F472208

General Info

Members Datasets Scaffolds Average Seq Length
646 275 1292 139

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0860353|Ga0373937_0860353_70_570
Length 166
Sequence MTIDNFTAIYPIPLRAFGLRRMTPDDIIAAMERTFAIIKPDAVRARHTGQILSKIEESGFSVRALRLVHLTKHEAEGFYHVHRERPFFASLTAFMSSGPCVVMALEAPDAIKKWRALMGATDPAKADHGTLRKEFGTSIEFNATHGSDAAETAAFELGYFFRGMEL

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
193 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
194 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
195 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
196 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
197 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 4.02
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 3.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0860353 3300036401 Bacteria 855
2 Ga0065714_10026109 3300005288 Bacteria 1093
3 Ga0065712_10001052 3300005290 Bacteria 13561
4 Ga0065712_10004524 3300005290 Bacteria 3741
5 Ga0065712_10083311 3300005290 Bacteria 2847
6 Ga0065712_10424601 3300005290 Bacteria 694
7 Ga0065712_10515239 3300005290 Bacteria 639
8 Ga0065715_10000269 3300005293 Bacteria 20304
9 Ga0065715_10169718 3300005293 Bacteria 1557
10 Ga0065715_10411251 3300005293 Bacteria 869
11 Ga0065707_10143310 3300005295 Bacteria 1744
12 Ga0070676_10215752 3300005328 Bacteria 1265
13 Ga0070683_100000500 3300005329 Bacteria 27695
14 Ga0070690_100147974 3300005330 Bacteria 1600
15 Ga0070690_100173884 3300005330 Bacteria 1484
16 Ga0070690_101357601 3300005330 Bacteria 571
17 Ga0070670_100009228 3300005331 Bacteria 8427
18 Ga0070670_100360700 3300005331 Bacteria 1278
19 Ga0070670_100509403 3300005331 Bacteria 1071
20 Ga0070670_100839677 3300005331 Bacteria 831
21 Ga0070677_10738136 3300005333 Bacteria 557
22 Ga0068869_100059330 3300005334 Bacteria 2801
23 Ga0068869_100152520 3300005334 Bacteria 1793
24 Ga0068869_100176264 3300005334 Bacteria 1673
25 Ga0068869_100253732 3300005334 Bacteria 1406
26 Ga0068869_100926798 3300005334 Bacteria 755
27 Ga0070666_10177494 3300005335 Bacteria 1493
28 Ga0070666_10311596 3300005335 Unclassified 1122
29 Ga0070666_10561648 3300005335 Bacteria 831
30 Ga0070666_10712641 3300005335 Bacteria 736
31 Ga0070680_100210315 3300005336 Bacteria 1641
32 Ga0068868_100168087 3300005338 Bacteria 1815
33 Ga0070689_100013117 3300005340 Bacteria 5989
34 Ga0070689_100344426 3300005340 Bacteria 1249
35 Ga0070689_100795568 3300005340 Bacteria 831
36 Ga0070689_101965170 3300005340 Bacteria 535
37 Ga0070687_100107290 3300005343 Bacteria 1574
38 Ga0070661_100031574 3300005344 Bacteria 3831
39 Ga0070692_10018721 3300005345 Bacteria 3334
40 Ga0070692_10376888 3300005345 Bacteria 889
41 Ga0070669_100304557 3300005353 Bacteria 1283
42 Ga0070669_100663644 3300005353 Bacteria 878
43 Ga0070669_100971542 3300005353 Bacteria 728
44 Ga0070675_100019150 3300005354 Bacteria 5453
45 Ga0070675_100046131 3300005354 Bacteria 3568
46 Ga0070675_100292376 3300005354 Bacteria 1434
47 Ga0070675_100396405 3300005354 Bacteria 1231
48 Ga0070674_100427874 3300005356 Bacteria 1088
49 Ga0070673_100269312 3300005364 Bacteria 1490
50 Ga0070673_100645275 3300005364 Bacteria 969
51 Ga0070673_101153528 3300005364 Bacteria 725
52 Ga0070688_100050483 3300005365 Bacteria 2591
53 Ga0070688_100053636 3300005365 Bacteria 2523
54 Ga0070688_100072787 3300005365 Bacteria 2203
55 Ga0070688_100506877 3300005365 Bacteria 911
56 Ga0070688_100562929 3300005365 Bacteria 868
57 Ga0070659_100118976 3300005366 Bacteria 2138
58 Ga0070667_100085317 3300005367 Bacteria 2708
59 Ga0070667_100554323 3300005367 Bacteria 1057
60 Ga0070667_101830713 3300005367 Bacteria 571
61 Ga0070703_10013281 3300005406 Bacteria 2338
62 Ga0070709_10437356 3300005434 Bacteria 983
63 Ga0070713_100432774 3300005436 Bacteria 1233
64 Ga0070701_10077049 3300005438 Bacteria 1796
65 Ga0070701_10140214 3300005438 Bacteria 1382
66 Ga0070701_10371069 3300005438 Bacteria 899
67 Ga0070705_100041193 3300005440 Bacteria 2632
68 Ga0070705_100102927 3300005440 Bacteria 1807
69 Ga0070705_100614446 3300005440 Bacteria 843
70 Ga0070705_101383993 3300005440 Unclassified 586
71 Ga0070700_100041113 3300005441 Bacteria 2833
72 Ga0070700_100735097 3300005441 Bacteria 788
73 Ga0070700_101661842 3300005441 Bacteria 547
74 Ga0070694_100233309 3300005444 Bacteria 1385
75 Ga0070694_100330345 3300005444 Bacteria 1176
76 Ga0070694_100534737 3300005444 Bacteria 937
77 Ga0070694_100568358 3300005444 Bacteria 910
78 Ga0070694_100596762 3300005444 Bacteria 889
79 Ga0070708_100066078 3300005445 Bacteria 3245
80 Ga0070708_100140943 3300005445 Bacteria 2235
81 Ga0070708_100186581 3300005445 Bacteria 1939
82 Ga0070708_100328668 3300005445 Bacteria 1440
83 Ga0070708_100395693 3300005445 Bacteria 1303
84 Ga0070708_101705068 3300005445 Bacteria 586
85 Ga0070678_100078658 3300005456 Bacteria 2492
86 Ga0070678_100344258 3300005456 Bacteria 1280
87 Ga0070662_100510524 3300005457 Bacteria 1003
88 Ga0070662_101047292 3300005457 Unclassified 699
89 Ga0070681_10073791 3300005458 Bacteria 3374
90 Ga0068867_100057195 3300005459 Bacteria 2888
91 Ga0068867_100231898 3300005459 Bacteria 1493
92 Ga0068867_100241385 3300005459 Bacteria 1465
93 Ga0068867_100333307 3300005459 Bacteria 1261
94 Ga0070685_10160416 3300005466 Bacteria 1433
95 Ga0070685_10402498 3300005466 Bacteria 948
96 Ga0070706_100012846 3300005467 Bacteria 7752
97 Ga0070706_100016961 3300005467 Bacteria 6728
98 Ga0070706_100402618 3300005467 Bacteria 1274
99 Ga0070706_100494739 3300005467 Bacteria 1138
100 Ga0070706_100640486 3300005467 Bacteria 987
101 Ga0070706_100702988 3300005467 Bacteria 937
102 Ga0070706_100916946 3300005467 Bacteria 809
103 Ga0070706_101471835 3300005467 Bacteria 623
104 Ga0070707_100001291 3300005468 Bacteria 24645
105 Ga0070707_101076306 3300005468 Bacteria 770
106 Ga0070707_101428490 3300005468 Bacteria 658
107 Ga0070707_101703536 3300005468 Bacteria 597
108 Ga0070707_101728082 3300005468 Bacteria 593
109 Ga0070707_102056142 3300005468 Bacteria 539
110 Ga0070698_100015442 3300005471 Bacteria 8068
111 Ga0070698_100046510 3300005471 Bacteria 4437
112 Ga0070698_100317007 3300005471 Bacteria 1490
