F472304

General Info

Members Datasets Scaffolds Average Seq Length
647 267 1294 253

Family's Representative Sequence

Representative Sequence 3300041496|Ga0451839_0643251|Ga0451839_0643251_82_837
Length 251
Sequence MDGPPTFHLSQGDAVDWLRALPSESIDLVVTDPPYESLEKHRAIGTTTRLKHSKASSNDWFEIFPNARFPELFAAVYRVLKPNTHFYLFCDPETMFVAKQAADQMDERARFKFWKPLIWNKQRIGMGYHYRAKYECILFFEKGKRKLNNLGISDIIDCPRVIGGYPAEKPPQVASVLVEQSSQVGELVIDPFMGSGSTGVAAISNGRDFKGNDLCAEALDITRTRLLELGAKEDRPLTASDSEIAQLGLML

Samples

Sample ID Description Type Environment
1 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
232 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
253 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
254 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
255 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
258 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0
Rhizoplane 1.55
Rhizosphere 93.97
Stem 0
Stem Tuber 0
Unclassified 12.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451839_0643251 3300041496 Bacteria 980
2 JGI24749J21850_1020852 3300002076 Unclassified 926
3 JGI25406J46586_10000235 3300003203 Bacteria 24695
4 JGI25406J46586_10064113 3300003203 Bacteria 1175
5 Ga0065714_10135118 3300005288 Bacteria 1216
6 Ga0065712_10067865 3300005290 Bacteria 24437
7 Ga0065712_10107489 3300005290 Unclassified 1894
8 Ga0065715_10107907 3300005293 Unclassified 2746
9 Ga0065715_10123608 3300005293 Bacteria 2167
10 Ga0065707_10003223 3300005295 Bacteria 8202
11 Ga0065707_10131964 3300005295 Bacteria 1905
12 Ga0070658_10255184 3300005327 Unclassified 1488
13 Ga0070676_10003293 3300005328 Bacteria 8396
14 Ga0070676_10038292 3300005328 Bacteria 2769
15 Ga0070676_10302780 3300005328 Archaea 1084
16 Ga0070690_100007181 3300005330 Bacteria 6371
17 Ga0070690_100018154 3300005330 Bacteria 4243
18 Ga0070690_100053632 3300005330 Unclassified 2579
19 Ga0070690_100112843 3300005330 Bacteria 1816
20 Ga0070670_100003801 3300005331 Bacteria 12580
21 Ga0070670_100021404 3300005331 Bacteria 5563
22 Ga0070670_100075879 3300005331 Bacteria 2888
23 Ga0070670_100158493 3300005331 Bacteria 1961
24 Ga0070670_100264234 3300005331 Bacteria 1501
25 Ga0070677_10011656 3300005333 Bacteria 3037
26 Ga0070677_10028514 3300005333 Bacteria 2110
27 Ga0070677_10038554 3300005333 Unclassified 1871
28 Ga0068869_100011020 3300005334 Bacteria 5922
29 Ga0068869_100041469 3300005334 Bacteria 3297
30 Ga0070666_10014378 3300005335 Bacteria 5038
31 Ga0070666_10040292 3300005335 Bacteria 3117
32 Ga0070666_10049607 3300005335 Bacteria 2821
33 Ga0070666_10228383 3300005335 Bacteria 1314
34 Ga0070682_100480853 3300005337 Bacteria 958
35 Ga0068868_100053897 3300005338 Unclassified 3168
36 Ga0070660_100697262 3300005339 Bacteria 851
37 Ga0070689_100011819 3300005340 Bacteria 6266
38 Ga0070689_100014676 3300005340 Bacteria 5697
39 Ga0070689_100025074 3300005340 Bacteria 4478
40 Ga0070689_100073827 3300005340 Bacteria 2669
41 Ga0070689_100111910 3300005340 Unclassified 2172
42 Ga0070689_100344795 3300005340 Bacteria 1248
43 Ga0070691_10010237 3300005341 Bacteria 4277
44 Ga0070691_10035610 3300005341 Bacteria 2344
45 Ga0070691_10225709 3300005341 Bacteria 994
46 Ga0070687_100010127 3300005343 Unclassified 4062
47 Ga0070687_100021721 3300005343 Bacteria 3023
48 Ga0070687_100030045 3300005343 Bacteria 2653
49 Ga0070687_100306827 3300005343 Bacteria 1009
50 Ga0070661_100009654 3300005344 Bacteria 6688
51 Ga0070661_100074836 3300005344 Bacteria 2495
52 Ga0070661_100127838 3300005344 Bacteria 1907
53 Ga0070692_10136137 3300005345 Bacteria 1385
54 Ga0070668_100026305 3300005347 Bacteria 4415
55 Ga0070668_100092311 3300005347 Bacteria 2388
56 Ga0070669_100000905 3300005353 Bacteria 21589
57 Ga0070669_100010357 3300005353 Bacteria 6620
58 Ga0070669_100039266 3300005353 Bacteria 3439
59 Ga0070669_100064742 3300005353 Bacteria 2693
60 Ga0070669_100088723 3300005353 Unclassified 2315
61 Ga0070669_100193969 3300005353 Unclassified 1595
62 Ga0070675_100001573 3300005354 Bacteria 16869
63 Ga0070675_100049288 3300005354 Bacteria 3457
64 Ga0070675_100093543 3300005354 Bacteria 2521
65 Ga0070675_100132071 3300005354 Bacteria 2128
66 Ga0070675_100212958 3300005354 Bacteria 1680
67 Ga0070675_100328365 3300005354 Unclassified 1352
68 Ga0070671_100009508 3300005355 Bacteria 7802
69 Ga0070671_100167693 3300005355 Bacteria 1857
70 Ga0070671_100237572 3300005355 Bacteria 1547
71 Ga0070674_100016839 3300005356 Bacteria 4586
72 Ga0070674_100125900 3300005356 Bacteria 1903
73 Ga0070673_100001470 3300005364 Bacteria 13793
74 Ga0070673_100031718 3300005364 Bacteria 3969
75 Ga0070673_100032836 3300005364 Bacteria 3913
76 Ga0070673_100216905 3300005364 Unclassified 1654
77 Ga0070688_100008481 3300005365 Bacteria 5578
78 Ga0070688_100025611 3300005365 Unclassified 3494
79 Ga0070688_100031954 3300005365 Unclassified 3170
80 Ga0070688_100046289 3300005365 Bacteria 2693
81 Ga0070659_100077747 3300005366 Bacteria 2647
82 Ga0070659_100572165 3300005366 Bacteria 969
83 Ga0070667_100101830 3300005367 Bacteria 2481
84 Ga0070709_10098498 3300005434 Unclassified 1943
85 Ga0070713_100009346 3300005436 Bacteria 7011
86 Ga0070713_100020862 3300005436 Bacteria 5030
87 Ga0070701_10008429 3300005438 Bacteria 4460
88 Ga0070701_10165798 3300005438 Bacteria 1283
89 Ga0070705_100000816 3300005440 Bacteria 17518
90 Ga0070700_100008109 3300005441 Bacteria 5709
91 Ga0070700_100011101 3300005441 Bacteria 4982
92 Ga0070694_100000404 3300005444 Bacteria 23456
93 Ga0070694_100014795 3300005444 Bacteria 4888
94 Ga0070694_100088173 3300005444 Bacteria 2172
95 Ga0070694_100265285 3300005444 Bacteria 1304
96 Ga0070708_100498315 3300005445 Unclassified 1149
97 Ga0070663_100016940 3300005455 Bacteria 4744
98 Ga0070678_100022333 3300005456 Bacteria 4191
99 Ga0070678_100043497 3300005456 Bacteria 3200
100 Ga0070678_100189099 3300005456 Bacteria 1691
101 Ga0070662_100014937 3300005457 Bacteria 5192
102 Ga0070662_100136216 3300005457 Bacteria 1899
103 Ga0070662_100212667 3300005457 Bacteria 1539
104 Ga0070662_100528889 3300005457 Bacteria 986
105 Ga0070681_10053173 3300005458 Bacteria 4035
106 Ga0070681_10101499 3300005458 Bacteria 2822
107 Ga0068867_100006619 3300005459 Bacteria 8190
108 Ga0068867_100015567 3300005459 Bacteria 5396
109 Ga0068867_100217295 3300005459 Bacteria 1538
110 Ga0068867_100404090 3300005459 Bacteria 1153
111 Ga0070685_10003719 3300005466 Bacteria 7723
112 Ga0070685_10325802 3300005466 Bacteria 1043
113 Ga0070707_100040651 3300005468 Bacteria 4449
114 Ga0070698_100007242 3300005471 Bacteria 12016
115 Ga0070698_100088141 3300005471 Bacteria 3088
116 Ga0070698_100288881 3300005471 Bacteria 1571
117 Ga0070698_100442020 3300005471 Bacteria 1236
118 Ga0070699_100005414 3300005518 Bacteria 11191
119 Ga0070699_100069558 3300005518 Bacteria 3059
120 Ga0070699_100413221 3300005518 Bacteria 1221
121 Ga0070684_100176598 3300005535 Bacteria 1941
