0017542
1139 Ga0495647_0214101
1140 Ga0495658_0288680
1141 Ga0495658_0717597
1142 Ga0495613_0002918
1143 Ga0495613_0381572
1144 Ga0495613_0557969
1145 Ga0495624_0110472
1146 Ga0495624_0114314
1147 Ga0495649_0642241
1148 Ga0495600_0071773
1149 Ga0495600_0120139
1150 Ga0495600_0586256
1151 Ga0495581_0074306
1152 Ga0495581_0167220
1153 Ga0495604_0000072
1154 Ga0495604_0068411
1155 Ga0495636_0053620
1156 Ga0495674_0045450
1157 Ga0495674_0060387
1158 Ga0495674_0189677
1159 Ga0495676_0162915
1160 Ga0495676_0205444
1161 Ga0495676_0923640
1162 Ga0495676_1003194
1163 Ga0495680_0003161
1164 Ga0495680_0205289
1165 Ga0495675_0000031
1166 Ga0495675_0077260
1167 Ga0495677_0045927
1168 Ga0495673_0242545
1169 Ga0495684_0005222
1170 Ga0495684_1075699
1171 Ga0495602_0000133
1172 Ga0495614_0135856
1173 Ga0496100_0185217
1174 Ga0496100_0981271
1175 Ga0496100_1220986
1176 Ga0496101_0028111
1177 Ga0496101_0188124
1178 Ga0496101_1302256
1179 Ga0496102_0028751
1180 Ga0496102_0031068
1181 Ga0496102_0051569
1182 Ga0496102_0226769
1183 Ga0496102_0677213
1184 Ga0496102_1389417
1185 Ga0496102_1500271
1186 Ga0496103_0005252
1187 Ga0496103_0005964
1188 Ga0496103_0042219
1189 Ga0496104_0006253
1190 Ga0496104_0268810
1191 Ga0496104_0878823
1192 Ga0496104_1172406
1193 Ga0496104_1738187
1194 Ga0496105_0035035
1195 Ga0496105_0124219
1196 Ga0496105_0201937
1197 Ga0496105_0712398
1198 Ga0496106_0224750
1199 Ga0496106_0336160
1200 Ga0496107_0050169
1201 Ga0496107_0197410
1202 Ga0496108_0018399
1203 Ga0496108_0033295
1204 Ga0496108_0146135
1205 Ga0496108_0282306
1206 Ga0496108_1314279
1207 Ga0496109_0020592
1208 Ga0496109_0277769
1209 Ga0496109_0398534
1210 Ga0496109_0447967
1211 Ga0496109_0633978
1212 Ga0496110_0102065
1213 Ga0496110_0233940
1214 Ga0496111_0033331
1215 Ga0496111_0033863
1216 Ga0496111_0063311
1217 Ga0496112_0022196
1218 Ga0496112_0099498
1219 Ga0496112_0196321
1220 Ga0496112_0214900
1221 Ga0496112_1096133
1222 Ga0496113_0082165
1223 Ga0496113_0098110
1224 Ga0496113_0218826
1225 Ga0496113_0253050
1226 Ga0496113_0458241
1227 Ga0496113_0710081
1228 Ga0496114_0083140
1229 Ga0496114_0094393
1230 Ga0496114_0515985
1231 Ga0496115_0060441
1232 Ga0496115_0074222
1233 Ga0496115_0813106
1234 Ga0501031_0004754
1235 Ga0501032_0287055
1236 Ga0501036_0046060
1237 Ga0501037_0467186
1238 Ga0501038_0061306
1239 Ga0501039_0007399
1240 Ga0501039_0316644
1241 Ga0501040_0011540
1242 Ga0501040_0302114
1243 Ga0501041_0000831
1244 Ga0501042_0000539
1245 Ga0501043_0054289
1246 Ga0501046_0001759
1247 Ga0501046_0441601
1248 Ga0501048_0057279
1249 Ga0501067_0015125
1250 Ga0501067_0029377
1251 Ga0501068_0009363
1252 Ga0501068_0184377
1253 Ga0501069_0023595
1254 Ga0501070_0345084
1255 Ga0501071_0020772
1256 Ga0501072_0008040
1257 Ga0501072_0701543
1258 Ga0501073_0026944
1259 Ga0501074_0002779
1260 Ga0501075_0000468
1261 Ga0501076_0004870
1262 Ga0501077_0035080
1263 Ga0501079_0004598
1264 Ga0501079_0435867
1265 Ga0501080_0093538
1266 Ga0501081_0003165
1267 Ga0501081_0825000
1268 Ga0501083_0094187
1269 Ga0501035_0013695
1270 Ga0501045_0001327
1271 nmdc:mga03683_169982_c1
1272 nmdc:mga00v17_535052_c1
1273 nmdc:mga08x19_425082_c1
1274 Ga0495601_0000626
1275 Ga0495601_0009387
1276 Ga0495601_0577305
1277 Ga0495612_0103599
1278 Ga0495655_0102925
1279 Ga0495595_0068824
1280 Ga0495595_0368329
1281 Ga0495595_0639443
1282 Ga0495619_0005077
1283 Ga0495619_0052173
1284 Ga0495619_0058992
1285 Ga0501084_0003996
1286 Ga0501084_1077032
1287 Ga0587073_0211367
1288 Ga0501082_0002382
1289 Ga0501082_1472840
1290 Ga0466962_0003932
1291 Ga0466962_0152342
1292 Ga0466962_0348275
1293 Ga0466962_0551878
1294 Ga0466962_0656597
1295 Ga0530510_0057010
1296 Ga0530510_0318979

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oqq-assembly1.cif.gz_B legionella pneumophila sidj/saccharomyces cerevisiae calmodulin complex 0.6072 22 63
7qoo-assembly1.cif.gz_W structure of the human inner kinetochore ccan complex 0.5001 6 61
1mnm-assembly1.cif.gz_C yeast matalpha2/mcm1/dna ternary transcription complex crystal structure 0.4886 15 62
7czl-assembly1.cif.gz_N structural insights into a dimeric psb27-photosystem ii complex from a cyanobacterium thermosynechococcus vulcanus 0.4801 7 61
4ne1-assembly1.cif.gz_W human mhf1 mhf2 dna complexes 0.4727 7 61
ID Description Score Start End Superfamily
af_Q9W4B1_214_299_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.7313 23 60 1.10.238.10
af_Q9BXY5_429_514_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.6985 25 64 1.10.238.10
af_Q9SYG2_94_158_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6911 23 61 1.10.10.60
af_Q6KAQ7_662_715_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6766 23 62 1.10.10.60
af_Q9VM59_135_186_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6324 23 63 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A838KFP3-F1-model_v4 Uncharacterized protein 0.9813 27 69
AF-A0A4S3JQG9-F1-model_v4 LexA repressor DNA-binding domain-containing protein 0.9502 23 67 GO:0018836
AF-A0A838KFP3-F1-model_v4 Uncharacterized protein 0.9192 27 69
AF-A0A2V8EP18-F1-model_v4 Alkylmercury lyase 0.9027 27 68 GO:0016829
AF-A0A7V9B7Y4-F1-model_v4 Uncharacterized protein 0.8874 23 68

Map