113 Ga0070698_100749670 3300005471 Bacteria 919
114 Ga0070698_101368659 3300005471 Unclassified 658
115 Ga0070699_100005090 3300005518 Bacteria 11570
116 Ga0070699_100128299 3300005518 Bacteria 2235
117 Ga0070699_100541926 3300005518 Bacteria 1059
118 Ga0070699_101344369 3300005518 Unclassified 655
119 Ga0070679_100725108 3300005530 Bacteria 937
120 Ga0070684_100001365 3300005535 Bacteria 17516
121 Ga0070684_100108795 3300005535 Bacteria 2484
122 Ga0070697_100004461 3300005536 Bacteria 10759
123 Ga0070697_100097789 3300005536 Bacteria 2436
124 Ga0070697_100431632 3300005536 Bacteria 1146
125 Ga0068853_100524994 3300005539 Bacteria 1119
126 Ga0068853_100981861 3300005539 Bacteria 813
127 Ga0070672_100075633 3300005543 Bacteria 2689
128 Ga0070672_100139502 3300005543 Bacteria 1998
129 Ga0070672_100279250 3300005543 Bacteria 1412
130 Ga0070686_100224880 3300005544 Bacteria 1358
131 Ga0070686_100328889 3300005544 Bacteria 1142
132 Ga0070695_100010735 3300005545 Bacteria 5473
133 Ga0070695_100246201 3300005545 Bacteria 1299
134 Ga0070695_100438200 3300005545 Unclassified 998
135 Ga0070696_100020384 3300005546 Bacteria 4495
136 Ga0070696_100142699 3300005546 Bacteria 1752
137 Ga0070696_100940007 3300005546 Unclassified 719
138 Ga0070696_101169660 3300005546 Bacteria 649
139 Ga0070693_101422264 3300005547 Bacteria 540
140 Ga0070665_100115357 3300005548 Bacteria 2689
141 Ga0070665_100221409 3300005548 Bacteria 1893
142 Ga0070665_100258431 3300005548 Bacteria 1743
143 Ga0070665_100538374 3300005548 Bacteria 1180
144 Ga0070665_101178924 3300005548 Bacteria 777
145 Ga0070704_100021700 3300005549 Bacteria 4168
146 Ga0070704_100043466 3300005549 Bacteria 3115
147 Ga0070704_100064127 3300005549 Bacteria 2639
148 Ga0070704_100513399 3300005549 Bacteria 1042
149 Ga0070704_101002050 3300005549 Unclassified 755
150 Ga0070704_101496460 3300005549 Bacteria 621
151 Ga0070664_100014461 3300005564 Bacteria 6434
152 Ga0070664_100617499 3300005564 Bacteria 1006
153 Ga0068854_100171002 3300005578 Bacteria 1691
154 Ga0070702_100408729 3300005615 Bacteria 973
155 Ga0070702_101703742 3300005615 Bacteria 524
156 Ga0068852_100913975 3300005616 Bacteria 895
157 Ga0068859_100006868 3300005617 Bacteria 11557
158 Ga0068859_100053081 3300005617 Bacteria 4076
159 Ga0068859_100179315 3300005617 Bacteria 2201
160 Ga0068859_100186960 3300005617 Bacteria 2155
161 Ga0068859_101191762 3300005617 Bacteria 839
162 Ga0068864_100023937 3300005618 Bacteria 5132
163 Ga0068864_100261183 3300005618 Bacteria 1611
164 Ga0068864_100723180 3300005618 Bacteria 974
165 Ga0068866_10062776 3300005718 Bacteria 1934
166 Ga0068861_100028741 3300005719 Bacteria 4059
167 Ga0068861_100737539 3300005719 Bacteria 919
168 Ga0068861_101690696 3300005719 Bacteria 626
169 Ga0068870_10947305 3300005840 Bacteria 611
170 Ga0068863_100137798 3300005841 Bacteria 2331
171 Ga0068863_100327559 3300005841 Bacteria 1489
172 Ga0068863_100346457 3300005841 Bacteria 1446
173 Ga0068863_100420046 3300005841 Bacteria 1310
174 Ga0068858_100106695 3300005842 Bacteria 2614
175 Ga0068858_100178153 3300005842 Bacteria 2006
176 Ga0068858_100412050 3300005842 Bacteria 1299
177 Ga0068858_100570145 3300005842 Bacteria 1097
178 Ga0068860_100120521 3300005843 Bacteria 2512
179 Ga0068860_100484169 3300005843 Bacteria 1233
180 Ga0068860_100518963 3300005843 Bacteria 1191
181 Ga0068860_100917921 3300005843 Bacteria 892
182 Ga0068860_101650297 3300005843 Bacteria 663
183 Ga0068860_102032503 3300005843 Bacteria 596
184 Ga0068860_102045636 3300005843 Bacteria 594
185 Ga0068862_100223618 3300005844 Bacteria 1705
186 Ga0068862_100367864 3300005844 Bacteria 1338
187 Ga0068862_100376557 3300005844 Bacteria 1323
188 Ga0068862_100525315 3300005844 Bacteria 1127
189 Ga0068862_100805587 3300005844 Bacteria 917
190 Ga0068862_100863528 3300005844 Bacteria 887
191 Ga0068862_101621657 3300005844 Bacteria 654
192 Ga0075365_10109281 3300006038 Bacteria 1899
193 Ga0075368_10140326 3300006042 Bacteria 1007
194 Ga0075363_100166696 3300006048 Bacteria 1249
195 Ga0075363_100287807 3300006048 Bacteria 952
196 Ga0075363_100769438 3300006048 Bacteria 584
197 Ga0075362_10017447 3300006177 Bacteria 2957
198 Ga0075367_10030143 3300006178 Bacteria 3108
199 Ga0075366_10000178 3300006195 Bacteria 27695
200 Ga0097621_100077347 3300006237 Bacteria 2762
201 Ga0097621_100119132 3300006237 Bacteria 2237
202 Ga0097621_100389591 3300006237 Bacteria 1246
203 Ga0097621_101338242 3300006237 Bacteria 677
204 Ga0097621_102394062 3300006237 Unclassified 505
205 Ga0075370_10071287 3300006353 Bacteria 1988
206 Ga0068871_100187996 3300006358 Bacteria 1778
207 Ga0068871_100273761 3300006358 Bacteria 1475
208 Ga0068871_101262865 3300006358 Bacteria 694
209 Ga0075428_100026176 3300006844 Bacteria 6461
210 Ga0075428_100041804 3300006844 Bacteria 5040
211 Ga0075428_100054384 3300006844 Bacteria 4387
212 Ga0075428_100077471 3300006844 Bacteria 3629
213 Ga0075428_100233794 3300006844 Bacteria 1983
214 Ga0075428_101293703 3300006844 Bacteria 767
215 Ga0075430_100000019 3300006846 Bacteria 86721
216 Ga0075430_100168344 3300006846 Bacteria 1823
217 Ga0075430_100223708 3300006846 Bacteria 1561
218 Ga0075431_100011273 3300006847 Bacteria 9005
219 Ga0075431_100022048 3300006847 Bacteria 6513
220 Ga0075431_100049567 3300006847 Bacteria 4329
221 Ga0075431_100266890 3300006847 Bacteria 1736
222 Ga0075431_100322653 3300006847 Bacteria 1557
223 Ga0075431_100333007 3300006847 Bacteria 1529
224 Ga0075431_100959763 3300006847 Bacteria 823
225 Ga0075433_10043990 3300006852 Bacteria 3878
226 Ga0075433_10100482 3300006852 Bacteria 2561
227 Ga0075433_10268157 3300006852 Bacteria 1513
228 Ga0075433_10803453 3300006852 Bacteria 822
229 Ga0075434_100011187 3300006871 Bacteria 8444
230 Ga0075434_100115423 3300006871 Bacteria 2698
231 Ga0075434_100558260 3300006871 Bacteria 1165
232 Ga0075434_101153190 3300006871 Unclassified 788
233 Ga0075429_100554725 3300006880 Bacteria 1007
234 Ga0075429_100681048 3300006880 Bacteria 901
235 Ga0075429_101239447 3300006880 Bacteria 651
236 Ga0075429_101274078 3300006880 Bacteria 641
237 Ga0075429_101957195 3300006880 Bacteria 508