122 Ga0070672_100016778 3300005543 Bacteria 5251
123 Ga0070672_100019594 3300005543 Bacteria 4914
124 Ga0070672_100023578 3300005543 Bacteria 4539
125 Ga0070672_100035279 3300005543 Bacteria 3802
126 Ga0070672_100075089 3300005543 Bacteria 2698
127 Ga0070672_100310544 3300005543 Bacteria 1338
128 Ga0070686_100012251 3300005544 Bacteria 4877
129 Ga0070695_100000418 3300005545 Bacteria 21992
130 Ga0070695_100090814 3300005545 Bacteria 2039
131 Ga0070695_100481023 3300005545 Bacteria 957
132 Ga0070696_100004573 3300005546 Bacteria 9234
133 Ga0070696_100020999 3300005546 Bacteria 4426
134 Ga0070693_100052761 3300005547 Bacteria 2332
135 Ga0070665_100025018 3300005548 Bacteria 6018
136 Ga0070704_100023114 3300005549 Bacteria 4053
137 Ga0070704_100071651 3300005549 Bacteria 2518
138 Ga0070704_100155753 3300005549 Bacteria 1802
139 Ga0070664_100001566 3300005564 Bacteria 18284
140 Ga0070664_100041182 3300005564 Unclassified 3897
141 Ga0070664_100097008 3300005564 Bacteria 2559
142 Ga0070664_100195521 3300005564 Bacteria 1803
143 Ga0070664_100316162 3300005564 Bacteria 1414
144 Ga0068857_100124339 3300005577 Unclassified 2324
145 Ga0068854_100120608 3300005578 Bacteria 1990
146 Ga0070702_100075877 3300005615 Bacteria 1999
147 Ga0068852_100060494 3300005616 Bacteria 3288
148 Ga0068859_100003898 3300005617 Bacteria 15223
149 Ga0068859_100011406 3300005617 Bacteria 8933
150 Ga0068859_100032048 3300005617 Bacteria 5279
151 Ga0068859_100061755 3300005617 Unclassified 3776
152 Ga0068859_100095106 3300005617 Bacteria 3032
153 Ga0068859_100577661 3300005617 Bacteria 1218
154 Ga0068864_100040765 3300005618 Bacteria 3971
155 Ga0068864_100049629 3300005618 Bacteria 3611
156 Ga0068864_100054915 3300005618 Bacteria 3438
157 Ga0068864_100065238 3300005618 Bacteria 3159
158 Ga0068864_100145096 3300005618 Bacteria 2145
159 Ga0068864_100255567 3300005618 Bacteria 1628
160 Ga0068864_100877305 3300005618 Bacteria 885
161 Ga0068861_100009355 3300005719 Bacteria 6763
162 Ga0068861_100176847 3300005719 Bacteria 1773
163 Ga0068861_100299210 3300005719 Bacteria 1393
164 Ga0068851_10063099 3300005834 Bacteria 1902
165 Ga0068870_10000837 3300005840 Bacteria 11981
166 Ga0068870_10112464 3300005840 Unclassified 1557
167 Ga0068870_10131952 3300005840 Unclassified 1452
168 Ga0068863_100018471 3300005841 Bacteria 6673
169 Ga0068863_100060382 3300005841 Bacteria 3586
170 Ga0068863_100112824 3300005841 Bacteria 2589
171 Ga0068863_100213429 3300005841 Bacteria 1859
172 Ga0068858_100155752 3300005842 Bacteria 2149
173 Ga0068858_100799968 3300005842 Bacteria 920
174 Ga0068860_100002415 3300005843 Bacteria 19605
175 Ga0068860_100042083 3300005843 Bacteria 4365
176 Ga0068862_100004927 3300005844 Bacteria 11238
177 Ga0068862_100261164 3300005844 Bacteria 1581
178 Ga0081455_10080490 3300005937 Bacteria 2670
179 Ga0081539_10000017 3300005985 Bacteria 375107
180 Ga0081539_10000358 3300005985 Bacteria 100577
181 Ga0081539_10023710 3300005985 Bacteria 4009
182 Ga0070717_10121940 3300006028 Unclassified 2234
183 Ga0075368_10002367 3300006042 Bacteria 6133
184 Ga0075364_10007655 3300006051 Bacteria 6423
185 Ga0070712_100070686 3300006175 Bacteria 2495
186 Ga0075367_10002227 3300006178 Bacteria 8752
187 Ga0097621_100174259 3300006237 Bacteria 1856
188 Ga0097621_100278610 3300006237 Bacteria 1471
189 Ga0068871_100040027 3300006358 Bacteria 3753
190 Ga0068871_100113053 3300006358 Unclassified 2286
191 Ga0068871_100136940 3300006358 Bacteria 2080
192 Ga0068871_100205984 3300006358 Bacteria 1700
193 Ga0075428_100000966 3300006844 Bacteria 30438
194 Ga0075428_100002721 3300006844 Bacteria 19240
195 Ga0075428_100005539 3300006844 Bacteria 14045
196 Ga0075428_100019158 3300006844 Bacteria 7568
197 Ga0075428_100060858 3300006844 Unclassified 4134
198 Ga0075428_100099177 3300006844 Bacteria 3176
199 Ga0075428_100107034 3300006844 Bacteria 3048
200 Ga0075428_100314344 3300006844 Bacteria 1684
201 Ga0075428_100905044 3300006844 Bacteria 936
202 Ga0075430_100003708 3300006846 Bacteria 12836
203 Ga0075430_100004064 3300006846 Bacteria 12348
204 Ga0075430_100006719 3300006846 Bacteria 9704
205 Ga0075430_100027436 3300006846 Bacteria 4838
206 Ga0075430_100042408 3300006846 Bacteria 3847
207 Ga0075430_100127584 3300006846 Bacteria 2121
208 Ga0075431_100000306 3300006847 Bacteria 38508
209 Ga0075431_100022279 3300006847 Bacteria 6475
210 Ga0075431_100027107 3300006847 Bacteria 5877
211 Ga0075433_10000354 3300006852 Bacteria 28740
212 Ga0075433_10002437 3300006852 Bacteria 14164
213 Ga0075433_10004762 3300006852 Bacteria 10589
214 Ga0075433_10052781 3300006852 Unclassified 3543
215 Ga0075433_10085131 3300006852 Bacteria 2791
216 Ga0075433_10127221 3300006852 Bacteria 2262
217 Ga0075433_10181501 3300006852 Unclassified 1873
218 Ga0075434_100000062 3300006871 Bacteria 55222
219 Ga0075434_100002738 3300006871 Bacteria 15575
220 Ga0075434_100006005 3300006871 Bacteria 11112
221 Ga0075434_100129574 3300006871 Unclassified 2541
222 Ga0075434_100193910 3300006871 Unclassified 2052
223 Ga0075429_100002673 3300006880 Bacteria 15008
224 Ga0075429_100007827 3300006880 Bacteria 9284
225 Ga0075429_100017702 3300006880 Bacteria 6162
226 Ga0075429_100055290 3300006880 Bacteria 3454
227 Ga0075429_100058991 3300006880 Bacteria 3343
228 Ga0075429_100100515 3300006880 Bacteria 2524
229 Ga0075429_100101698 3300006880 Bacteria 2509
230 Ga0075429_100453265 3300006880 Bacteria 1124
231 Ga0068865_100063195 3300006881 Unclassified 2601
232 Ga0068865_100119083 3300006881 Unclassified 1960
233 Ga0068865_100385538 3300006881 Bacteria 1144
234 Ga0075436_100181382 3300006914 Bacteria 1488
235 Ga0097620_100003898 3300006931 Bacteria 15223
236 Ga0097620_100011406 3300006931 Bacteria 8933
237 Ga0097620_100032049 3300006931 Bacteria 5279
238 Ga0097620_100061756 3300006931 Unclassified 3776
239 Ga0097620_100095111 3300006931 Bacteria 3032
240 Ga0097620_100577664 3300006931 Bacteria 1218
241 Ga0075435_100004195 3300007076 Bacteria 9885
242 Ga0075435_100018689 3300007076 Bacteria 5278
243 Ga0075435_100025593 3300007076 Unclassified 4595
244 Ga0105240_10847775 3300009093 Bacteria 987
245 Ga0111539_10001341 3300009094 Bacteria 32793
246 Ga0111539_10002443 3300009094 Bacteria 24706
247 Ga0111539_10007113 3300009094 Bacteria 14344
248 Ga0111539_10009474 3300009094 Bacteria 12291
249 Ga0111539_10013448 3300009094 Bacteria 10230
250 Ga0111539_10016332 3300009094 Bacteria 9203
251 Ga0111539_10071453 3300009094 Unclassified 4095
252 Ga0111539_10096193 3300009094 Bacteria 3478
253 Ga0111539_10116299 3300009094 Bacteria 3136
254 Ga0111539_10128939 3300009094 Bacteria 2963
255 Ga0111539_10374579 3300009094 Bacteria 1657
256 Ga0105245_10056302 3300009098 Bacteria 3534
257 Ga0114129_10000580 3300009147 Bacteria 45136
258 Ga0114129_10006836 3300009147 Bacteria 16209
259 Ga0114129_10016296 3300009147 Bacteria 10579
260 Ga0114129_10050776 3300009147 Bacteria 5824
261 Ga0114129_10070454 3300009147 Bacteria 4876