238 Ga0068865_100007712 3300006881 Bacteria 6632
239 Ga0068865_100151173 3300006881 Bacteria 1761
240 Ga0068865_100683648 3300006881 Bacteria 875
241 Ga0075436_100141529 3300006914 Bacteria 1691
242 Ga0097620_100006868 3300006931 Bacteria 11557
243 Ga0097620_100053081 3300006931 Bacteria 4076
244 Ga0097620_100179304 3300006931 Bacteria 2201
245 Ga0097620_100186957 3300006931 Bacteria 2155
246 Ga0097620_101191824 3300006931 Bacteria 839
247 Ga0075435_100033565 3300007076 Bacteria 4059
248 Ga0111539_10002812 3300009094 Bacteria 23123
249 Ga0111539_10003063 3300009094 Bacteria 22145
250 Ga0111539_10058085 3300009094 Bacteria 4591
251 Ga0111539_10106604 3300009094 Bacteria 3287
252 Ga0111539_10147557 3300009094 Bacteria 2754
253 Ga0111539_10378748 3300009094 Bacteria 1647
254 Ga0111539_10504546 3300009094 Bacteria 1409
255 Ga0111539_10699890 3300009094 Bacteria 1179
256 Ga0111539_11877961 3300009094 Bacteria 695
257 Ga0111539_11962757 3300009094 Bacteria 679
258 Ga0105245_10122746 3300009098 Bacteria 2428
259 Ga0105245_10455393 3300009098 Bacteria 1289
260 Ga0105245_11020516 3300009098 Bacteria 872
261 Ga0105247_10952779 3300009101 Bacteria 667
262 Ga0114129_10011664 3300009147 Bacteria 12507
263 Ga0114129_10023331 3300009147 Bacteria 8776
264 Ga0114129_10084888 3300009147 Bacteria 4394
265 Ga0114129_10137508 3300009147 Bacteria 3351
266 Ga0114129_10148003 3300009147 Bacteria 3215
267 Ga0114129_10154399 3300009147 Bacteria 3140
268 Ga0114129_10176610 3300009147 Bacteria 2909
269 Ga0114129_10659599 3300009147 Bacteria 1349
270 Ga0114129_11338697 3300009147 Bacteria 886
271 Ga0114129_11969344 3300009147 Unclassified 707
272 Ga0105243_10100150 3300009148 Bacteria 2404
273 Ga0105243_10646734 3300009148 Bacteria 1024
274 Ga0105243_10814186 3300009148 Bacteria 922
275 Ga0105243_12297560 3300009148 Bacteria 577
276 Ga0105241_10229700 3300009174 Bacteria 1564
277 Ga0105241_10331895 3300009174 Bacteria 1315
278 Ga0105242_10151477 3300009176 Bacteria 2022
279 Ga0105242_10339472 3300009176 Bacteria 1384
280 Ga0105242_10431331 3300009176 Bacteria 1238
281 Ga0105242_11119293 3300009176 Bacteria 802
282 Ga0105248_10021539 3300009177 Bacteria 7139
283 Ga0105248_10026112 3300009177 Bacteria 6498
284 Ga0105248_10061095 3300009177 Bacteria 4230
285 Ga0105248_10078331 3300009177 Bacteria 3715
286 Ga0105248_10082480 3300009177 Bacteria 3616
287 Ga0105237_10120536 3300009545 Bacteria 2617
288 Ga0105237_11996075 3300009545 Bacteria 589
289 Ga0105249_10107994 3300009553 Bacteria 2626
290 Ga0105249_10341006 3300009553 Bacteria 1515
291 Ga0105249_10598900 3300009553 Bacteria 1157
292 Ga0105249_11080636 3300009553 Bacteria 872
293 Ga0105249_11879938 3300009553 Bacteria 671
294 Ga0105239_10216475 3300010375 Bacteria 2147
295 Ga0105246_10191908 3300011119 Bacteria 1582
296 Ga0105246_10497236 3300011119 Bacteria 1035
297 Ga0157374_10206366 3300013296 Bacteria 1926
298 Ga0157374_10226196 3300013296 Bacteria 1837
299 Ga0157374_12268172 3300013296 Bacteria 570
300 Ga0157378_10307324 3300013297 Bacteria 1537
301 Ga0157378_10409841 3300013297 Bacteria 1337
302 Ga0157378_12723993 3300013297 Bacteria 547
303 Ga0163162_10068321 3300013306 Bacteria 3605
304 Ga0163162_10179067 3300013306 Bacteria 2246
305 Ga0163162_10618464 3300013306 Bacteria 1208
306 Ga0163162_12066166 3300013306 Bacteria 653
307 Ga0157375_10072570 3300013308 Bacteria 3459
308 Ga0157375_10112204 3300013308 Bacteria 2826
309 Ga0157375_10363789 3300013308 Bacteria 1613
310 Ga0157375_11757604 3300013308 Bacteria 735
311 Ga0163163_10036003 3300014325 Bacteria 4805
312 Ga0157380_10290936 3300014326 Bacteria 1500
313 Ga0157380_10316198 3300014326 Bacteria 1445
314 Ga0157380_10496871 3300014326 Bacteria 1184
315 Ga0157377_10167023 3300014745 Bacteria 1373
316 Ga0157377_10370872 3300014745 Bacteria 966
317 Ga0157377_11615661 3300014745 Bacteria 520
318 Ga0157379_10687675 3300014968 Bacteria 959
319 Ga0157376_10221826 3300014969 Bacteria 1751
320 Ga0157376_10292499 3300014969 Bacteria 1538
321 Ga0163161_10007977 3300017792 Bacteria 7326
322 Ga0163161_10796008 3300017792 Bacteria 794
323 Ga0163161_11059529 3300017792 Unclassified 695
324 Ga0213871_10259107 3300021441 Bacteria 554
325 Ga0207697_10020218 3300025315 Bacteria 2726
326 Ga0207697_10211120 3300025315 Bacteria 855
327 Ga0207642_10030509 3300025899 Bacteria 2247
328 Ga0207642_10090817 3300025899 Bacteria 1508
329 Ga0207688_10076213 3300025901 Bacteria 1909
330 Ga0207688_10856457 3300025901 Unclassified 576
331 Ga0207680_10167544 3300025903 Bacteria 1477
332 Ga0207680_11278062 3300025903 Bacteria 522
333 Ga0207647_10326664 3300025904 Bacteria 871
334 Ga0207699_10677378 3300025906 Bacteria 754
335 Ga0207645_10070895 3300025907 Bacteria 2230
336 Ga0207643_10046529 3300025908 Bacteria 2453
337 Ga0207684_10000943 3300025910 Bacteria 32808
338 Ga0207684_10027896 3300025910 Bacteria 4809
339 Ga0207684_10032393 3300025910 Bacteria 4445
340 Ga0207684_10070050 3300025910 Bacteria 2980
341 Ga0207684_10426616 3300025910 Bacteria 1139
342 Ga0207684_10988574 3300025910 Bacteria 704
343 Ga0207707_11134952 3300025912 Bacteria 635
344 Ga0207663_10626880 3300025916 Unclassified 847
345 Ga0207660_10139439 3300025917 Bacteria 1853
346 Ga0207660_10435804 3300025917 Bacteria 1059
347 Ga0207660_10934761 3300025917 Bacteria 707
348 Ga0207662_10284745 3300025918 Bacteria 1095
349 Ga0207657_10645367 3300025919 Bacteria 824
350 Ga0207649_10682737 3300025920 Bacteria 795
351 Ga0207646_10004242 3300025922 Bacteria 15667
352 Ga0207646_10226961 3300025922 Bacteria 1687
353 Ga0207646_10623146 3300025922 Bacteria 967
354 Ga0207646_11138716 3300025922 Bacteria 686
355 Ga0207646_11234580 3300025922 Unclassified 654
356 Ga0207681_10143837 3300025923 Bacteria 1779
357 Ga0207681_10266207 3300025923 Bacteria 1344
358 Ga0207650_10027932 3300025925 Bacteria 4042
359 Ga0207650_10347659 3300025925 Bacteria 1219
360 Ga0207650_10831699 3300025925 Bacteria 783
361 Ga0207650_11685688 3300025925 Bacteria 537
362 Ga0207659_10014319 3300025926 Bacteria 5110
363 Ga0207659_10139757 3300025926 Bacteria 1879
364 Ga0207659_10183816 3300025926 Bacteria 1658
365 Ga0207659_10284388 3300025926 Bacteria 1353
366 Ga0207659_10293881 3300025926 Bacteria 1332
367 Ga0207687_10139684 3300025927 Bacteria 1836
368 Ga0207687_10435031 3300025927 Bacteria 1085
369 Ga0207700_10196900 3300025928 Bacteria 1696
370 Ga0207644_10010166 3300025931 Bacteria 6200
371 Ga0207644_11161694 3300025931 Bacteria 649
372 Ga0207690_10132878 3300025932 Bacteria 1824
373 Ga0207690_10666385 3300025932 Bacteria 853
374 Ga0207706_10151830 3300025933 Bacteria 2037
375 Ga0207706_10399892 3300025933 Bacteria 1191
376 Ga0207706_10866277 3300025933 Bacteria 764
377 Ga0207706_11178338 3300025933 Bacteria 637
378 Ga0207686_10074100 3300025934 Bacteria 2199
379 Ga0207686_10489105 3300025934 Bacteria 953
380 Ga0207709_10410329 3300025935 Bacteria 1038
381 Ga0207709_11304714 3300025935 Bacteria 600
382 Ga0207670_10016400 3300025936 Bacteria 4452
383 Ga0207704_10120324 3300025938 Bacteria 1795
384 Ga0207704_10224755 3300025938 Bacteria 1392
385 Ga0207704_10269113 3300025938 Bacteria 1289
386 Ga0207691_10042995 3300025940 Bacteria 4165
387 Ga0207691_10051896 3300025940 Bacteria 3747
388 Ga0207691_10079346 3300025940 Bacteria 2954
389 Ga0207691_10901584 3300025940 Bacteria 740
390 Ga0207691_11383325 3300025940 Bacteria 579
391 Ga0207711_10058738 3300025941 Bacteria 3311
392 Ga0207711_10163298 3300025941 Bacteria 2017
393 Ga0207711_10211872 3300025941 Bacteria 1770
394 Ga0207711_10265815 3300025941 Bacteria 1577
395 Ga0207711_10442056 3300025941 Bacteria 1210
396 Ga0207689_10029623 3300025942 Bacteria 4569
397 Ga0207689_10378105 3300025942 Bacteria 1179
398 Ga0207689_10394878 3300025942 Bacteria 1153
399 Ga0207661_10561335 3300025944 Bacteria 1046
400 Ga0207661_10759580 3300025944 Bacteria 892
401 Ga0207679_10170651 3300025945 Bacteria 1790
402 Ga0207679_10487624 3300025945 Bacteria 1098
403 Ga0207651_10144229 3300025960 Bacteria 1844
404 Ga0207651_10215674 3300025960 Bacteria 1548
405 Ga0207651_10242949 3300025960 Bacteria 1469
406 Ga0207651_11744656 3300025960 Bacteria 560
407 Ga0207712_10022729 3300025961 Bacteria 4134
408 Ga0207712_10043515 3300025961 Bacteria 3098
409 Ga0207712_10163515 3300025961 Bacteria 1732
410 Ga0207712_10924247 3300025961 Bacteria 772
411 Ga0207668_10775820 3300025972 Bacteria 847
412 Ga0207668_11408876 3300025972 Bacteria 628
413 Ga0207640_10253444 3300025981 Bacteria 1367
414 Ga0207658_10033552 3300025986 Bacteria 3663
415 Ga0207658_10049176 3300025986 Bacteria 3097
416 Ga0207658_10379802 3300025986 Bacteria 1237
417 Ga0207677_10036053 3300026023 Bacteria 3219
418 Ga0207677_10539594 3300026023 Bacteria 1015
419 Ga0207703_10194509 3300026035 Bacteria 1799
420 Ga0207703_10387255 3300026035 Bacteria 1294
421 Ga0207703_10476676 3300026035 Bacteria 1169
422 Ga0207639_10369790 3300026041 Bacteria 1285
423 Ga0207639_10564179 3300026041 Bacteria 1046
424 Ga0207639_11373596 3300026041 Bacteria 663
425 Ga0207708_10008486 3300026075 Bacteria 7607
426 Ga0207708_10170980 3300026075 Bacteria 1721
427 Ga0207708_10949604 3300026075 Bacteria 746
428 Ga0207708_11695525 3300026075 Bacteria 555
429 Ga0207702_11383530 3300026078 Bacteria 697
430 Ga0207641_10379148 3300026088 Bacteria 1354
431 Ga0207641_10982794 3300026088 Bacteria 840
432 Ga0207648_10017784 3300026089 Bacteria 6454
433 Ga0207648_10117749 3300026089 Bacteria 2334
434 Ga0207676_10016426 3300026095 Bacteria 5361
435 Ga0207676_10683072 3300026095 Bacteria 993
436 Ga0207674_10017928 3300026116 Bacteria 7716
437 Ga0207674_10771707 3300026116 Bacteria 928
438 Ga0207675_100230336 3300026118 Bacteria 1787
439 Ga0207675_100239830 3300026118 Bacteria 1752
440 Ga0207675_101829098 3300026118 Bacteria 626
441 Ga0207683_10082721 3300026121 Bacteria 2852
442 Ga0207683_10792488 3300026121 Bacteria 879
443 Ga0207698_10553044 3300026142 Bacteria 1128
444 Ga0207698_10790487 3300026142 Bacteria 950
445 Ga0207698_11433631 3300026142 Bacteria 706
446 Ga0209813_10079380 3300027866 Bacteria 1082
447 Ga0207428_10000174 3300027907 Bacteria 89762
448 Ga0207428_10246840 3300027907 Bacteria 1332
449 Ga0207428_10359556 3300027907 Bacteria 1070
450 Ga0207428_10622891 3300027907 Bacteria 776
451 Ga0268266_10143107 3300028379 Bacteria 2147
452 Ga0268266_10213372 3300028379 Bacteria 1771
453 Ga0268265_10310241 3300028380 Bacteria 1424
454 Ga0268265_10613815 3300028380 Bacteria 1041
455 Ga0268265_10632137 3300028380 Bacteria 1027
456 Ga0268264_10454059 3300028381 Bacteria 1242
457 Ga0268264_10820221 3300028381 Unclassified 930
458 Ga0268264_11472734 3300028381 Bacteria 691
459 Ga0268264_11587870 3300028381 Bacteria 665
460 Ga0265338_10062708 3300028800 Bacteria 3247
461 Ga0307408_101045432 3300031548 Bacteria 755
462 Ga0316579_10091249 3300031691 Unclassified 1455
463 Ga0307407_10084228 3300031903 Bacteria 1931
464 Ga0307409_101518668 3300031995 Bacteria 697
465 Ga0307416_100115167 3300032002 Bacteria 2380
466 Ga0307414_11549526 3300032004 Bacteria 617
467 Ga0307415_100170643 3300032126 Unclassified 1696
468 Ga0307415_101113476 3300032126 Bacteria 740
469 Ga0316580_10084754 3300032139 Bacteria 969
470 Ga0316596_1185225 3300033541 Bacteria 577
471 Ga0373930_0004673 3300034816 Bacteria 2242
472 Ga0373940_0222507 3300035088 Bacteria 628
473 Ga0373944_0239350 3300035089 Bacteria 667
474 Ga0373951_0088816 3300035091 Bacteria 809
475 Ga0373932_0015993 3300035112 Bacteria 1910
476 Ga0373941_0320378 3300035115 Bacteria 623
477 Ga0373943_0016934 3300035170 Bacteria 3332
478 Ga0373946_0032729 3300035171 Bacteria 2089
479 Ga0373962_0118813 3300035242 Bacteria 841
480 Ga0316574_0484808 3300035398 Bacteria 772
481 Ga0316574_1010328 3300035398 Bacteria 500
482 Ga0373924_0345365 3300035410 Bacteria 663
483 Ga0373931_0004986 3300035691 Bacteria 6107
484 Ga0373931_0238290 3300035691 Bacteria 1102
485 Ga0373931_0414944 3300035691 Bacteria 855
486 Ga0373931_1067186 3300035691 Bacteria 549
487 Ga0373935_0401955 3300035692 Bacteria 984
488 Ga0373947_0104540 3300035725 Bacteria 1783
489 Ga0373947_0341876 3300035725 Bacteria 1003
490 Ga0373937_0175264 3300036401 Bacteria 2013
491 Ga0373937_1938931 3300036401 Bacteria 535
492 Ga0316582_0108687 3300036647 Bacteria 1844
493 Ga0316582_0210986 3300036647 Viruses 1327