262 Ga0114129_10073055 3300009147 Bacteria 4779
263 Ga0114129_10239973 3300009147 Bacteria 2436
264 Ga0114129_10242226 3300009147 Bacteria 2424
265 Ga0114129_10251912 3300009147 Bacteria 2370
266 Ga0114129_10411110 3300009147 Bacteria 1781
267 Ga0105243_10090164 3300009148 Bacteria 2522
268 Ga0105243_10112893 3300009148 Bacteria 2277
269 Ga0105241_10468312 3300009174 Bacteria 1118
270 Ga0105242_10022919 3300009176 Bacteria 4918
271 Ga0105242_10080946 3300009176 Bacteria 2715
272 Ga0105248_10013980 3300009177 Bacteria 8831
273 Ga0105248_10854275 3300009177 Unclassified 1027
274 Ga0105249_10005801 3300009553 Bacteria 10679
275 Ga0105249_10013712 3300009553 Bacteria 7157
276 Ga0105249_10468906 3300009553 Bacteria 1300
277 Ga0105239_10071305 3300010375 Bacteria 3817
278 Ga0105246_10018846 3300011119 Bacteria 4400
279 Ga0105246_10302111 3300011119 Bacteria 1293
280 Ga0157378_10084463 3300013297 Unclassified 2874
281 Ga0163162_10037106 3300013306 Bacteria 4860
282 Ga0163162_10062015 3300013306 Bacteria 3778
283 Ga0163162_10200913 3300013306 Bacteria 2122
284 Ga0157375_10001940 3300013308 Bacteria 17821
285 Ga0157375_10189983 3300013308 Bacteria 2208
286 Ga0157375_10480708 3300013308 Bacteria 1407
287 Ga0163163_10047104 3300014325 Bacteria 4237
288 Ga0163163_10056186 3300014325 Bacteria 3891
289 Ga0163163_10058488 3300014325 Bacteria 3812
290 Ga0157380_10002697 3300014326 Bacteria 12037
291 Ga0157380_10010493 3300014326 Bacteria 6665
292 Ga0157380_10103595 3300014326 Bacteria 2375
293 Ga0157380_10310833 3300014326 Bacteria 1456
294 Ga0157380_10392347 3300014326 Unclassified 1314
295 Ga0157380_10706485 3300014326 Unclassified 1014
296 Ga0157377_10014138 3300014745 Bacteria 4056
297 Ga0157377_10014930 3300014745 Bacteria 3961
298 Ga0157377_10117827 3300014745 Bacteria 1605
299 Ga0157379_10004591 3300014968 Bacteria 11850
300 Ga0163161_10006329 3300017792 Bacteria 8194
301 Ga0163161_10078030 3300017792 Bacteria 2434
302 Ga0207673_1002116 3300025290 Unclassified 2231
303 Ga0207697_10001409 3300025315 Bacteria 13169
304 Ga0207697_10030974 3300025315 Bacteria 2189
305 Ga0207697_10067726 3300025315 Unclassified 1493
306 Ga0207697_10107416 3300025315 Bacteria 1193
307 Ga0207682_10030799 3300025893 Unclassified 2150
308 Ga0207682_10056941 3300025893 Bacteria 1628
309 Ga0207642_10046192 3300025899 Bacteria 1938
310 Ga0207688_10001799 3300025901 Bacteria 11401
311 Ga0207688_10038096 3300025901 Bacteria 2668
312 Ga0207688_10145843 3300025901 Bacteria 1395
313 Ga0207688_10177268 3300025901 Bacteria 1270
314 Ga0207680_10056223 3300025903 Bacteria 2376
315 Ga0207699_10080153 3300025906 Unclassified 2022
316 Ga0207645_10001298 3300025907 Bacteria 20552
317 Ga0207645_10010247 3300025907 Bacteria 6441
318 Ga0207645_10034281 3300025907 Bacteria 3262
319 Ga0207645_10044583 3300025907 Bacteria 2838
320 Ga0207645_10182648 3300025907 Bacteria 1376
321 Ga0207643_10001468 3300025908 Bacteria 13539
322 Ga0207643_10002221 3300025908 Bacteria 10583
323 Ga0207643_10011325 3300025908 Bacteria 4815
324 Ga0207643_10049737 3300025908 Bacteria 2376
325 Ga0207705_10172491 3300025909 Unclassified 1629
326 Ga0207705_10523021 3300025909 Bacteria 922
327 Ga0207654_10114176 3300025911 Bacteria 1685
328 Ga0207693_10096172 3300025915 Bacteria 2322
329 Ga0207660_10184136 3300025917 Bacteria 1623
330 Ga0207662_10003068 3300025918 Bacteria 8524
331 Ga0207662_10005334 3300025918 Bacteria 6842
332 Ga0207662_10031685 3300025918 Bacteria 3072
333 Ga0207662_10046500 3300025918 Bacteria 2567
334 Ga0207657_10317751 3300025919 Unclassified 1232
335 Ga0207649_10119090 3300025920 Unclassified 1777
336 Ga0207652_10259171 3300025921 Bacteria 1568
337 Ga0207646_10046654 3300025922 Bacteria 3887
338 Ga0207646_10089529 3300025922 Bacteria 2755
339 Ga0207646_10366388 3300025922 Bacteria 1302
340 Ga0207646_10839838 3300025922 Unclassified 817
341 Ga0207681_10005201 3300025923 Bacteria 7989
342 Ga0207681_10041867 3300025923 Unclassified 3056
343 Ga0207681_10058753 3300025923 Bacteria 2634
344 Ga0207681_10137337 3300025923 Unclassified 1816
345 Ga0207681_10171419 3300025923 Unclassified 1645
346 Ga0207650_10238721 3300025925 Bacteria 1468
347 Ga0207650_10345859 3300025925 Bacteria 1222
348 Ga0207650_10347012 3300025925 Bacteria 1220
349 Ga0207659_10000671 3300025926 Bacteria 20258
350 Ga0207659_10016105 3300025926 Bacteria 4860
351 Ga0207659_10043231 3300025926 Bacteria 3163
352 Ga0207659_10104339 3300025926 Bacteria 2143
353 Ga0207700_10046898 3300025928 Bacteria 3199
354 Ga0207700_10202703 3300025928 Unclassified 1673
355 Ga0207644_10008511 3300025931 Bacteria 6712
356 Ga0207644_10046912 3300025931 Unclassified 3080
357 Ga0207690_10099864 3300025932 Bacteria 2070
358 Ga0207706_10008539 3300025933 Bacteria 9437
359 Ga0207706_10078134 3300025933 Bacteria 2911
360 Ga0207706_10079853 3300025933 Unclassified 2877
361 Ga0207706_10086281 3300025933 Bacteria 2759
362 Ga0207706_10531524 3300025933 Bacteria 1013
363 Ga0207709_10027215 3300025935 Bacteria 3291
364 Ga0207709_10051262 3300025935 Bacteria 2529
365 Ga0207670_10006290 3300025936 Bacteria 6580
366 Ga0207670_10047711 3300025936 Unclassified 2854
367 Ga0207670_10178092 3300025936 Bacteria 1599
368 Ga0207670_10180164 3300025936 Bacteria 1591
369 Ga0207669_10002217 3300025937 Bacteria 8257
370 Ga0207669_10088120 3300025937 Bacteria 2012
371 Ga0207704_10014123 3300025938 Bacteria 4024
372 Ga0207704_10091243 3300025938 Bacteria 2002
373 Ga0207704_10133069 3300025938 Bacteria 1726
374 Ga0207691_10002728 3300025940 Bacteria 17256
375 Ga0207691_10010512 3300025940 Bacteria 8880
376 Ga0207691_10133149 3300025940 Bacteria 2194
377 Ga0207691_10187560 3300025940 Bacteria 1805
378 Ga0207691_10198704 3300025940 Bacteria 1746
379 Ga0207691_10219284 3300025940 Bacteria 1650
380 Ga0207691_10355617 3300025940 Bacteria 1253
381 Ga0207711_10012331 3300025941 Bacteria 7105
382 Ga0207711_10069404 3300025941 Bacteria 3055
383 Ga0207689_10003595 3300025942 Bacteria 14158
384 Ga0207689_10020548 3300025942 Bacteria 5555
385 Ga0207689_10093189 3300025942 Bacteria 2474
386 Ga0207689_10164158 3300025942 Unclassified 1830
387 Ga0207661_10003048 3300025944 Bacteria 11591
388 Ga0207661_10169332 3300025944 Bacteria 1901
389 Ga0207679_10001960 3300025945 Bacteria 12774
390 Ga0207679_10023240 3300025945 Unclassified 4235
391 Ga0207679_10123299 3300025945 Bacteria 2067
392 Ga0207651_10020824 3300025960 Bacteria 3968
393 Ga0207651_10075364 3300025960 Bacteria 2407
394 Ga0207651_10108550 3300025960 Bacteria 2077
395 Ga0207651_10499370 3300025960 Bacteria 1051
396 Ga0207712_10008832 3300025961 Bacteria 6372
397 Ga0207712_10093888 3300025961 Bacteria 2215
398 Ga0207712_10378272 3300025961 Bacteria 1184
399 Ga0207712_10451087 3300025961 Bacteria 1091
400 Ga0207668_10058106 3300025972 Bacteria 2702
401 Ga0207668_10102744 3300025972 Bacteria 2127
402 Ga0207640_10008838 3300025981 Bacteria 5608
403 Ga0207658_10007310 3300025986 Bacteria 7533
404 Ga0207703_10025856 3300026035 Bacteria 4620
405 Ga0207703_10163239 3300026035 Bacteria 1953
406 Ga0207703_10503882 3300026035 Bacteria 1137
407 Ga0207678_10027579 3300026067 Bacteria 4955
408 Ga0207678_10335868 3300026067 Bacteria 1301
409 Ga0207708_10028934 3300026075 Bacteria 4196
410 Ga0207708_10080573 3300026075 Bacteria 2501
411 Ga0207708_10171833 3300026075 Bacteria 1717
412 Ga0207708_10222286 3300026075 Bacteria 1513
413 Ga0207641_10024047 3300026088 Bacteria 5020
414 Ga0207641_10151514 3300026088 Unclassified 2100
415 Ga0207641_10155872 3300026088 Bacteria 2072
416 Ga0207641_10228853 3300026088 Bacteria 1727
417 Ga0207648_10001387 3300026089 Bacteria 26689
418 Ga0207648_10006172 3300026089 Bacteria 11938
419 Ga0207676_10028495 3300026095 Bacteria 4172
420 Ga0207676_10030121 3300026095 Bacteria 4070
421 Ga0207676_10042118 3300026095 Bacteria 3511
422 Ga0207676_10044421 3300026095 Bacteria 3428
423 Ga0207676_10053485 3300026095 Bacteria 3161
424 Ga0207676_10141926 3300026095 Unclassified 2057
425 Ga0207676_10216741 3300026095 Bacteria 1702
426 Ga0207674_10139092 3300026116 Unclassified 2389
427 Ga0207674_10179556 3300026116 Unclassified 2068
428 Ga0207675_100000628 3300026118 Bacteria 34588
429 Ga0207675_100026426 3300026118 Bacteria 5404
430 Ga0207675_100039091 3300026118 Bacteria 4428
431 Ga0207675_100342976 3300026118 Bacteria 1463
432 Ga0207683_10013715 3300026121 Bacteria 6909
433 Ga0207683_10054002 3300026121 Bacteria 3523
434 Ga0207683_10077726 3300026121 Bacteria 2940
435 Ga0207698_10682643 3300026142 Bacteria 1020
436 Ga0209971_1033879 3300027682 Bacteria 1227
437 Ga0209966_1020715 3300027695 Unclassified 1276
438 Ga0209998_10035912 3300027717 Bacteria 1112
439 Ga0207428_10003905 3300027907 Bacteria 14297
440 Ga0207428_10004004 3300027907 Bacteria 14145
441 Ga0207428_10007092 3300027907 Bacteria 10262
442 Ga0207428_10014516 3300027907 Bacteria 6837
443 Ga0207428_10246749 3300027907 Bacteria 1332
444 Ga0268266_10045041 3300028379 Bacteria 3773
445 Ga0268265_10000425 3300028380 Bacteria 45228
446 Ga0268265_10034370 3300028380 Bacteria 3694
447 Ga0268265_10063222 3300028380 Bacteria 2847
448 Ga0268265_10077038 3300028380 Bacteria 2618
449 Ga0268265_10191875 3300028380 Bacteria 1765
450 Ga0268265_10341450 3300028380 Bacteria 1364
451 Ga0268264_10000746 3300028381 Bacteria 36726
452 Ga0268264_10036098 3300028381 Bacteria 4069
453 Ga0307517_10015966 3300028786 Bacteria 9917
454 Ga0307515_10009382 3300028794 Bacteria 18935
455 Ga0307408_100093471 3300031548 Unclassified 2275
456 Ga0307408_100151258 3300031548 Unclassified 1832
457 Ga0307508_10002741 3300031616 Bacteria 18382
458 Ga0307508_10134752 3300031616 Bacteria 2073
459 Ga0265314_10274031 3300031711 Bacteria 958
460 Ga0307516_10002045 3300031730 Bacteria 27493
461 Ga0307516_10004219 3300031730 Bacteria 17894
462 Ga0307516_10037878 3300031730 Bacteria 4817
463 Ga0307405_10005005 3300031731 Bacteria 6334
464 Ga0307405_10018635 3300031731 Bacteria 3835
465 Ga0307405_10183091 3300031731 Bacteria 1506
466 Ga0307413_10017463 3300031824 Bacteria 3737
467 Ga0307413_10035863 3300031824 Bacteria 2850
468 Ga0307410_10051042 3300031852 Bacteria 2785
469 Ga0307410_10061912 3300031852 Bacteria 2562
470 Ga0307406_10075311 3300031901 Bacteria 2226
471 Ga0307412_10026642 3300031911 Bacteria 3596
472 Ga0307412_10031786 3300031911 Bacteria 3337
473 Ga0307412_10147884 3300031911 Unclassified 1729
474 Ga0307409_100012815 3300031995 Bacteria 5361
475 Ga0307409_100015493 3300031995 Bacteria 5006
476 Ga0307409_100043671 3300031995 Bacteria 3368
477 Ga0307409_100134332 3300031995 Bacteria 2120
478 Ga0307416_100015216 3300032002 Bacteria 5304
479 Ga0307416_100061658 3300032002 Bacteria 3062
480 Ga0307416_100126757 3300032002 Bacteria 2288
481 Ga0307416_100258053 3300032002 Bacteria 1701
482 Ga0307416_100746985 3300032002 Unclassified 1071
483 Ga0307416_100918961 3300032002 Bacteria 976
484 Ga0307414_10208595 3300032004 Bacteria 1595
485 Ga0307411_10011744 3300032005 Bacteria 4744
486 Ga0307411_10026184 3300032005 Bacteria 3508
487 Ga0307411_10028821 3300032005 Bacteria 3381
488 Ga0307411_10191523 3300032005 Bacteria 1562
489 Ga0307411_10481893 3300032005 Unclassified 1045
490 Ga0307415_100031652 3300032126 Bacteria 3411
491 Ga0307415_100072539 3300032126 Bacteria 2425
492 Ga0307415_100131612 3300032126 Unclassified 1895
493 Ga0373951_0047965 3300035091 Bacteria 1045
494 Ga0373936_0000036 3300035113 Bacteria 99616
495 Ga0373936_0000064 3300035113 Bacteria 50371
496 Ga0373939_0016433 3300035114 Unclassified 1952
497 Ga0373941_0037773 3300035115 Unclassified 1475
498 Ga0373935_0299794 3300035692 Bacteria 1136
499 Ga0373937_0014852 3300036401 Bacteria 6878
500 Ga0436365_1793482 3300039437 Bacteria 1419
501 Ga0439453_0006598 3300041408 Unclassified 1813
502 Ga0451791_0012197 3300041451 Bacteria 857
503 Ga0451791_1866726 3300041451 Bacteria 1117
504 Ga0451807_1118018 3300041486 Bacteria 1202
505 Ga0439450_007421 3300042008 Bacteria 2009
506 Ga0439446_0084085 3300042156 Bacteria 989
507 Ga0439435_0002012 3300042436 Bacteria 3929
508 Ga0450916_003720 3300042530 Bacteria 1688
509 Ga0439440_0038568 3300042993 Bacteria 1157
510 Ga0453683_0001104 3300044673 Bacteria 24685
511 Ga0453683_0039187 3300044673 Bacteria 2978
512 Ga0453684_0006056 3300044712 Bacteria 23371
513 Ga0453684_0017059 3300044712 Bacteria 11273
514 Ga0466959_0009400 3300045049 Bacteria 6952
515 Ga0451576_0002417 3300045051 Bacteria 27989
516 Ga0451576_0059529 3300045051 Bacteria 3986
517 Ga0451576_0069339 3300045051 Unclassified 3669
518 Ga0451576_0099942 3300045051 Bacteria 3017
519 Ga0451576_0118793 3300045051 Unclassified 2752
520 Ga0495603_0017508 3300046455 Bacteria 4336
521 Ga0495629_0002074 3300046459 Bacteria 15546
522 Ga0495594_0101920 3300046499 Bacteria 1615
523 Ga0495643_0012415 3300046522 Bacteria 5140
524 Ga0495598_0026529 3300046537 Bacteria 1589
525 Ga0495598_0054286 3300046537 Bacteria 1216
526 Ga0495598_0069710 3300046537 Bacteria 1104
527 Ga0495621_0003214 3300046539 Bacteria 4487
528 Ga0495621_0005564 3300046539 Bacteria 3629
529 Ga0495621_0013800 3300046539 Bacteria 2545
530 Ga0495621_0098403 3300046539 Bacteria 1110
531 Ga0495633_0246675 3300046558 Bacteria 815
532 Ga0495659_0013805 3300046664 Bacteria 2635
533 Ga0495659_0018139 3300046664 Bacteria 2341
534 Ga0495659_0030479 3300046664 Bacteria 1878
535 Ga0495588_0052341 3300046674 Bacteria 2104
536 Ga0495658_0008605 3300046683 Bacteria 5063
537 Ga0495669_0094042 3300046684 Unclassified 1387
538 Ga0495613_0079977 3300046689 Bacteria 2377
539 Ga0495670_0096221 3300046691 Bacteria 1520
540 Ga0495670_0291329 3300046691 Bacteria 874
541 Ga0495636_0001278 3300047318 Bacteria 9533
542 Ga0495636_0130170 3300047318 Bacteria 1119
543 Ga0495685_013926 3300047447 Bacteria 2729
544 Ga0495684_0474632 3300047471 Unclassified 865