494 Ga0316582_0260247 3300036647 Bacteria 1190
495 Ga0316584_0639807 3300036712 Unclassified 734
496 Ga0373925_0001695 3300037068 Bacteria 18540
497 Ga0373925_0188210 3300037068 Bacteria 1637
498 Ga0395905_0658973 3300037471 Unclassified 949
499 Ga0400484_26581 3300038725 Bacteria 6844
500 Ga0400490_22371 3300038726 Bacteria 1904
501 Ga0400488_09289 3300038741 Bacteria 2261
502 Ga0400486_03208 3300038742 Bacteria 1314
503 Ga0400483_139472 3300039062 Bacteria 1004
504 Ga0400487_01400 3300039110 Bacteria 1321
505 Ga0439439_0102352 3300041406 Unclassified 789
506 Ga0450890_043394 3300042127 Bacteria 671
507 Ga0451577_0138436 3300042876 Bacteria 2186
508 Ga0451577_0464713 3300042876 Unclassified 1149
509 Ga0453683_0170202 3300044673 Unclassified 1379
510 Ga0453684_0221454 3300044712 Bacteria 2192
511 Ga0453684_1344545 3300044712 Bacteria 743
512 Ga0451576_0623023 3300045051 Bacteria 1134
513 Ga0451576_0963891 3300045051 Bacteria 894
514 Ga0451576_2321123 3300045051 Bacteria 550
515 Ga0495629_0000010 3300046459 Bacteria 340114
516 Ga0495582_0026776 3300046473 Bacteria 3161
517 Ga0495582_0556435 3300046473 Bacteria 664
518 Ga0495639_0000036 3300046475 Bacteria 60447
519 Ga0495594_0096598 3300046499 Bacteria 1660
520 Ga0495596_0228630 3300046500 Bacteria 722
521 Ga0495618_0095700 3300046514 Bacteria 1899
522 Ga0495628_0481767 3300046516 Unclassified 898
523 Ga0495630_0451656 3300046517 Bacteria 985
524 Ga0495630_1003842 3300046517 Bacteria 634
525 Ga0495666_0003862 3300046526 Bacteria 7582
526 Ga0495640_0037828 3300046533 Bacteria 3400
527 Ga0495645_0521287 3300046543 Bacteria 740
528 Ga0495622_0003351 3300046557 Bacteria 7562
529 Ga0495667_0269047 3300046559 Bacteria 1083
530 Ga0495635_0003750 3300046663 Bacteria 10547
531 Ga0495657_0180666 3300046675 Bacteria 1295
532 Ga0495613_0794361 3300046689 Bacteria 618
533 Ga0495624_0334263 3300046690 Bacteria 912
534 Ga0495600_0003594 3300046809 Bacteria 9136
535 Ga0495600_0301798 3300046809 Bacteria 1010
536 Ga0495581_0003468 3300047315 Bacteria 9054
537 Ga0495674_0242946 3300047319 Bacteria 1483
538 Ga0495676_0008355 3300047321 Bacteria 9495
539 Ga0495680_0000604 3300047322 Bacteria 40524
540 Ga0495684_0035673 3300047471 Bacteria 3813
541 Ga0495684_0105529 3300047471 Bacteria 2129
542 Ga0495684_0144084 3300047471 Bacteria 1785
543 Ga0496100_0255842 3300048903 Bacteria 1297
544 Ga0496101_0098048 3300048904 Bacteria 2190
545 Ga0496102_0001871 3300048905 Bacteria 18136
546 Ga0496102_0106816 3300048905 Bacteria 2606
547 Ga0496102_0656971 3300048905 Bacteria 972
548 Ga0496103_0139181 3300048906 Bacteria 1552
549 Ga0496103_0887529 3300048906 Bacteria 559
550 Ga0496104_0044478 3300048907 Bacteria 4172
551 Ga0496105_0118922 3300048908 Bacteria 2180
552 Ga0496106_0324233 3300048909 Bacteria 1236
553 Ga0496106_0691263 3300048909 Bacteria 813
554 Ga0496107_1115540 3300048910 Bacteria 569
555 Ga0496108_0052475 3300048911 Bacteria 3417
556 Ga0496108_0119269 3300048911 Bacteria 2262
557 Ga0496108_1143326 3300048911 Bacteria 660
558 Ga0496109_0001591 3300048912 Bacteria 18936
559 Ga0496109_0002883 3300048912 Bacteria 14395
560 Ga0496110_0003223 3300048913 Bacteria 12429
561 Ga0496110_0071475 3300048913 Bacteria 3077
562 Ga0496111_0089134 3300048914 Bacteria 2259
563 Ga0496112_0000913 3300048915 Bacteria 21318
564 Ga0496112_0001633 3300048915 Bacteria 17370
565 Ga0496112_0210221 3300048915 Bacteria 1903
566 Ga0496113_0275280 3300048916 Bacteria 1346
567 Ga0496114_0039519 3300048917 Bacteria 3904
568 Ga0496114_1109158 3300048917 Bacteria 676
569 Ga0501037_0786639 3300049573 Bacteria 629
570 Ga0501040_0041322 3300049576 Bacteria 3141
571 Ga0501041_0304005 3300049577 Bacteria 1005
572 Ga0501041_0745544 3300049577 Bacteria 627
573 Ga0501042_0938943 3300049578 Bacteria 630
574 Ga0501046_0121803 3300049580 Bacteria 1984
575 Ga0501071_0320634 3300049587 Bacteria 1177
576 Ga0501071_0352148 3300049587 Bacteria 1121
577 Ga0501072_0561237 3300049588 Bacteria 901
578 Ga0501075_0066913 3300049591 Bacteria 2712
579 Ga0501075_0174528 3300049591 Bacteria 1640
580 Ga0501075_1232166 3300049591 Bacteria 567
581 Ga0501077_0232490 3300049593 Bacteria 1172
582 Ga0501079_0222198 3300049741 Bacteria 1476
583 Ga0501079_1045652 3300049741 Bacteria 643
584 Ga0501080_0060984 3300049742 Bacteria 3512
585 Ga0501080_0261358 3300049742 Bacteria 1577
586 Ga0501081_0075505 3300049743 Bacteria 2353
587 Ga0501081_0116209 3300049743 Bacteria 1902
588 Ga0501081_0376651 3300049743 Bacteria 1048
589 Ga0501081_0480612 3300049743 Bacteria 925
590 nmdc:mga03n38_699011_c1 3300050490 Bacteria 584
591 nmdc:mga0k408_2148_c1 3300050493 Bacteria 10576
592 nmdc:mga06z11_235551_c1 3300050494 Bacteria 1074
593 nmdc:mga06z11_248476_c1 3300050494 Bacteria 1047
594 nmdc:mga04h51_205665_c1 3300050495 Bacteria 775
595 nmdc:mga05p37_125765_c1 3300050507 Bacteria 3148
596 nmdc:mga05p37_136186_c1 3300050507 Bacteria 3011
597 nmdc:mga05p37_197055_c1 3300050507 Bacteria 2442
598 nmdc:mga05p37_309171_c1 3300050507 Bacteria 1874
599 nmdc:mga05p37_335032_c1 3300050507 Bacteria 1786
600 nmdc:mga05p37_567062_c1 3300050507 Bacteria 1289
601 nmdc:mga05p37_651530_c1 3300050507 Bacteria 1179
602 nmdc:mga05p37_898856_c1 3300050507 Bacteria 955
603 nmdc:mga09592_124395_c1 3300050508 Bacteria 2216
604 nmdc:mga09592_496680_c1 3300050508 Bacteria 1051
605 nmdc:mga0qj67_159526_c1 3300050509 Bacteria 1831
606 nmdc:mga0qj67_230952_c1 3300050509 Bacteria 1501
607 nmdc:mga0qj67_301528_c1 3300050509 Bacteria 1298
608 nmdc:mga0qj67_343_c1 3300050509 Bacteria 32121
609 nmdc:mga06r32_17698_c1 3300050510 Bacteria 6510
610 nmdc:mga06r32_244423_c1 3300050510 Bacteria 1782
611 nmdc:mga06r32_419452_c1 3300050510 Bacteria 1319
612 nmdc:mga06r32_472017_c1 3300050510 Bacteria 1233
613 nmdc:mga06r32_643935_c1 3300050510 Bacteria 1028
614 nmdc:mga06r32_9480_c1 3300050510 Bacteria 8789
615 nmdc:mga08y16_116365_c1 3300050511 Bacteria 2783
616 nmdc:mga08y16_17788_c1 3300050511 Bacteria 7487
617 nmdc:mga08y16_2073_c1 3300050511 Bacteria 20553
618 nmdc:mga08y16_311248_c1 3300050511 Bacteria 1622
619 nmdc:mga08y16_625208_c1 3300050511 Bacteria 1083
620 nmdc:mga0n895_179708_c1 3300050512 Bacteria 2147