545 Ga0495615_0003295 3300048090 Bacteria 2686
546 Ga0496105_0092232 3300048908 Bacteria 2501
547 Ga0496106_0118405 3300048909 Bacteria 2068
548 Ga0496109_0205593 3300048912 Unclassified 1851
549 Ga0496112_0454115 3300048915 Bacteria 1219
550 Ga0496113_0090201 3300048916 Bacteria 2361
551 Ga0496113_0139997 3300048916 Bacteria 1903
552 Ga0496113_0388132 3300048916 Bacteria 1121
553 Ga0501297_002914 3300049520 Unclassified 1681
554 Ga0501034_0223420 3300049571 Bacteria 1835
555 Ga0501039_0076626 3300049575 Bacteria 2600
556 Ga0501041_0034070 3300049577 Bacteria 3083
557 Ga0501041_0062865 3300049577 Bacteria 2274
558 Ga0501042_0031610 3300049578 Bacteria 3745
559 Ga0501043_0259112 3300049579 Bacteria 1338
560 Ga0501068_0202562 3300049584 Bacteria 1259
561 Ga0501070_0382803 3300049586 Bacteria 1139
562 Ga0501075_0042092 3300049591 Unclassified 3424
563 Ga0501076_0024231 3300049592 Bacteria 4688
564 Ga0501076_0042225 3300049592 Unclassified 3590
565 Ga0501217_003300 3300049661 Bacteria 3251
566 Ga0501253_028909 3300049683 Bacteria 1042
567 Ga0501080_0100982 3300049742 Bacteria 2676
568 Ga0501080_0246221 3300049742 Bacteria 1630
569 Ga0501081_0318984 3300049743 Bacteria 1142
570 Ga0501035_0289324 3300049822 Bacteria 1383
571 nmdc:mga06z11_54097_c1 3300050494 Bacteria 2068
572 nmdc:mga04h51_42251_c1 3300050495 Bacteria 1494
573 nmdc:mga07m45_31334_c1 3300050496 Bacteria 2947
574 nmdc:mga05p37_127461_c1 3300050507 Bacteria 3125
575 nmdc:mga05p37_24393_c1 3300050507 Bacteria 7349
576 nmdc:mga05p37_270928_c1 3300050507 Bacteria 2028
577 nmdc:mga05p37_28158_c1 3300050507 Bacteria 6849
578 nmdc:mga05p37_284794_c1 3300050507 Bacteria 1969
579 nmdc:mga05p37_4750_c1 3300050507 Bacteria 15875
580 nmdc:mga05p37_816431_c1 3300050507 Bacteria 1018
581 nmdc:mga05p37_90546_c1 3300050507 Bacteria 3770
582 nmdc:mga09592_15338_c1 3300050508 Bacteria 6257
583 nmdc:mga09592_165197_c1 3300050508 Unclassified 1913
584 nmdc:mga09592_20065_c1 3300050508 Bacteria 5492
585 nmdc:mga09592_2427_c1 3300050508 Bacteria 15033
586 nmdc:mga09592_292404_c1 3300050508 Unclassified 1412
587 nmdc:mga09592_306593_c1 3300050508 Bacteria 1376
588 nmdc:mga09592_3600_c1 3300050508 Bacteria 12504
589 nmdc:mga09592_77348_c1 3300050508 Bacteria 2830
590 nmdc:mga09592_95214_c1 3300050508 Bacteria 2547
591 nmdc:mga0qj67_120626_c1 3300050509 Bacteria 2121
592 nmdc:mga0qj67_13473_c1 3300050509 Bacteria 6166
593 nmdc:mga0qj67_159605_c1 3300050509 Bacteria 1830
594 nmdc:mga0qj67_19760_c1 3300050509 Bacteria 5151
595 nmdc:mga0qj67_24261_c1 3300050509 Bacteria 4674
596 nmdc:mga0qj67_300088_c1 3300050509 Bacteria 1301
597 nmdc:mga0qj67_51895_c1 3300050509 Bacteria 3244
598 nmdc:mga0qj67_8228_c1 3300050509 Bacteria 7731
599 nmdc:mga06r32_18386_c1 3300050510 Bacteria 6399
600 nmdc:mga06r32_188526_c1 3300050510 Bacteria 2050
601 nmdc:mga06r32_49803_c1 3300050510 Bacteria 4007
602 nmdc:mga08y16_13388_c1 3300050511 Bacteria 8629
603 nmdc:mga08y16_13527_c1 3300050511 Bacteria 8587
604 nmdc:mga08y16_212_c1 3300050511 Bacteria 52087
605 nmdc:mga08y16_4134_c1 3300050511 Bacteria 15148
606 nmdc:mga08y16_56210_c1 3300050511 Bacteria 4113
607 nmdc:mga08y16_8951_c1 3300050511 Bacteria 10514
608 nmdc:mga0n895_1241_c1 3300050512 Bacteria 18808
609 nmdc:mga0n895_136402_c1 3300050512 Bacteria 2480
610 nmdc:mga0n895_30593_c1 3300050512 Bacteria 5147
611 nmdc:mga0n895_76093_c1 3300050512 Bacteria 3338
612 nmdc:mga0rr50_2828_c1 3300050513 Bacteria 9869
613 nmdc:mga0rr50_34181_c1 3300050513 Bacteria 3639
614 nmdc:mga0rr50_37519_c1 3300050513 Unclassified 3499
615 nmdc:mga0a205_1267_c2 3300050515 Bacteria 12352
616 nmdc:mga0a205_325661_c1 3300050515 Bacteria 1407
617 nmdc:mga0a205_5420_c1 3300050515 Bacteria 11503
618 nmdc:mga0a205_62087_c1 3300050515 Unclassified 3610
619 nmdc:mga0a205_850_c1 3300050515 Bacteria 25026
620 nmdc:mga0a205_8785_c1 3300050515 Bacteria 9206
621 Ga0500635_0013158 3300053080 Bacteria 2397
622 Ga0495619_0329083 3300053085 Bacteria 1058
623 Ga0500647_0029687 3300053091 Bacteria 2595
624 Ga0500651_0239353 3300053093 Bacteria 1059
625 Ga0500566_0016930 3300053094 Bacteria 4280
626 Ga0500640_000390 3300053095 Bacteria 10466
627 Ga0500654_104459 3300053099 Bacteria 1191
628 Ga0500554_000138 3300053102 Bacteria 14765
629 Ga0500572_031456 3300053111 Bacteria 1483
630 Ga0500595_000239 3300053119 Bacteria 37131
631 Ga0500607_040231 3300053121 Bacteria 2535
632 Ga0500614_001371 3300053123 Bacteria 5870
633 Ga0500559_0015579 3300053136 Bacteria 3210
634 Ga0500622_0031183 3300053156 Bacteria 2797
635 Ga0500601_005667 3300053737 Bacteria 1371
636 Ga0501084_0055198 3300054114 Bacteria 3324
637 Ga0501084_0188441 3300054114 Bacteria 1741
638 Ga0590071_004426 3300059421 Bacteria 3412
639 Ga0590071_013055 3300059421 Unclassified 1946
640 Ga0590075_000298 3300059424 Bacteria 13972
641 Ga0590075_000401 3300059424 Bacteria 11865
642 Ga0590077_000654 3300059426 Bacteria 9215
643 Ga0590077_001505 3300059426 Bacteria 5408
644 Ga0501082_0117072 3300060353 Bacteria 2308
645 Ga0501082_0469234 3300060353 Bacteria 1100
646 Ga0530510_0002014 3300061734 Bacteria 13943
647 Ga0530510_0212103 3300061734 Bacteria 1439
648 Ga0451839_0643251
649 JGI24749J21850_1020852
650 JGI25406J46586_10000235
651 JGI25406J46586_10064113
652 Ga0065714_10135118
653 Ga0065712_10067865
654 Ga0065712_10107489
655 Ga0065715_10107907
656 Ga0065715_10123608
657 Ga0065707_10003223
658 Ga0065707_10131964
659 Ga0070658_10255184
660 Ga0070676_10003293
661 Ga0070676_10038292
662 Ga0070676_10302780
663 Ga0070690_100007181
664 Ga0070690_100018154
665 Ga0070690_100053632
666 Ga0070690_100112843
667 Ga0070670_100003801
668 Ga0070670_100021404
669 Ga0070670_100075879
670 Ga0070670_100158493
671 Ga0070670_100264234
672 Ga0070677_10011656
673 Ga0070677_10028514
674 Ga0070677_10038554
675 Ga0068869_100011020
676 Ga0068869_100041469
677 Ga0070666_10014378
678 Ga0070666_10040292
679 Ga0070666_10049607
680 Ga0070666_10228383
681 Ga0070682_100480853
682 Ga0068868_100053897
683 Ga0070660_100697262
684 Ga0070689_100011819
685 Ga0070689_100014676
686 Ga0070689_100025074
687 Ga0070689_100073827
688 Ga0070689_100111910
689 Ga0070689_100344795
690 Ga0070691_10010237
691 Ga0070691_10035610
692 Ga0070691_10225709
693 Ga0070687_100010127
694 Ga0070687_100021721
695 Ga0070687_100030045
696 Ga0070687_100306827
697 Ga0070661_100009654
698 Ga0070661_100074836
699 Ga0070661_100127838
700 Ga0070692_10136137
701 Ga0070668_100026305
702 Ga0070668_100092311
703 Ga0070669_100000905
704 Ga0070669_100010357
705 Ga0070669_100039266
706 Ga0070669_100064742
707 Ga0070669_100088723
708 Ga0070669_100193969
709 Ga0070675_100001573
710 Ga0070675_100049288
711 Ga0070675_100093543
712 Ga0070675_100132071
713 Ga0070675_100212958
714 Ga0070675_100328365
715 Ga0070671_100009508
716 Ga0070671_100167693
717 Ga0070671_100237572
718 Ga0070674_100016839
719 Ga0070674_100125900
720 Ga0070673_100001470
721 Ga0070673_100031718