621 nmdc:mga0n895_243509_c1 3300050512 Bacteria 1825
622 nmdc:mga0n895_33522_c1 3300050512 Bacteria 4937
623 nmdc:mga0n895_473021_c1 3300050512 Bacteria 1264
624 nmdc:mga0n895_558750_c1 3300050512 Bacteria 1150
625 nmdc:mga0n895_970687_c1 3300050512 Unclassified 832
626 nmdc:mga0rr50_340544_c1 3300050513 Bacteria 1260
627 nmdc:mga0rr50_45835_c1 3300050513 Bacteria 3216
628 nmdc:mga08x19_102755_c1 3300050514 Bacteria 1898
629 nmdc:mga0a205_1292039_c1 3300050515 Bacteria 577
630 nmdc:mga0a205_182812_c1 3300050515 Archaea 1990
631 nmdc:mga0a205_283078_c1 3300050515 Bacteria 1533
632 nmdc:mga0a205_32667_c1 3300050515 Bacteria 4989
633 nmdc:mga0a205_40666_c1 3300050515 Bacteria 4476
634 nmdc:mga0a205_862480_c1 3300050515 Bacteria 752
635 Ga0495601_0014121 3300053077 Bacteria 4812
636 Ga0495601_1063304 3300053077 Bacteria 507
637 Ga0495619_0029691 3300053085 Bacteria 3534
638 Ga0495619_0091797 3300053085 Bacteria 2056
639 Ga0500566_0022261 3300053094 Bacteria 3723
640 Ga0501084_0986713 3300054114 Bacteria 708
641 Ga0590071_000151 3300059421 Bacteria 19813
642 Ga0590075_000018 3300059424 Bacteria 44292
643 Ga0590077_000123 3300059426 Bacteria 21032
644 Ga0501082_1242992 3300060353 Bacteria 651
645 Ga0530510_0181090 3300061734 Bacteria 1563
646 Ga0530510_0438071 3300061734 Bacteria 987
647 Ga0373937_0860353
648 Ga0065714_10026109
649 Ga0065712_10001052
650 Ga0065712_10004524
651 Ga0065712_10083311
652 Ga0065712_10424601
653 Ga0065712_10515239
654 Ga0065715_10000269
655 Ga0065715_10169718
656 Ga0065715_10411251
657 Ga0065707_10143310
658 Ga0070676_10215752
659 Ga0070683_100000500
660 Ga0070690_100147974
661 Ga0070690_100173884
662 Ga0070690_101357601
663 Ga0070670_100009228
664 Ga0070670_100360700
665 Ga0070670_100509403
666 Ga0070670_100839677
667 Ga0070677_10738136
668 Ga0068869_100059330
669 Ga0068869_100152520
670 Ga0068869_100176264
671 Ga0068869_100253732
672 Ga0068869_100926798
673 Ga0070666_10177494
674 Ga0070666_10311596
675 Ga0070666_10561648
676 Ga0070666_10712641
677 Ga0070680_100210315
678 Ga0068868_100168087
679 Ga0070689_100013117
680 Ga0070689_100344426
681 Ga0070689_100795568
682 Ga0070689_101965170
683 Ga0070687_100107290
684 Ga0070661_100031574
685 Ga0070692_10018721
686 Ga0070692_10376888
687 Ga0070669_100304557
688 Ga0070669_100663644
689 Ga0070669_100971542
690 Ga0070675_100019150
691 Ga0070675_100046131
692 Ga0070675_100292376
693 Ga0070675_100396405
694 Ga0070674_100427874
695 Ga0070673_100269312
696 Ga0070673_100645275
697 Ga0070673_101153528
698 Ga0070688_100050483
699 Ga0070688_100053636
700 Ga0070688_100072787
701 Ga0070688_100506877
702 Ga0070688_100562929
703 Ga0070659_100118976
704 Ga0070667_100085317
705 Ga0070667_100554323
706 Ga0070667_101830713
707 Ga0070703_10013281
708 Ga0070709_10437356
709 Ga0070713_100432774
710 Ga0070701_10077049
711 Ga0070701_10140214
712 Ga0070701_10371069
713 Ga0070705_100041193
714 Ga0070705_100102927
715 Ga0070705_100614446
716 Ga0070705_101383993
717 Ga0070700_100041113
718 Ga0070700_100735097
719 Ga0070700_101661842
720 Ga0070694_100233309
721 Ga0070694_100330345
722 Ga0070694_100534737
723 Ga0070694_100568358
724 Ga0070694_100596762
725 Ga0070708_100066078
726 Ga0070708_100140943
727 Ga0070708_100186581
728 Ga0070708_100328668
729 Ga0070708_100395693
730 Ga0070708_101705068
731 Ga0070678_100078658
732 Ga0070678_100344258
733 Ga0070662_100510524
734 Ga0070662_101047292
735 Ga0070681_10073791
736 Ga0068867_100057195
737 Ga0068867_100231898
738 Ga0068867_100241385
739 Ga0068867_100333307
740 Ga0070685_10160416
741 Ga0070685_10402498
742 Ga0070706_100012846
743 Ga0070706_100016961
744 Ga0070706_100402618
745 Ga0070706_100494739
746 Ga0070706_100640486
747 Ga0070706_100702988
748 Ga0070706_100916946
749 Ga0070706_101471835
750 Ga0070707_100001291
751 Ga0070707_101076306
752 Ga0070707_101428490
753 Ga0070707_101703536
754 Ga0070707_101728082
755 Ga0070707_102056142
756 Ga0070698_100015442
757 Ga0070698_100046510
758 Ga0070698_100317007
759 Ga0070698_100749670
760 Ga0070698_101368659
761 Ga0070699_100005090
762 Ga0070699_100128299
763 Ga0070699_100541926
764 Ga0070699_101344369
765 Ga0070679_100725108
766 Ga0070684_100001365
767 Ga0070684_100108795
768 Ga0070697_100004461
769 Ga0070697_100097789
770 Ga0070697_100431632
771 Ga0068853_100524994
772 Ga0068853_100981861
773 Ga0070672_100075633
774 Ga0070672_100139502
775 Ga0070672_100279250
776 Ga0070686_100224880
777 Ga0070686_100328889
778 Ga0070695_100010735
779 Ga0070695_100246201
780 Ga0070695_100438200
781 Ga0070696_100020384
782 Ga0070696_100142699
783 Ga0070696_100940007
784 Ga0070696_101169660
785 Ga0070693_101422264
786 Ga0070665_100115357
787 Ga0070665_100221409
788 Ga0070665_100258431
789 Ga0070665_100538374
790 Ga0070665_101178924
791 Ga0070704_100021700
792 Ga0070704_100043466
793 Ga0070704_100064127
794 Ga0070704_100513399
795 Ga0070704_101002050
796 Ga0070704_101496460
797 Ga0070664_100014461
798 Ga0070664_100617499
799 Ga0068854_100171002
800 Ga0070702_100408729
801 Ga0070702_101703742
802 Ga0068852_100913975
803 Ga0068859_100006868
804 Ga0068859_100053081
805 Ga0068859_100179315
806 Ga0068859_100186960
807 Ga0068859_101191762
808 Ga0068864_100023937
809 Ga0068864_100261183
810 Ga0068864_100723180
811 Ga0068866_10062776
812 Ga0068861_100028741
813 Ga0068861_100737539
814 Ga0068861_101690696
815 Ga0068870_10947305
816 Ga0068863_100137798
817 Ga0068863_100327559
818 Ga0068863_100346457
819 Ga0068863_100420046
820 Ga0068858_100106695
821 Ga0068858_100178153
822 Ga0068858_100412050
823 Ga0068858_100570145
824 Ga0068860_100120521
825 Ga0068860_100484169
826 Ga0068860_100518963
827 Ga0068860_100917921
828 Ga0068860_101650297
829 Ga0068860_102032503
830 Ga0068860_102045636
831 Ga0068862_100223618
832 Ga0068862_100367864
833 Ga0068862_100376557
834 Ga0068862_100525315
835 Ga0068862_100805587
836 Ga0068862_100863528
837 Ga0068862_101621657
838 Ga0075365_10109281
839 Ga0075368_10140326
840 Ga0075363_100166696
841 Ga0075363_100287807
842 Ga0075363_100769438
843 Ga0075362_10017447
844 Ga0075367_10030143
845 Ga0075366_10000178
846 Ga0097621_100077347
847 Ga0097621_100119132
848 Ga0097621_100389591
849 Ga0097621_101338242