722 Ga0070673_100032836
723 Ga0070673_100216905
724 Ga0070688_100008481
725 Ga0070688_100025611
726 Ga0070688_100031954
727 Ga0070688_100046289
728 Ga0070659_100077747
729 Ga0070659_100572165
730 Ga0070667_100101830
731 Ga0070709_10098498
732 Ga0070713_100009346
733 Ga0070713_100020862
734 Ga0070701_10008429
735 Ga0070701_10165798
736 Ga0070705_100000816
737 Ga0070700_100008109
738 Ga0070700_100011101
739 Ga0070694_100000404
740 Ga0070694_100014795
741 Ga0070694_100088173
742 Ga0070694_100265285
743 Ga0070708_100498315
744 Ga0070663_100016940
745 Ga0070678_100022333
746 Ga0070678_100043497
747 Ga0070678_100189099
748 Ga0070662_100014937
749 Ga0070662_100136216
750 Ga0070662_100212667
751 Ga0070662_100528889
752 Ga0070681_10053173
753 Ga0070681_10101499
754 Ga0068867_100006619
755 Ga0068867_100015567
756 Ga0068867_100217295
757 Ga0068867_100404090
758 Ga0070685_10003719
759 Ga0070685_10325802
760 Ga0070707_100040651
761 Ga0070698_100007242
762 Ga0070698_100088141
763 Ga0070698_100288881
764 Ga0070698_100442020
765 Ga0070699_100005414
766 Ga0070699_100069558
767 Ga0070699_100413221
768 Ga0070684_100176598
769 Ga0070672_100016778
770 Ga0070672_100019594
771 Ga0070672_100023578
772 Ga0070672_100035279
773 Ga0070672_100075089
774 Ga0070672_100310544
775 Ga0070686_100012251
776 Ga0070695_100000418
777 Ga0070695_100090814
778 Ga0070695_100481023
779 Ga0070696_100004573
780 Ga0070696_100020999
781 Ga0070693_100052761
782 Ga0070665_100025018
783 Ga0070704_100023114
784 Ga0070704_100071651
785 Ga0070704_100155753
786 Ga0070664_100001566
787 Ga0070664_100041182
788 Ga0070664_100097008
789 Ga0070664_100195521
790 Ga0070664_100316162
791 Ga0068857_100124339
792 Ga0068854_100120608
793 Ga0070702_100075877
794 Ga0068852_100060494
795 Ga0068859_100003898
796 Ga0068859_100011406
797 Ga0068859_100032048
798 Ga0068859_100061755
799 Ga0068859_100095106
800 Ga0068859_100577661
801 Ga0068864_100040765
802 Ga0068864_100049629
803 Ga0068864_100054915
804 Ga0068864_100065238
805 Ga0068864_100145096
806 Ga0068864_100255567
807 Ga0068864_100877305
808 Ga0068861_100009355
809 Ga0068861_100176847
810 Ga0068861_100299210
811 Ga0068851_10063099
812 Ga0068870_10000837
813 Ga0068870_10112464
814 Ga0068870_10131952
815 Ga0068863_100018471
816 Ga0068863_100060382
817 Ga0068863_100112824
818 Ga0068863_100213429
819 Ga0068858_100155752
820 Ga0068858_100799968
821 Ga0068860_100002415
822 Ga0068860_100042083
823 Ga0068862_100004927
824 Ga0068862_100261164
825 Ga0081455_10080490
826 Ga0081539_10000017
827 Ga0081539_10000358
828 Ga0081539_10023710
829 Ga0070717_10121940
830 Ga0075368_10002367
831 Ga0075364_10007655
832 Ga0070712_100070686
833 Ga0075367_10002227
834 Ga0097621_100174259
835 Ga0097621_100278610
836 Ga0068871_100040027
837 Ga0068871_100113053
838 Ga0068871_100136940
839 Ga0068871_100205984
840 Ga0075428_100000966
841 Ga0075428_100002721
842 Ga0075428_100005539
843 Ga0075428_100019158
844 Ga0075428_100060858
845 Ga0075428_100099177
846 Ga0075428_100107034
847 Ga0075428_100314344
848 Ga0075428_100905044
849 Ga0075430_100003708
850 Ga0075430_100004064
851 Ga0075430_100006719
852 Ga0075430_100027436
853 Ga0075430_100042408
854 Ga0075430_100127584
855 Ga0075431_100000306
856 Ga0075431_100022279
857 Ga0075431_100027107
858 Ga0075433_10000354
859 Ga0075433_10002437
860 Ga0075433_10004762
861 Ga0075433_10052781
862 Ga0075433_10085131
863 Ga0075433_10127221
864 Ga0075433_10181501
865 Ga0075434_100000062
866 Ga0075434_100002738
867 Ga0075434_100006005
868 Ga0075434_100129574
869 Ga0075434_100193910
870 Ga0075429_100002673
871 Ga0075429_100007827
872 Ga0075429_100017702
873 Ga0075429_100055290
874 Ga0075429_100058991
875 Ga0075429_100100515
876 Ga0075429_100101698
877 Ga0075429_100453265
878 Ga0068865_100063195
879 Ga0068865_100119083
880 Ga0068865_100385538
881 Ga0075436_100181382
882 Ga0097620_100003898
883 Ga0097620_100011406
884 Ga0097620_100032049
885 Ga0097620_100061756
886 Ga0097620_100095111
887 Ga0097620_100577664
888 Ga0075435_100004195
889 Ga0075435_100018689
890 Ga0075435_100025593
891 Ga0105240_10847775
892 Ga0111539_10001341
893 Ga0111539_10002443
894 Ga0111539_10007113
895 Ga0111539_10009474
896 Ga0111539_10013448
897 Ga0111539_10016332
898 Ga0111539_10071453
899 Ga0111539_10096193
900 Ga0111539_10116299
901 Ga0111539_10128939
902 Ga0111539_10374579
903 Ga0105245_10056302
904 Ga0114129_10000580
905 Ga0114129_10006836
906 Ga0114129_10016296
907 Ga0114129_10050776
908 Ga0114129_10070454
909 Ga0114129_10073055
910 Ga0114129_10239973
911 Ga0114129_10242226
912 Ga0114129_10251912
913 Ga0114129_10411110
914 Ga0105243_10090164
915 Ga0105243_10112893
916 Ga0105241_10468312
917 Ga0105242_10022919
918 Ga0105242_10080946
919 Ga0105248_10013980
920 Ga0105248_10854275
921 Ga0105249_10005801
922 Ga0105249_10013712
923 Ga0105249_10468906
924 Ga0105239_10071305
925 Ga0105246_10018846
926 Ga0105246_10302111
927 Ga0157378_10084463
928 Ga0163162_10037106
929 Ga0163162_10062015
930 Ga0163162_10200913
931 Ga0157375_10001940
932 Ga0157375_10189983
933 Ga0157375_10480708
934 Ga0163163_10047104
935 Ga0163163_10056186
936 Ga0163163_10058488
937 Ga0157380_10002697
938 Ga0157380_10010493
939 Ga0157380_10103595
940 Ga0157380_10310833
941 Ga0157380_10392347
942 Ga0157380_10706485
943 Ga0157377_10014138
944 Ga0157377_10014930
945 Ga0157377_10117827
946 Ga0157379_10004591
947 Ga0163161_10006329
948 Ga0163161_10078030
949 Ga0207673_1002116
950 Ga0207697_10001409
951 Ga0207697_10030974
952 Ga0207697_10067726
953 Ga0207697_10107416
954 Ga0207682_10030799
955 Ga0207682_10056941
956 Ga0207642_10046192
957 Ga0207688_10001799
958 Ga0207688_10038096
959 Ga0207688_10145843
960 Ga0207688_10177268
961 Ga0207680_10056223
962 Ga0207699_10080153
963 Ga0207645_10001298
964 Ga0207645_10010247
965 Ga0207645_10034281
966 Ga0207645_10044583
967 Ga0207645_10182648
968 Ga0207643_10001468
969 Ga0207643_10002221
970 Ga0207643_10011325
971 Ga0207643_10049737
972 Ga0207705_10172491
973 Ga0207705_10523021
974 Ga0207654_10114176
975 Ga0207693_10096172
976 Ga0207660_10184136
977 Ga0207662_10003068
978 Ga0207662_10005334
979 Ga0207662_10031685
980 Ga0207662_10046500
981 Ga0207657_10317751
982 Ga0207649_10119090
983 Ga0207652_10259171
984 Ga0207646_10046654
985 Ga0207646_10089529
986 Ga0207646_10366388
987 Ga0207646_10839838
988 Ga0207681_10005201
989 Ga0207681_10041867
990 Ga0207681_10058753
991 Ga0207681_10137337
992 Ga0207681_10171419
993 Ga0207650_10238721
994 Ga0207650_10345859
995 Ga0207650_10347012
996 Ga0207659_10000671
997 Ga0207659_10016105
998 Ga0207659_10043231
999 Ga0207659_10104339
1000 Ga0207700_10046898
1001 Ga0207700_10202703
1002 Ga0207644_10008511
1003 Ga0207644_10046912
1004 Ga0207690_10099864
1005 Ga0207706_10008539
1006 Ga0207706_10078134
1007 Ga0207706_10079853
1008 Ga0207706_10086281
1009 Ga0207706_10531524
1010 Ga0207709_10027215
1011 Ga0207709_10051262
1012 Ga0207670_10006290
1013 Ga0207670_10047711
1014 Ga0207670_10178092
1015 Ga0207670_10180164
1016 Ga0207669_10002217
1017 Ga0207669_10088120
1018 Ga0207704_10014123
1019 Ga0207704_10091243
1020 Ga0207704_10133069
1021 Ga0207691_10002728
1022 Ga0207691_10010512
1023 Ga0207691_10133149
1024 Ga0207691_10187560
1025 Ga0207691_10198704
1026 Ga0207691_10219284
1027 Ga0207691_10355617
1028 Ga0207711_10012331
1029 Ga0207711_10069404
1030 Ga0207689_10003595
1031 Ga0207689_10020548
1032 Ga0207689_10093189
1033 Ga0207689_10164158
1034 Ga0207661_10003048
1035 Ga0207661_10169332
1036 Ga0207679_10001960
1037 Ga0207679_10023240
1038 Ga0207679_10123299
1039 Ga0207651_10020824
1040 Ga0207651_10075364
1041 Ga0207651_10108550
1042 Ga0207651_10499370
1043 Ga0207712_10008832
1044 Ga0207712_10093888
1045 Ga0207712_10378272
1046 Ga0207712_10451087
1047 Ga0207668_10058106
1048 Ga0207668_10102744
1049 Ga0207640_10008838
1050 Ga0207658_10007310
1051 Ga0207703_10025856
1052 Ga0207703_10163239
1053 Ga0207703_10503882
1054 Ga0207678_10027579
1055 Ga0207678_10335868
1056 Ga0207708_10028934
1057 Ga0207708_10080573
1058 Ga0207708_10171833
1059 Ga0207708_10222286
1060 Ga0207641_10024047
1061 Ga0207641_10151514
1062 Ga0207641_10155872
1063 Ga0207641_10228853
1064 Ga0207648_10001387
1065 Ga0207648_10006172
1066 Ga0207676_10028495
1067 Ga0207676_10030121
1068 Ga0207676_10042118
1069 Ga0207676_10044421
1070 Ga0207676_10053485
1071 Ga0207676_10141926
1072 Ga0207676_10216741
1073 Ga0207674_10139092
1074 Ga0207674_10179556
1075 Ga0207675_100000628
1076 Ga0207675_100026426
1077 Ga0207675_100039091
1078 Ga0207675_100342976
1079 Ga0207683_10013715
1080 Ga0207683_10054002
1081 Ga0207683_10077726
1082 Ga0207698_10682643
1083 Ga0209971_1033879
1084 Ga0209966_1020715
1085 Ga0209998_10035912
1086 Ga0207428_10003905
1087 Ga0207428_10004004
1088 Ga0207428_10007092
1089 Ga0207428_10014516
1090 Ga0207428_10246749
1091 Ga0268266_10045041
1092 Ga0268265_10000425
1093 Ga0268265_10034370
1094 Ga0268265_10063222
1095 Ga0268265_10077038
1096 Ga0268265_10191875
1097 Ga0268265_10341450
1098 Ga0268264_10000746
1099 Ga0268264_10036098
1100 Ga0307517_10015966
1101 Ga0307515_10009382
1102 Ga0307408_100093471
1103 Ga0307408_100151258
1104 Ga0307508_10002741
1105 Ga0307508_10134752
1106 Ga0265314_10274031
1107 Ga0307516_10002045
1108 Ga0307516_10004219
1109 Ga0307516_10037878
1110 Ga0307405_10005005
1111 Ga0307405_10018635
1112 Ga0307405_10183091
1113 Ga0307413_10017463
1114 Ga0307413_10035863
1115 Ga0307410_10051042
1116 Ga0307410_10061912
1117 Ga0307406_10075311
1118 Ga0307412_10026642
1119 Ga0307412_10031786
1120 Ga0307412_10147884
1121 Ga0307409_100012815
1122 Ga0307409_100015493
1123 Ga0307409_100043671
1124 Ga0307409_100134332
1125 Ga0307416_100015216
1126 Ga0307416_100061658
1127 Ga0307416_100126757
1128 Ga0307416_100258053
1129 Ga0307416_100746985
1130 Ga0307416_100918961
1131 Ga0307414_10208595
1132 Ga0307411_10011744
1133 Ga0307411_10026184
1134 Ga0307411_10028821
1135 Ga0307411_10191523
1136 Ga0307411_10481893
1137 Ga0307415_100031652
1138 Ga0307415_100072539
1139 Ga0307415_100131612
1140 Ga0373951_0047965
1141 Ga0373936_0000036
1142 Ga0373936_0000064
1143 Ga0373939_0016433
1144 Ga0373941_0037773
1145 Ga0373935_0299794
1146 Ga0373937_0014852
1147 Ga0436365_1793482
1148 Ga0439453_0006598
1149 Ga0451791_0012197
1150 Ga0451791_1866726
1151 Ga0451807_1118018
1152 Ga0439450_007421
1153 Ga0439446_0084085
1154 Ga0439435_0002012
1155 Ga0450916_003720
1156 Ga0439440_0038568
1157 Ga0453683_0001104
1158 Ga0453683_0039187
1159 Ga0453684_0006056
1160 Ga0453684_0017059
1161 Ga0466959_0009400
1162 Ga0451576_0002417
1163 Ga0451576_0059529
1164 Ga0451576_0069339
1165 Ga0451576_0099942
1166 Ga0451576_0118793
1167 Ga0495603_0017508
1168 Ga0495629_0002074
1169 Ga0495594_0101920
1170 Ga0495643_0012415
1171 Ga0495598_0026529
1172 Ga0495598_0054286
1173 Ga0495598_0069710
1174 Ga0495621_0003214
1175 Ga0495621_0005564
1176 Ga0495621_0013800
1177 Ga0495621_0098403
1178 Ga0495633_0246675
1179 Ga0495659_0013805
1180 Ga0495659_0018139
1181 Ga0495659_0030479
1182 Ga0495588_0052341
1183 Ga0495658_0008605
1184 Ga0495669_0094042
1185 Ga0495613_0079977
1186 Ga0495670_0096221
1187 Ga0495670_0291329
1188 Ga0495636_0001278
1189 Ga0495636_0130170
1190 Ga0495685_013926
1191 Ga0495684_0474632
1192 Ga0495615_0003295
1193 Ga0496105_0092232
1194 Ga0496106_0118405
1195 Ga0496109_0205593
1196 Ga0496112_0454115
1197 Ga0496113_0090201
1198 Ga0496113_0139997
1199 Ga0496113_0388132
1200 Ga0501297_002914
1201 Ga0501034_0223420
1202 Ga0501039_0076626
1203 Ga0501041_0034070
1204 Ga0501041_0062865
1205 Ga0501042_0031610
1206 Ga0501043_0259112
1207 Ga0501068_0202562
1208 Ga0501070_0382803
1209 Ga0501075_0042092
1210 Ga0501076_0024231
1211 Ga0501076_0042225
1212 Ga0501217_003300
1213 Ga0501253_028909
1214 Ga0501080_0100982
1215 Ga0501080_0246221
1216 Ga0501081_0318984
1217 Ga0501035_0289324
1218 nmdc:mga06z11_54097_c1
1219 nmdc:mga04h51_42251_c1
1220 nmdc:mga07m45_31334_c1
1221 nmdc:mga05p37_127461_c1
1222 nmdc:mga05p37_24393_c1
1223 nmdc:mga05p37_270928_c1
1224 nmdc:mga05p37_28158_c1
1225 nmdc:mga05p37_284794_c1
1226 nmdc:mga05p37_4750_c1
1227 nmdc:mga05p37_816431_c1
1228 nmdc:mga05p37_90546_c1
1229 nmdc:mga09592_15338_c1
1230 nmdc:mga09592_165197_c1
1231 nmdc:mga09592_20065_c1
1232 nmdc:mga09592_2427_c1
1233 nmdc:mga09592_292404_c1
1234 nmdc:mga09592_306593_c1
1235 nmdc:mga09592_3600_c1
1236 nmdc:mga09592_77348_c1
1237 nmdc:mga09592_95214_c1
1238 nmdc:mga0qj67_120626_c1
1239 nmdc:mga0qj67_13473_c1
1240 nmdc:mga0qj67_159605_c1
1241 nmdc:mga0qj67_19760_c1
1242 nmdc:mga0qj67_24261_c1
1243 nmdc:mga0qj67_300088_c1
1244 nmdc:mga0qj67_51895_c1
1245 nmdc:mga0qj67_8228_c1
1246 nmdc:mga06r32_18386_c1
1247 nmdc:mga06r32_188526_c1
1248 nmdc:mga06r32_49803_c1
1249 nmdc:mga08y16_13388_c1
1250 nmdc:mga08y16_13527_c1
1251 nmdc:mga08y16_212_c1
1252 nmdc:mga08y16_4134_c1
1253 nmdc:mga08y16_56210_c1
1254 nmdc:mga08y16_8951_c1
1255 nmdc:mga0n895_1241_c1
1256 nmdc:mga0n895_136402_c1
1257 nmdc:mga0n895_30593_c1
1258 nmdc:mga0n895_76093_c1
1259 nmdc:mga0rr50_2828_c1
1260 nmdc:mga0rr50_34181_c1
1261 nmdc:mga0rr50_37519_c1
1262 nmdc:mga0a205_1267_c2
1263 nmdc:mga0a205_325661_c1
1264 nmdc:mga0a205_5420_c1
1265 nmdc:mga0a205_62087_c1
1266 nmdc:mga0a205_850_c1
1267 nmdc:mga0a205_8785_c1
1268 Ga0500635_0013158
1269 Ga0495619_0329083
1270 Ga0500647_0029687
1271 Ga0500651_0239353
1272 Ga0500566_0016930
1273 Ga0500640_000390
1274 Ga0500654_104459
1275 Ga0500554_000138
1276 Ga0500572_031456
1277 Ga0500595_000239
1278 Ga0500607_040231
1279 Ga0500614_001371
1280 Ga0500559_0015579
1281 Ga0500622_0031183
1282 Ga0500601_005667
1283 Ga0501084_0055198
1284 Ga0501084_0188441
1285 Ga0590071_004426
1286 Ga0590071_013055
1287 Ga0590075_000298
1288 Ga0590075_000401
1289 Ga0590077_000654
1290 Ga0590077_001505
1291 Ga0501082_0117072
1292 Ga0501082_0469234
1293 Ga0530510_0002014
1294 Ga0530510_0212103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01555