850 Ga0097621_102394062
851 Ga0075370_10071287
852 Ga0068871_100187996
853 Ga0068871_100273761
854 Ga0068871_101262865
855 Ga0075428_100026176
856 Ga0075428_100041804
857 Ga0075428_100054384
858 Ga0075428_100077471
859 Ga0075428_100233794
860 Ga0075428_101293703
861 Ga0075430_100000019
862 Ga0075430_100168344
863 Ga0075430_100223708
864 Ga0075431_100011273
865 Ga0075431_100022048
866 Ga0075431_100049567
867 Ga0075431_100266890
868 Ga0075431_100322653
869 Ga0075431_100333007
870 Ga0075431_100959763
871 Ga0075433_10043990
872 Ga0075433_10100482
873 Ga0075433_10268157
874 Ga0075433_10803453
875 Ga0075434_100011187
876 Ga0075434_100115423
877 Ga0075434_100558260
878 Ga0075434_101153190
879 Ga0075429_100554725
880 Ga0075429_100681048
881 Ga0075429_101239447
882 Ga0075429_101274078
883 Ga0075429_101957195
884 Ga0068865_100007712
885 Ga0068865_100151173
886 Ga0068865_100683648
887 Ga0075436_100141529
888 Ga0097620_100006868
889 Ga0097620_100053081
890 Ga0097620_100179304
891 Ga0097620_100186957
892 Ga0097620_101191824
893 Ga0075435_100033565
894 Ga0111539_10002812
895 Ga0111539_10003063
896 Ga0111539_10058085
897 Ga0111539_10106604
898 Ga0111539_10147557
899 Ga0111539_10378748
900 Ga0111539_10504546
901 Ga0111539_10699890
902 Ga0111539_11877961
903 Ga0111539_11962757
904 Ga0105245_10122746
905 Ga0105245_10455393
906 Ga0105245_11020516
907 Ga0105247_10952779
908 Ga0114129_10011664
909 Ga0114129_10023331
910 Ga0114129_10084888
911 Ga0114129_10137508
912 Ga0114129_10148003
913 Ga0114129_10154399
914 Ga0114129_10176610
915 Ga0114129_10659599
916 Ga0114129_11338697
917 Ga0114129_11969344
918 Ga0105243_10100150
919 Ga0105243_10646734
920 Ga0105243_10814186
921 Ga0105243_12297560
922 Ga0105241_10229700
923 Ga0105241_10331895
924 Ga0105242_10151477
925 Ga0105242_10339472
926 Ga0105242_10431331
927 Ga0105242_11119293
928 Ga0105248_10021539
929 Ga0105248_10026112
930 Ga0105248_10061095
931 Ga0105248_10078331
932 Ga0105248_10082480
933 Ga0105237_10120536
934 Ga0105237_11996075
935 Ga0105249_10107994
936 Ga0105249_10341006
937 Ga0105249_10598900
938 Ga0105249_11080636
939 Ga0105249_11879938
940 Ga0105239_10216475
941 Ga0105246_10191908
942 Ga0105246_10497236
943 Ga0157374_10206366
944 Ga0157374_10226196
945 Ga0157374_12268172
946 Ga0157378_10307324
947 Ga0157378_10409841
948 Ga0157378_12723993
949 Ga0163162_10068321
950 Ga0163162_10179067
951 Ga0163162_10618464
952 Ga0163162_12066166
953 Ga0157375_10072570
954 Ga0157375_10112204
955 Ga0157375_10363789
956 Ga0157375_11757604
957 Ga0163163_10036003
958 Ga0157380_10290936
959 Ga0157380_10316198
960 Ga0157380_10496871
961 Ga0157377_10167023
962 Ga0157377_10370872
963 Ga0157377_11615661
964 Ga0157379_10687675
965 Ga0157376_10221826
966 Ga0157376_10292499
967 Ga0163161_10007977
968 Ga0163161_10796008
969 Ga0163161_11059529
970 Ga0213871_10259107
971 Ga0207697_10020218
972 Ga0207697_10211120
973 Ga0207642_10030509
974 Ga0207642_10090817
975 Ga0207688_10076213
976 Ga0207688_10856457
977 Ga0207680_10167544
978 Ga0207680_11278062
979 Ga0207647_10326664
980 Ga0207699_10677378
981 Ga0207645_10070895
982 Ga0207643_10046529
983 Ga0207684_10000943
984 Ga0207684_10027896
985 Ga0207684_10032393
986 Ga0207684_10070050
987 Ga0207684_10426616
988 Ga0207684_10988574
989 Ga0207707_11134952
990 Ga0207663_10626880
991 Ga0207660_10139439
992 Ga0207660_10435804
993 Ga0207660_10934761
994 Ga0207662_10284745
995 Ga0207657_10645367
996 Ga0207649_10682737
997 Ga0207646_10004242
998 Ga0207646_10226961
999 Ga0207646_10623146
1000 Ga0207646_11138716
1001 Ga0207646_11234580
1002 Ga0207681_10143837
1003 Ga0207681_10266207
1004 Ga0207650_10027932
1005 Ga0207650_10347659
1006 Ga0207650_10831699
1007 Ga0207650_11685688
1008 Ga0207659_10014319
1009 Ga0207659_10139757
1010 Ga0207659_10183816
1011 Ga0207659_10284388
1012 Ga0207659_10293881
1013 Ga0207687_10139684
1014 Ga0207687_10435031
1015 Ga0207700_10196900
1016 Ga0207644_10010166
1017 Ga0207644_11161694
1018 Ga0207690_10132878
1019 Ga0207690_10666385
1020 Ga0207706_10151830
1021 Ga0207706_10399892
1022 Ga0207706_10866277
1023 Ga0207706_11178338
1024 Ga0207686_10074100
1025 Ga0207686_10489105
1026 Ga0207709_10410329
1027 Ga0207709_11304714
1028 Ga0207670_10016400
1029 Ga0207704_10120324
1030 Ga0207704_10224755
1031 Ga0207704_10269113
1032 Ga0207691_10042995
1033 Ga0207691_10051896
1034 Ga0207691_10079346
1035 Ga0207691_10901584
1036 Ga0207691_11383325
1037 Ga0207711_10058738
1038 Ga0207711_10163298
1039 Ga0207711_10211872
1040 Ga0207711_10265815
1041 Ga0207711_10442056
1042 Ga0207689_10029623
1043 Ga0207689_10378105
1044 Ga0207689_10394878
1045 Ga0207661_10561335
1046 Ga0207661_10759580
1047 Ga0207679_10170651
1048 Ga0207679_10487624
1049 Ga0207651_10144229
1050 Ga0207651_10215674
1051 Ga0207651_10242949
1052 Ga0207651_11744656
1053 Ga0207712_10022729
1054 Ga0207712_10043515
1055 Ga0207712_10163515
1056 Ga0207712_10924247
1057 Ga0207668_10775820
1058 Ga0207668_11408876
1059 Ga0207640_10253444
1060 Ga0207658_10033552
1061 Ga0207658_10049176
1062 Ga0207658_10379802
1063 Ga0207677_10036053
1064 Ga0207677_10539594
1065 Ga0207703_10194509
1066 Ga0207703_10387255
1067 Ga0207703_10476676
1068 Ga0207639_10369790
1069 Ga0207639_10564179
1070 Ga0207639_11373596
1071 Ga0207708_10008486
1072 Ga0207708_10170980
1073 Ga0207708_10949604
1074 Ga0207708_11695525
1075 Ga0207702_11383530
1076 Ga0207641_10379148
1077 Ga0207641_10982794
1078 Ga0207648_10017784
1079 Ga0207648_10117749
1080 Ga0207676_10016426
1081 Ga0207676_10683072
1082 Ga0207674_10017928
1083 Ga0207674_10771707
1084 Ga0207675_100230336
1085 Ga0207675_100239830
1086 Ga0207675_101829098
1087 Ga0207683_10082721
1088 Ga0207683_10792488
1089 Ga0207698_10553044
1090 Ga0207698_10790487
1091 Ga0207698_11433631
1092 Ga0209813_10079380
1093 Ga0207428_10000174
1094 Ga0207428_10246840
1095 Ga0207428_10359556
1096 Ga0207428_10622891
1097 Ga0268266_10143107
1098 Ga0268266_10213372
1099 Ga0268265_10310241
1100 Ga0268265_10613815
1101 Ga0268265_10632137
1102 Ga0268264_10454059
1103 Ga0268264_10820221
1104 Ga0268264_11472734
1105 Ga0268264_11587870
1106 Ga0265338_10062708
1107 Ga0307408_101045432
1108 Ga0316579_10091249
1109 Ga0307407_10084228