N6_N4_Mtase

DNA methylase

147

224

0.91

PF01555

N6_N4_Mtase

DNA methylase

26

156

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hek-assembly3.cif.gz_B crystal structure of m1.hpyavi 0.8375 8 223
5hfj-assembly3.cif.gz_H crystal structure of m1.hpyavi-sam complex 0.8248 8 223
5hek-assembly3.cif.gz_B crystal structure of m1.hpyavi 0.8206 8 223
5hek-assembly3.cif.gz_D crystal structure of m1.hpyavi 0.8203 8 224
5hfj-assembly3.cif.gz_D crystal structure of m1.hpyavi-sam complex 0.8132 8 223
ID Description Score Start End Superfamily
af_Q58120_177_350_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9006 162 226 3.40.50.150
3b1cA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8315 168 209 3.40.640.10
5hekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8203 8 224 3.40.50.150
5hekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8072 8 224 3.40.50.150
af_Q8IDQ7_255_493_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8008 161 212 3.40.50.150
ID Description Score Start End GO Terms
AF-T0ZWM5-F1-model_v4 DNA methylase N-4/N-6 domain protein 0.9581 85 226 GO:0003677
GO:0005737
GO:0008170
GO:0009307
GO:0032259
AF-A0A7V9L6B3-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9556 108 228 GO:0003677
GO:0008170
GO:0032259
AF-A0A850QQ94-F1-model_v4 Site-specific DNA-methyltransferase 0.9546 109 225 GO:0003677
GO:0005737
GO:0008170
GO:0032259
AF-A0A521F783-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9402 70 223 GO:0003677
GO:0005737
GO:0008170
GO:0009007
GO:0009307
GO:0032259
AF-A0A850QQ94-F1-model_v4 Site-specific DNA-methyltransferase 0.9313 109 225 GO:0003677
GO:0005737
GO:0008170
GO:0032259

Map