1110 Ga0307409_101518668
1111 Ga0307416_100115167
1112 Ga0307414_11549526
1113 Ga0307415_100170643
1114 Ga0307415_101113476
1115 Ga0316580_10084754
1116 Ga0316596_1185225
1117 Ga0373930_0004673
1118 Ga0373940_0222507
1119 Ga0373944_0239350
1120 Ga0373951_0088816
1121 Ga0373932_0015993
1122 Ga0373941_0320378
1123 Ga0373943_0016934
1124 Ga0373946_0032729
1125 Ga0373962_0118813
1126 Ga0316574_0484808
1127 Ga0316574_1010328
1128 Ga0373924_0345365
1129 Ga0373931_0004986
1130 Ga0373931_0238290
1131 Ga0373931_0414944
1132 Ga0373931_1067186
1133 Ga0373935_0401955
1134 Ga0373947_0104540
1135 Ga0373947_0341876
1136 Ga0373937_0175264
1137 Ga0373937_1938931
1138 Ga0316582_0108687
1139 Ga0316582_0210986
1140 Ga0316582_0260247
1141 Ga0316584_0639807
1142 Ga0373925_0001695
1143 Ga0373925_0188210
1144 Ga0395905_0658973
1145 Ga0400484_26581
1146 Ga0400490_22371
1147 Ga0400488_09289
1148 Ga0400486_03208
1149 Ga0400483_139472
1150 Ga0400487_01400
1151 Ga0439439_0102352
1152 Ga0450890_043394
1153 Ga0451577_0138436
1154 Ga0451577_0464713
1155 Ga0453683_0170202
1156 Ga0453684_0221454
1157 Ga0453684_1344545
1158 Ga0451576_0623023
1159 Ga0451576_0963891
1160 Ga0451576_2321123
1161 Ga0495629_0000010
1162 Ga0495582_0026776
1163 Ga0495582_0556435
1164 Ga0495639_0000036
1165 Ga0495594_0096598
1166 Ga0495596_0228630
1167 Ga0495618_0095700
1168 Ga0495628_0481767
1169 Ga0495630_0451656
1170 Ga0495630_1003842
1171 Ga0495666_0003862
1172 Ga0495640_0037828
1173 Ga0495645_0521287
1174 Ga0495622_0003351
1175 Ga0495667_0269047
1176 Ga0495635_0003750
1177 Ga0495657_0180666
1178 Ga0495613_0794361
1179 Ga0495624_0334263
1180 Ga0495600_0003594
1181 Ga0495600_0301798
1182 Ga0495581_0003468
1183 Ga0495674_0242946
1184 Ga0495676_0008355
1185 Ga0495680_0000604
1186 Ga0495684_0035673
1187 Ga0495684_0105529
1188 Ga0495684_0144084
1189 Ga0496100_0255842
1190 Ga0496101_0098048
1191 Ga0496102_0001871
1192 Ga0496102_0106816
1193 Ga0496102_0656971
1194 Ga0496103_0139181
1195 Ga0496103_0887529
1196 Ga0496104_0044478
1197 Ga0496105_0118922
1198 Ga0496106_0324233
1199 Ga0496106_0691263
1200 Ga0496107_1115540
1201 Ga0496108_0052475
1202 Ga0496108_0119269
1203 Ga0496108_1143326
1204 Ga0496109_0001591
1205 Ga0496109_0002883
1206 Ga0496110_0003223
1207 Ga0496110_0071475
1208 Ga0496111_0089134
1209 Ga0496112_0000913
1210 Ga0496112_0001633
1211 Ga0496112_0210221
1212 Ga0496113_0275280
1213 Ga0496114_0039519
1214 Ga0496114_1109158
1215 Ga0501037_0786639
1216 Ga0501040_0041322
1217 Ga0501041_0304005
1218 Ga0501041_0745544
1219 Ga0501042_0938943
1220 Ga0501046_0121803
1221 Ga0501071_0320634
1222 Ga0501071_0352148
1223 Ga0501072_0561237
1224 Ga0501075_0066913
1225 Ga0501075_0174528
1226 Ga0501075_1232166
1227 Ga0501077_0232490
1228 Ga0501079_0222198
1229 Ga0501079_1045652
1230 Ga0501080_0060984
1231 Ga0501080_0261358
1232 Ga0501081_0075505
1233 Ga0501081_0116209
1234 Ga0501081_0376651
1235 Ga0501081_0480612
1236 nmdc:mga03n38_699011_c1
1237 nmdc:mga0k408_2148_c1
1238 nmdc:mga06z11_235551_c1
1239 nmdc:mga06z11_248476_c1
1240 nmdc:mga04h51_205665_c1
1241 nmdc:mga05p37_125765_c1
1242 nmdc:mga05p37_136186_c1
1243 nmdc:mga05p37_197055_c1
1244 nmdc:mga05p37_309171_c1
1245 nmdc:mga05p37_335032_c1
1246 nmdc:mga05p37_567062_c1
1247 nmdc:mga05p37_651530_c1
1248 nmdc:mga05p37_898856_c1
1249 nmdc:mga09592_124395_c1
1250 nmdc:mga09592_496680_c1
1251 nmdc:mga0qj67_159526_c1
1252 nmdc:mga0qj67_230952_c1
1253 nmdc:mga0qj67_301528_c1
1254 nmdc:mga0qj67_343_c1
1255 nmdc:mga06r32_17698_c1
1256 nmdc:mga06r32_244423_c1
1257 nmdc:mga06r32_419452_c1
1258 nmdc:mga06r32_472017_c1
1259 nmdc:mga06r32_643935_c1
1260 nmdc:mga06r32_9480_c1
1261 nmdc:mga08y16_116365_c1
1262 nmdc:mga08y16_17788_c1
1263 nmdc:mga08y16_2073_c1
1264 nmdc:mga08y16_311248_c1
1265 nmdc:mga08y16_625208_c1
1266 nmdc:mga0n895_179708_c1
1267 nmdc:mga0n895_243509_c1
1268 nmdc:mga0n895_33522_c1
1269 nmdc:mga0n895_473021_c1
1270 nmdc:mga0n895_558750_c1
1271 nmdc:mga0n895_970687_c1
1272 nmdc:mga0rr50_340544_c1
1273 nmdc:mga0rr50_45835_c1
1274 nmdc:mga08x19_102755_c1
1275 nmdc:mga0a205_1292039_c1
1276 nmdc:mga0a205_182812_c1
1277 nmdc:mga0a205_283078_c1
1278 nmdc:mga0a205_32667_c1
1279 nmdc:mga0a205_40666_c1
1280 nmdc:mga0a205_862480_c1
1281 Ga0495601_0014121
1282 Ga0495601_1063304
1283 Ga0495619_0029691
1284 Ga0495619_0091797
1285 Ga0500566_0022261
1286 Ga0501084_0986713
1287 Ga0590071_000151
1288 Ga0590075_000018
1289 Ga0590077_000123
1290 Ga0501082_1242992
1291 Ga0530510_0181090
1292 Ga0530510_0438071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

32

166

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vgv-assembly6.cif.gz_L e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 0.9844 2 132
7jrj-assembly1.cif.gz_K chlamydomonas reinhardtii radial spoke head and neck (recombinant) 0.9837 1 134
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9834 2 135
7jtk-assembly1.cif.gz_i radial spoke 1 isolated from chlamydomonas reinhardtii 0.9831 1 134
2hur-assembly1.cif.gz_A escherichia coli nucleoside diphosphate kinase 0.9824 2 135
ID Description Score Start End Superfamily
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9836 2 132 3.30.70.141
af_A0A1D6EH51_54_191_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.977 17 132 3.30.70.141
af_O88425_6_161_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9722 2 134 3.30.70.141
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9716 2 77 3.30.70.141
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9709 1 132 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A2V9FQE4-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.003 2 130 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A7X3QGC6-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1.002 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A4R5P201-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1.002 2 130 GO:0004550
GO:0006183
GO:0006228
GO:0006241
AF-V6DH04-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 1.001 2 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A2V9Z6T5-F1-model_v4 Nucleoside-diphosphate kinase 1.001 2 117 GO:0004550
GO:0006183
GO:0006228
GO:0006241

Map